BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006K11

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763873.1|  PREDICTED: putative UDP-glucuronate:xylan al...    113   1e-26   Nicotiana sylvestris
ref|XP_009629284.1|  PREDICTED: putative UDP-glucuronate:xylan al...    113   2e-26   Nicotiana tomentosiformis
ref|XP_006356283.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   2e-24   Solanum tuberosum [potatoes]
ref|XP_006356282.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   2e-24   Solanum tuberosum [potatoes]
ref|XP_004237736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   9e-24   Solanum lycopersicum
emb|CDP18299.1|  unnamed protein product                              90.9    2e-18   Coffea canephora [robusta coffee]
ref|XP_011073953.1|  PREDICTED: putative UDP-glucuronate:xylan al...  87.8    2e-17   Sesamum indicum [beniseed]
ref|XP_003544084.1|  PREDICTED: putative UDP-glucuronate:xylan al...  81.6    2e-15   
gb|KHN04164.1|  Glycogenin-2                                          81.6    3e-15   Glycine soja [wild soybean]
gb|KDP43041.1|  hypothetical protein JCGZ_25227                       80.9    5e-15   Jatropha curcas
ref|XP_007199740.1|  hypothetical protein PRUPE_ppa002697mg           79.0    2e-14   Prunus persica
ref|XP_003518352.1|  PREDICTED: putative UDP-glucuronate:xylan al...  77.4    9e-14   Glycine max [soybeans]
gb|KHN41007.1|  Glycogenin-2                                          77.4    9e-14   Glycine soja [wild soybean]
ref|XP_004148815.1|  PREDICTED: putative UDP-glucuronate:xylan al...  77.0    9e-14   Cucumis sativus [cucumbers]
ref|XP_004166220.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...  77.0    9e-14   
ref|XP_004498382.1|  PREDICTED: putative UDP-glucuronate:xylan al...  76.6    2e-13   Cicer arietinum [garbanzo]
ref|XP_010664887.1|  PREDICTED: putative UDP-glucuronate:xylan al...  75.9    2e-13   Vitis vinifera
ref|XP_010664886.1|  PREDICTED: putative UDP-glucuronate:xylan al...  75.9    2e-13   Vitis vinifera
emb|CBI19971.3|  unnamed protein product                              75.5    3e-13   Vitis vinifera
ref|XP_008441557.1|  PREDICTED: putative UDP-glucuronate:xylan al...  75.5    4e-13   Cucumis melo [Oriental melon]
ref|XP_009360737.1|  PREDICTED: putative UDP-glucuronate:xylan al...  75.1    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_010245814.1|  PREDICTED: putative UDP-glucuronate:xylan al...  73.2    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002275240.2|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    4e-12   Vitis vinifera
ref|XP_007161486.1|  hypothetical protein PHAVU_001G073100g           72.4    5e-12   Phaseolus vulgaris [French bean]
ref|XP_010911799.1|  PREDICTED: putative UDP-glucuronate:xylan al...  69.3    5e-11   Elaeis guineensis
ref|XP_010911800.1|  PREDICTED: putative UDP-glucuronate:xylan al...  69.3    5e-11   Elaeis guineensis
emb|CBI37563.3|  unnamed protein product                              68.6    9e-11   Vitis vinifera
gb|AAX33316.1|  secondary cell wall-related glycosyltransferase f...  68.2    1e-10   Populus tremula x Populus tremuloides
ref|XP_010244020.1|  PREDICTED: putative UDP-glucuronate:xylan al...  68.2    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_002526157.1|  glycogenin, putative                             67.0    3e-10   Ricinus communis
ref|XP_007199738.1|  hypothetical protein PRUPE_ppa002694mg           66.6    4e-10   Prunus persica
ref|XP_008237655.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...  66.6    4e-10   Prunus mume [ume]
ref|XP_010999819.1|  PREDICTED: putative UDP-glucuronate:xylan al...  66.6    4e-10   Populus euphratica
ref|XP_006858468.1|  hypothetical protein AMTR_s00071p00107830        66.2    5e-10   Amborella trichopoda
ref|XP_007048327.1|  Plant glycogenin-like starch initiation prot...  66.2    6e-10   
ref|XP_007048325.1|  Plant glycogenin-like starch initiation prot...  66.2    6e-10   
ref|XP_007048326.1|  Plant glycogenin-like starch initiation prot...  66.2    6e-10   
ref|XP_011022956.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  66.2    6e-10   Populus euphratica
ref|XP_011022955.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  66.2    6e-10   Populus euphratica
ref|XP_011022954.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  66.2    6e-10   Populus euphratica
ref|XP_011022958.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  65.9    7e-10   Populus euphratica
ref|XP_011022957.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  65.9    7e-10   Populus euphratica
ref|XP_006607044.1|  PREDICTED: putative UDP-glucuronate:xylan al...  65.9    7e-10   
ref|XP_008798993.1|  PREDICTED: putative UDP-glucuronate:xylan al...  65.5    8e-10   Phoenix dactylifera
ref|XP_008798991.1|  PREDICTED: putative UDP-glucuronate:xylan al...  65.9    9e-10   
emb|CDY04633.1|  BnaC05g16710D                                        65.5    9e-10   
ref|XP_002310513.2|  hypothetical protein POPTR_0007s04030g           65.5    9e-10   
gb|AAX33317.1|  secondary cell wall-related glycosyltransferase f...  64.3    2e-09   Populus tremula x Populus tremuloides
ref|XP_010062155.1|  PREDICTED: putative UDP-glucuronate:xylan al...  63.9    3e-09   Eucalyptus grandis [rose gum]
ref|XP_008237654.1|  PREDICTED: putative UDP-glucuronate:xylan al...  63.5    5e-09   Prunus mume [ume]
ref|XP_007019402.1|  Plant glycogenin-like starch initiation prot...  61.2    1e-08   
ref|XP_002307022.2|  hypothetical protein POPTR_0005s06280g           61.6    2e-08   
ref|XP_006464622.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  61.2    2e-08   Citrus sinensis [apfelsine]
ref|XP_011007557.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  61.2    2e-08   Populus euphratica
ref|XP_010680014.1|  PREDICTED: putative UDP-glucuronate:xylan al...  61.2    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011007558.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  61.2    2e-08   Populus euphratica
ref|XP_011007559.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  61.2    3e-08   Populus euphratica
ref|XP_007019401.1|  Plant glycogenin-like starch initiation prot...  61.2    3e-08   
ref|XP_009360736.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009360735.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    3e-08   Pyrus x bretschneideri [bai li]
gb|KJB80584.1|  hypothetical protein B456_013G105100                  60.8    4e-08   Gossypium raimondii
ref|XP_004290562.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.1    6e-08   Fragaria vesca subsp. vesca
ref|XP_006472929.1|  PREDICTED: putative UDP-glucuronate:xylan al...  59.7    8e-08   Citrus sinensis [apfelsine]
ref|XP_006434392.1|  hypothetical protein CICLE_v10003328mg           59.7    8e-08   Citrus clementina [clementine]
gb|KDO58344.1|  hypothetical protein CISIN_1g006648mg                 59.3    1e-07   Citrus sinensis [apfelsine]
ref|XP_006578795.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  59.3    1e-07   Glycine max [soybeans]
gb|KHG12057.1|  Glycogenin-2                                          59.3    1e-07   Gossypium arboreum [tree cotton]
gb|KHG05573.1|  Glycogenin-2                                          59.3    1e-07   Gossypium arboreum [tree cotton]
ref|XP_007137705.1|  hypothetical protein PHAVU_009G148800g           59.3    1e-07   Phaseolus vulgaris [French bean]
gb|KHN09596.1|  Glycogenin-1                                          58.9    2e-07   Glycine soja [wild soybean]
ref|XP_006581757.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  58.9    2e-07   Glycine max [soybeans]
gb|KEH40452.1|  UDP-glucuronate:xylan alpha-glucuronosyltransferase   58.5    2e-07   Medicago truncatula
ref|XP_002307480.2|  hypothetical protein POPTR_0005s21030g           58.5    2e-07   Populus trichocarpa [western balsam poplar]
gb|KDP24792.1|  hypothetical protein JCGZ_25413                       57.8    4e-07   Jatropha curcas
ref|XP_010110482.1|  hypothetical protein L484_003528                 57.4    6e-07   
gb|KHG15344.1|  Glycogenin-2                                          56.2    1e-06   Gossypium arboreum [tree cotton]
ref|XP_010930628.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.8    1e-06   Elaeis guineensis
ref|XP_004502919.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  56.2    2e-06   Cicer arietinum [garbanzo]
ref|XP_009348499.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.8    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_002517237.1|  glycogenin, putative                             55.1    3e-06   
gb|KHG03827.1|  Glycogenin-2                                          55.1    3e-06   Gossypium arboreum [tree cotton]
gb|KHN31133.1|  Glycogenin-2                                          55.1    3e-06   Glycine soja [wild soybean]
gb|KJB60000.1|  hypothetical protein B456_009G284700                  54.7    4e-06   Gossypium raimondii
gb|KJB59999.1|  hypothetical protein B456_009G284700                  54.3    5e-06   Gossypium raimondii
ref|XP_003602583.1|  Secondary cell wall-related glycosyltransfer...  53.9    7e-06   Medicago truncatula
ref|XP_006485174.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.5    9e-06   
ref|XP_008373923.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    2e-05   
ref|XP_008373924.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    2e-05   
ref|XP_008373922.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    2e-05   
ref|XP_010539695.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.4    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010539696.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.4    2e-05   Tarenaya hassleriana [spider flower]
gb|KCW69223.1|  hypothetical protein EUGRSUZ_F02737                   52.4    2e-05   Eucalyptus grandis [rose gum]
ref|XP_008786543.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.0    3e-05   Phoenix dactylifera
gb|KJB40458.1|  hypothetical protein B456_007G064800                  50.8    7e-05   Gossypium raimondii
gb|KCW62287.1|  hypothetical protein EUGRSUZ_H04942                   50.4    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010025567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    1e-04   Eucalyptus grandis [rose gum]
gb|KFK44246.1|  hypothetical protein AALP_AA1G233800                  49.7    2e-04   Arabis alpina [alpine rockcress]
gb|KFK44245.1|  hypothetical protein AALP_AA1G233800                  49.7    2e-04   Arabis alpina [alpine rockcress]
ref|XP_008373920.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.7    2e-04   Malus domestica [apple tree]
ref|XP_009408314.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348497.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.3    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_009149665.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.9    3e-04   Brassica rapa
ref|XP_009149666.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.9    3e-04   
emb|CDY50243.1|  BnaA06g15200D                                        47.8    0.001   Brassica napus [oilseed rape]



>ref|XP_009763873.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana sylvestris]
Length=648

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +2

Query  92   GGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPIL  271
            G + GASP  IEPRQRLS ST  E+T+K+R LRSK +++G+K L SPTK+R+ TCKFP L
Sbjct  3    GSIVGASPSPIEPRQRLSVST--EETSKKRFLRSKVFRDGEKGLHSPTKNRNFTCKFPTL  60

Query  272  KLVFAVIALGALFTLWHSPAIHS  340
            KL+  VIALGA +TLWHSP I++
Sbjct  61   KLILGVIALGAFWTLWHSPTIYN  83



>ref|XP_009629284.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana tomentosiformis]
Length=648

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +2

Query  92   GGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPIL  271
            G + GASP  IEPRQRLS ST  E+T+K+R LRSK +++G+K L SPTK+R+ TCKFP L
Sbjct  3    GSIIGASPSPIEPRQRLSVST--EETSKKRFLRSKVFRDGEKGLHSPTKNRNFTCKFPTL  60

Query  272  KLVFAVIALGALFTLWHSPAIHS  340
            KL+  VIALGA +TLWHSP I++
Sbjct  61   KLILGVIALGAFWTLWHSPTIYN  83



>ref|XP_006356283.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X2 [Solanum tuberosum]
Length=642

 Score =   107 bits (267),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 70/88 (80%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG+L G G  SP  IEPRQRLS  T  E+T+KRR LRSK +++G++AL SPTK+R+ TC
Sbjct  1    MRGSLAG-GPPSP--IEPRQRLSVFT--EETSKRRFLRSKVFRDGERALHSPTKNRNFTC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            KFP +KL+  VIAL A+++LWHSPAI++
Sbjct  56   KFPTVKLILGVIALVAIWSLWHSPAIYN  83



>ref|XP_006356282.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X1 [Solanum tuberosum]
Length=648

 Score =   107 bits (267),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 70/88 (80%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG+L G G  SP  IEPRQRLS  T  E+T+KRR LRSK +++G++AL SPTK+R+ TC
Sbjct  1    MRGSLAG-GPPSP--IEPRQRLSVFT--EETSKRRFLRSKVFRDGERALHSPTKNRNFTC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            KFP +KL+  VIAL A+++LWHSPAI++
Sbjct  56   KFPTVKLILGVIALVAIWSLWHSPAIYN  83



>ref|XP_004237736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Solanum lycopersicum]
Length=648

 Score =   105 bits (262),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG+L G G  SP  IEPRQRLS  T  E+T+KRR LRSK +++G++AL SPTK+R+ TC
Sbjct  1    MRGSLAG-GPPSP--IEPRQRLSVFT--EETSKRRFLRSKVFRDGERALHSPTKNRNFTC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            KFP +KL+   IAL A+++LWHSPAI++
Sbjct  56   KFPTIKLILGFIALVAIWSLWHSPAIYN  83



>emb|CDP18299.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG LG    A+P  IEPR R+S  T SE+ NK++LLRSKS ++G+K L+SP ++R L C
Sbjct  1    MRGILGS--SANP--IEPRLRVS--TPSEEANKKKLLRSKSSRDGEKVLYSPRQERVLNC  54

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHSEISA  352
            KF  LKLV  +I LGA F   HSP I+   SA
Sbjct  55   KFTTLKLVLGIIILGAFFMTLHSPTIYEAESA  86



>ref|XP_011073953.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
Length=644

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+SP   EPR RLS   ++EDTNKRR LR+K+ K+GD++L+  +  R  +CKFP LKLV 
Sbjct  3    GSSPTSGEPRHRLS--FNNEDTNKRRFLRNKALKDGDRSLYLSSLGRIFSCKFPALKLVM  60

Query  284  AVIALGALFTLWHSPAIH  337
             +I +GA FTL  SP+IH
Sbjct  61   VIIVIGAFFTLLRSPSIH  78



>ref|XP_003544084.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Glycine max]
Length=574

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  IEPR R SSS+ SEDT KRR  RSK +K+ +K L  P +DRS+TC+ P  KLV 
Sbjct  3    GPSPSTIEPRYR-SSSSFSEDTGKRRSQRSKDFKDVEKVLHIPFQDRSITCR-PNWKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG L T++H PA+++
Sbjct  61   VIIVLGTLVTIFHPPAVYN  79



>gb|KHN04164.1| Glycogenin-2 [Glycine soja]
Length=643

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  IEPR R SSS+ SEDT KRR  RSK +K+ +K L  P +DRS+TC+ P  KLV 
Sbjct  3    GPSPSTIEPRYR-SSSSFSEDTGKRRSQRSKDFKDVEKVLHIPFQDRSITCR-PNWKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG L T++H PA+++
Sbjct  61   VIIVLGTLVTIFHPPAVYN  79



>gb|KDP43041.1| hypothetical protein JCGZ_25227 [Jatropha curcas]
Length=647

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +2

Query  101  GGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLV  280
            G +SP  +EPR RLS+ST  E+TN+R+ LR +S ++ +KA   P + R+L CK   LK V
Sbjct  3    GSSSPSPVEPRHRLSTST--EETNRRKFLRDRSLRDVEKAFQVPIQYRNLNCKIATLKFV  60

Query  281  FAVIALGALFTLWHSPAIH  337
              VI LG+L TL+HSP ++
Sbjct  61   LVVIVLGSLVTLFHSPVVY  79



>ref|XP_007199740.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
 gb|EMJ00939.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
Length=644

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  IEPR RLSSS ++ED+NKRR  R+K  K+ +K L  P +DR+L CK P LKLV 
Sbjct  3    GPSPSPIEPRHRLSSS-ANEDSNKRRPQRNKVLKDIEKVLHVPAQDRNLNCK-PTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             VI LG   TL+ SPA++S
Sbjct  61   VVIILGTFVTLFVSPAVYS  79



>ref|XP_003518352.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Glycine max]
Length=644

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +EPR R SSS+ SEDT KRR  R K +K+ +KAL  P +DR +TC+ P  KLV 
Sbjct  3    GPSPSSVEPRHR-SSSSFSEDTGKRRSQRIKDFKDVEKALHIPFQDRIITCR-PNWKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG L T++H PA+++
Sbjct  61   VIIVLGTLVTIFHPPAVYN  79



>gb|KHN41007.1| Glycogenin-2 [Glycine soja]
Length=644

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +EPR R SSS+ SEDT KRR  R K +K+ +KAL  P +DR +TC+ P  KLV 
Sbjct  3    GPSPSSVEPRHR-SSSSFSEDTGKRRSQRIKDFKDVEKALHIPFQDRIITCR-PNWKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG L T++H PA+++
Sbjct  61   VIIVLGTLVTIFHPPAVYN  79



>ref|XP_004148815.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cucumis sativus]
 gb|KGN47482.1| hypothetical protein Csa_6G338140 [Cucumis sativus]
Length=634

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  113  PGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVI  292
            P  IEPR RLSSS + E+T+KRR  R + +K  ++AL  P +DR L CK P LKLV  +I
Sbjct  6    PSPIEPRHRLSSSFN-EETSKRRFQRIRDFKVVERALHIPIRDRVLNCK-PSLKLVLVII  63

Query  293  ALGALFTLWHSPAIH  337
            ALG + T +HSPA+H
Sbjct  64   ALGTIVTCFHSPAVH  78



>ref|XP_004166220.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3-like [Cucumis sativus]
Length=634

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  113  PGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVI  292
            P  IEPR RLSSS + E+T+KRR  R + +K  ++AL  P +DR L CK P LKLV  +I
Sbjct  6    PSPIEPRHRLSSSFN-EETSKRRFQRIRDFKVVERALHIPIRDRVLNCK-PSLKLVLVII  63

Query  293  ALGALFTLWHSPAIH  337
            ALG + T +HSPA+H
Sbjct  64   ALGTIVTCFHSPAVH  78



>ref|XP_004498382.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cicer arietinum]
Length=644

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +P  +EPR RLS+S S EDT+KRR  R+K  K+ +KAL  P +DRS+ C+ P  K+V 
Sbjct  3    GPAPNTVEPRHRLSTSFS-EDTSKRRSQRNKDLKDVEKALHFPFQDRSINCR-PNWKIVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG L T++H PA+++
Sbjct  61   VIIILGTLLTIFHPPAVYN  79



>ref|XP_010664887.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Vitis vinifera]
Length=642

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +E R RLS+S   E+ +KRRL RSK  K+ +KA   P ++R+  CKFP LKLV 
Sbjct  3    GPSPSPLETRLRLSAS--GEEGSKRRLQRSKDSKDVEKASHVPIQERNSNCKFPTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I  G   TL HSPA+H+
Sbjct  61   VIIICGTFVTLLHSPAVHN  79



>ref|XP_010664886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Vitis vinifera]
Length=643

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +E R RLS+S   E+ +KRRL RSK  K+ +KA   P ++R+  CKFP LKLV 
Sbjct  3    GPSPSPLETRLRLSAS--GEEGSKRRLQRSKDSKDVEKASHVPIQERNSNCKFPTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I  G   TL HSPA+H+
Sbjct  61   VIIICGTFVTLLHSPAVHN  79



>emb|CBI19971.3| unnamed protein product [Vitis vinifera]
Length=558

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +E R RLS+S   E+ +KRRL RSK  K+ +KA   P ++R+  CKFP LKLV 
Sbjct  3    GPSPSPLETRLRLSAS--GEEGSKRRLQRSKDSKDVEKASHVPIQERNSNCKFPTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             +I  G   TL HSPA+H+
Sbjct  61   VIIICGTFVTLLHSPAVHN  79



>ref|XP_008441557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis melo]
Length=634

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  113  PGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVI  292
            P  IEPR RLSSS + E+T+KRR  R + +K  ++AL  P +DR L CK P LKLV  +I
Sbjct  6    PSPIEPRHRLSSSFN-EETSKRRFQRIRDFKVVERALHIPIRDRVLNCK-PSLKLVLVII  63

Query  293  ALGALFTLWHSPAIH  337
             LG + T +HSPA+H
Sbjct  64   VLGTIVTCFHSPAVH  78



>ref|XP_009360737.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=644

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
             +SP  IEPR RLS+S +S+D+NKRR  R+K +K+ +K L  P +DR+L CK P LKLV 
Sbjct  3    ASSPTPIEPRHRLSAS-ASDDSNKRRPQRNKDFKDIEKFLHVPVQDRTLNCK-PTLKLVL  60

Query  284  AVIALGALFTLWHSPAIH  337
            AVI LG   TL  SP ++
Sbjct  61   AVILLGTFLTLIFSPGVY  78



>ref|XP_010245814.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245816.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245817.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245818.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245820.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
Length=646

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG +G +    P  +E R RLS S   +DTNKRR  R+K +K+ +K      +DR+  C
Sbjct  1    MRGAVGTL----PSPVEARHRLSGSI--DDTNKRRFQRNKDFKDVEKHFQVSIQDRNRNC  54

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHSE  343
            KF  LKLV  +I  G   T  HSPA+++E
Sbjct  55   KFLSLKLVLVIIIFGTFLTFLHSPAVYNE  83



>ref|XP_002275240.2| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Vitis vinifera]
Length=640

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG +G     SP  IE RQRLS S   EDT KRR  RSK   E  K    P +DRS  C
Sbjct  1    MRGAMGST--QSP--IEARQRLSVSI--EDTYKRRSQRSKVKDE--KPFHIPIQDRSTKC  52

Query  257  KFPILKLVFAVIALGALFTLWHSPAI  334
            KFP LKLV  +I  G   TL++SPA+
Sbjct  53   KFPALKLVLVIIVCGTFITLFYSPAV  78



>ref|XP_007161486.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
 gb|ESW33480.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
Length=645

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +EPR R SSS+ SEDT+KRR  RS+ +K+ +K L +P ++RS+TC+ P  KLV 
Sbjct  3    GLSPNFVEPRYR-SSSSFSEDTSKRRSQRSRDFKDVEKVLHTPFQERSITCR-PNWKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             ++ LG L T++H PA+++
Sbjct  61   VIVTLGTLVTIFHPPAVYN  79



>ref|XP_010911799.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=665

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-TKDRSLTCKFPILKLV  280
            GASPG +E R R  S+ +++D NKRR  RS+ +KE DK  FS    +RS +CKF  LKLV
Sbjct  28   GASPGNVEARHR--SAGTNDDENKRRTRRSRVFKEVDK--FSILISERSSSCKFHSLKLV  83

Query  281  FAVIALGALFTLWHSPAIHSE  343
              +I  G + TL +SPA+H+E
Sbjct  84   LVIIICGTILTLLYSPAVHNE  104



>ref|XP_010911800.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
 ref|XP_010911801.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
Length=639

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-TKDRSLTCKFPILKLV  280
            GASPG +E R R  S+ +++D NKRR  RS+ +KE DK  FS    +RS +CKF  LKLV
Sbjct  2    GASPGNVEARHR--SAGTNDDENKRRTRRSRVFKEVDK--FSILISERSSSCKFHSLKLV  57

Query  281  FAVIALGALFTLWHSPAIHSE  343
              +I  G + TL +SPA+H+E
Sbjct  58   LVIIICGTILTLLYSPAVHNE  78



>emb|CBI37563.3| unnamed protein product [Vitis vinifera]
Length=568

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G++   IE RQRLS S   EDT KRR  RSK   E  K    P +DRS  CKFP LKLV 
Sbjct  2    GSTQSPIEARQRLSVSI--EDTYKRRSQRSKVKDE--KPFHIPIQDRSTKCKFPALKLVL  57

Query  284  AVIALGALFTLWHSPAI  334
             +I  G   TL++SPA+
Sbjct  58   VIIVCGTFITLFYSPAV  74



>gb|AAX33316.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=649

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG   GV   S    EPR R  SS  +ED ++RR LR +  ++ +KA   P + ++L C
Sbjct  1    MRGV--GVTSPSSSSAEPRHR--SSAFNEDASRRRFLRGRDLRDVEKAFQVPIQYKNLNC  56

Query  257  KFPILKLVFAVIALGALFTLWHSPAIH  337
            K   LK+V  +IA G L T +HSP ++
Sbjct  57   KISTLKVVLLIIAFGTLVTFYHSPVVY  83



>ref|XP_010244020.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244021.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244022.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244023.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244024.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
Length=648

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG +G    +S   +E R RLS S   +DTNKRR  RSK +K+  K   +  + R+  C
Sbjct  2    MRGAIG----SSQSPMEARHRLSGSV--DDTNKRRFHRSKDFKDVGKHFQALVQYRNRNC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHSE  343
            KF  +KLV  +I  G   T  HSPA+++E
Sbjct  56   KFLSMKLVLVIILFGTFLTFLHSPAVYNE  84



>ref|XP_002526157.1| glycogenin, putative [Ricinus communis]
 gb|EEF36233.1| glycogenin, putative [Ricinus communis]
Length=656

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +2

Query  122  IEPRQRLSSST---SSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVI  292
            IEPR RLSS+    S    ++R+ LR + +K+ +KAL    + R+L CK   LKLV  VI
Sbjct  16   IEPRHRLSSTAEEISGSSNSRRKFLRERGFKDVEKALSGSFQYRNLKCKITTLKLVLVVI  75

Query  293  ALGALFTLWHSPAIH  337
            AL  L T +HSP ++
Sbjct  76   ALATLVTFFHSPPVY  90



>ref|XP_007199738.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
 gb|EMJ00937.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
Length=644

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +EPR RLS S ++ED NKRR  R+K  K+ +KAL     DR L CK P LKLV 
Sbjct  3    GPSPSPVEPRHRLSGS-ANEDANKRRSQRNKVLKDIEKALHVHATDRILNCK-PTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             ++  G   TL+ S A+++
Sbjct  61   IILVFGTFVTLFLSSAVYN  79



>ref|XP_008237655.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3 [Prunus mume]
Length=644

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +EPR RLS S ++ED NKRR  R+K  K+ +KAL     DR L CK P LKLV 
Sbjct  3    GPSPSPVEPRHRLSGS-ANEDANKRRSQRNKVLKDIEKALHVHATDRILNCK-PTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             ++  G   TL+ S A+++
Sbjct  61   IILVFGTFVTLFLSSAVYN  79



>ref|XP_010999819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Populus euphratica]
Length=649

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG   GV   S    EPR R   S  +ED ++RR LR +  ++ +KA   P + ++L C
Sbjct  1    MRGV--GVTSPSSSSAEPRHR--PSAFNEDASRRRFLRGRDLRDVEKAFQVPIQYKNLNC  56

Query  257  KFPILKLVFAVIALGALFTLWHSPAIH  337
            K   LK+V  +IA G L T +HSP ++
Sbjct  57   KISTLKVVLLIIAFGTLVTFYHSPVVY  83



>ref|XP_006858468.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
 gb|ERN19935.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
Length=640

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = +2

Query  89   LGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPI  268
            + G+ GA P  +EPR R +    S   +KRR+ R    ++ DKA+F+P +DR+ +CK   
Sbjct  1    MRGLSGALPSPVEPRHRQAGLLDS--GSKRRIQRLTDLEDTDKAIFNPVQDRNSSCKLCS  58

Query  269  LKLVFAVIALGALFTLWHSPAIH  337
            LKLV  +I  G   TL HSP  H
Sbjct  59   LKLVLVLIICGTFLTLLHSPTFH  81



>ref|XP_007048327.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
 gb|EOX92484.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
Length=621

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILK  274
            GV G SPG +E R RLS+S   E   KRRL ++K  K  +K    P +DR+  CK+P+LK
Sbjct  13   GVMGNSPGSVETRHRLSASI--EAIYKRRLNKNK-VKGVEKPFHIPIQDRNSCCKYPLLK  69

Query  275  LVFAVIALGALFTLWHSPAI-HSE  343
            LV  +I  G   TL +SP + HS+
Sbjct  70   LVLVIIVCGTFVTLLYSPEVYHSD  93



>ref|XP_007048325.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOX92482.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
Length=648

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILK  274
            GV G SPG +E R RLS+S   E   KRRL ++K  K  +K    P +DR+  CK+P+LK
Sbjct  13   GVMGNSPGSVETRHRLSASI--EAIYKRRLNKNK-VKGVEKPFHIPIQDRNSCCKYPLLK  69

Query  275  LVFAVIALGALFTLWHSPAI-HSE  343
            LV  +I  G   TL +SP + HS+
Sbjct  70   LVLVIIVCGTFVTLLYSPEVYHSD  93



>ref|XP_007048326.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
 gb|EOX92483.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
Length=653

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  95   GVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILK  274
            GV G SPG +E R RLS+S   E   KRRL ++K  K  +K    P +DR+  CK+P+LK
Sbjct  13   GVMGNSPGSVETRHRLSASI--EAIYKRRLNKNK-VKGVEKPFHIPIQDRNSCCKYPLLK  69

Query  275  LVFAVIALGALFTLWHSPAI-HSE  343
            LV  +I  G   TL +SP + HS+
Sbjct  70   LVLVIIVCGTFVTLLYSPEVYHSD  93



>ref|XP_011022956.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=631

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K +  P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPINIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>ref|XP_011022955.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=636

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K +  P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPINIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>ref|XP_011022954.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=637

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K +  P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPINIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>ref|XP_011022958.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X5 [Populus euphratica]
Length=630

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K +  P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPINIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>ref|XP_011022957.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X4 [Populus euphratica]
Length=631

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K +  P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPINIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>ref|XP_006607044.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like, partial [Glycine max]
Length=634

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +2

Query  149  STSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALFTLWHSP  328
            S  SEDT KRR  RSK +K+ +K L  P +DRS+TC+ P  KLV  +I LG L T++H P
Sbjct  8    SRCSEDTGKRRSQRSKDFKDVEKVLHIPFQDRSITCR-PNWKLVLVIIVLGTLVTIFHPP  66

Query  329  AIHS  340
            A+++
Sbjct  67   AVYN  70



>ref|XP_008798993.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
 ref|XP_008798994.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
Length=639

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-TKDRSLTCKFPILKLV  280
            GASPG +E R R  S+ +++D +KR+  RS+ +KE DK  FS    +RS +CKF  LKLV
Sbjct  2    GASPGNVEARHR--SAGTNDDASKRKTRRSRVFKEVDK--FSILISERSSSCKFHSLKLV  57

Query  281  FAVIALGALFTLWHSPAIHSE  343
              +I  G + TL +SPA+H+E
Sbjct  58   LVIIICGTILTLLYSPAVHNE  78



>ref|XP_008798991.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Phoenix dactylifera]
Length=665

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-TKDRSLTCKFPILKLV  280
            GASPG +E R R  S+ +++D +KR+  RS+ +KE DK  FS    +RS +CKF  LKLV
Sbjct  28   GASPGNVEARHR--SAGTNDDASKRKTRRSRVFKEVDK--FSILISERSSSCKFHSLKLV  83

Query  281  FAVIALGALFTLWHSPAIHSE  343
              +I  G + TL +SPA+H+E
Sbjct  84   LVIIICGTILTLLYSPAVHNE  104



>emb|CDY04633.1| BnaC05g16710D [Brassica napus]
Length=639

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKA-LFSPTKDRSLTCKFPILKLVFA  286
            SP  +EPR RLSS T  ++T+KRR LR++  K+ DK  L    + R+ T KF  LK+V  
Sbjct  5    SPSPVEPRHRLSSQT--DETSKRRSLRNRDAKDLDKGGLHGSFQYRNWTGKFSTLKVVLI  62

Query  287  VIALGALFTLWHSPAIH  337
            +I LG ++TL+ SPA+H
Sbjct  63   LIVLGTVYTLYRSPAVH  79



>ref|XP_002310513.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
 gb|EEE90963.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
Length=630

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG +E R RLS+S   ED  KRRL RSK  K  +K    P +DRS  CKFP++K + 
Sbjct  2    GGSPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPFNIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTIVSLLYSPDV  75



>gb|AAX33317.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=636

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G  PG +E R RLS+S   ED  KRRL RSK  K  +K    P +DRS  CKFP++K + 
Sbjct  2    GGPPGSVEARHRLSASF--EDLYKRRLTRSK-VKGVEKPFNIPIQDRSSCCKFPLIKFIL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIAGTIVSLLYSPDV  75



>ref|XP_010062155.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 ref|XP_010062156.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 gb|KCW69222.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=645

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG IEPR RLS+S S+++T KRR  RSK +K  +KA + P + R+L CK   LK+V 
Sbjct  3    GPSPGSIEPRHRLSTS-SNDETFKRRFQRSKYFKGVEKAFYLPIQARNLNCKISTLKVVL  61

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG   TL+ SPAI++
Sbjct  62   LIILLGTFLTLYCSPAIYN  80



>ref|XP_008237654.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Prunus mume]
Length=644

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  IEPR RLSSS ++ED+NKRR  R+K  K+ +K L  P +DR+L CK P LKLV 
Sbjct  3    GPSPSPIEPRHRLSSS-ANEDSNKRRPQRNKVLKDIEKVLHVPAQDRNLNCK-PTLKLVL  60

Query  284  AVIALGALFTLWHSPAIHS  340
             VI LG   TL+ SPA++S
Sbjct  61   VVILLGTFVTLFVSPAVYS  79



>ref|XP_007019402.1| Plant glycogenin-like starch initiation protein 2 isoform 2 [Theobroma 
cacao]
 gb|EOY16627.1| Plant glycogenin-like starch initiation protein 2 isoform 2 [Theobroma 
cacao]
Length=345

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R+S+S  +EDT++R   R+K +K+ +KAL  P + R+   K   LK V  +I LG 
Sbjct  10   EPRHRVSAS--AEDTSRRGFQRNKVFKDVEKALHVPIRYRNWNFKISTLKAVLVIILLGT  67

Query  305  LFTLWHSPAIH  337
            LFTL+ SPA++
Sbjct  68   LFTLFRSPAVY  78



>ref|XP_002307022.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
 gb|EEE94018.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
Length=631

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +PG +EPR RLS+S   ED  KRRL R K  K   K    P +DRS   KFP++KLV 
Sbjct  2    GGAPGSVEPRHRLSASF--EDLYKRRLTRYK-VKGVQKPFNIPIQDRSPCFKFPLIKLVL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTVVSLLYSPDV  75



>ref|XP_006464622.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Citrus sinensis]
Length=642

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = +2

Query  92   GGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPIL  271
            G   G S G +E R RLSSS   ED  KRR+ +SK  K  DK      +DR   CKFP+L
Sbjct  3    GAAMGNSTGSVEARHRLSSSI--EDIYKRRIKKSK-VKGIDKPFH--IQDRVSCCKFPLL  57

Query  272  KLVFAVIALGALFTLWHSPAIHS  340
            KLV  +I  G   TL +SP +++
Sbjct  58   KLVLVIIICGTFLTLMYSPEVYN  80



>ref|XP_011007557.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=636

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +PG +EPR RLS+S   ED  +RRL R K  K   K    P +DRS   KFP++KLV 
Sbjct  2    GGAPGSVEPRHRLSASF--EDLYRRRLTRYK-VKGVQKPFNIPVQDRSSCFKFPLIKLVL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTVVSLLYSPDV  75



>ref|XP_010680014.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Beta vulgaris subsp. vulgaris]
Length=648

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG++G    +SP  +E R RLS+S   E+++KRR LR +  ++ +KA  S   DRS   
Sbjct  1    MRGSIG----SSPKAVETRHRLSASV--EESSKRRSLRHRDNRDVEKASSSACHDRSFNF  54

Query  257  KFPILKLVFAVIALGALFTLWHSPAIH  337
            K+  LKL+  VI +G   TL +SP+  
Sbjct  55   KYSPLKLMLIVIMIGTFGTLLYSPSFQ  81



>ref|XP_011007558.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=631

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +PG +EPR RLS+S   ED  +RRL R K  K   K    P +DRS   KFP++KLV 
Sbjct  2    GGAPGSVEPRHRLSASF--EDLYRRRLTRYK-VKGVQKPFNIPVQDRSSCFKFPLIKLVL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTVVSLLYSPDV  75



>ref|XP_011007559.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=630

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +PG +EPR RLS+S   ED  +RRL R K  K   K    P +DRS   KFP++KLV 
Sbjct  2    GGAPGSVEPRHRLSASF--EDLYRRRLTRYK-VKGVQKPFNIPVQDRSSCFKFPLIKLVL  58

Query  284  AVIALGALFTLWHSPAI  334
             VI  G + +L +SP +
Sbjct  59   VVIIGGTVVSLLYSPDV  75



>ref|XP_007019401.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOY16626.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
Length=644

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R+S+S  +EDT++R   R+K +K+ +KAL  P + R+   K   LK V  +I LG 
Sbjct  10   EPRHRVSAS--AEDTSRRGFQRNKVFKDVEKALHVPIRYRNWNFKISTLKAVLVIILLGT  67

Query  305  LFTLWHSPAIH  337
            LFTL+ SPA++
Sbjct  68   LFTLFRSPAVY  78



>ref|XP_009360736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Pyrus x bretschneideri]
Length=639

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +2

Query  104  GASPGL--IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKL  277
            G SP    IEPR RLSS    EDTNKRR  R+K  K+ +KAL    ++R L CK P LKL
Sbjct  3    GPSPTTTPIEPRHRLSSP-PHEDTNKRRPQRNKVLKDIEKALHFHAQERILNCK-PTLKL  60

Query  278  VFAVIALGALFTLWHSPAIHS  340
            V  V+  G   TL+ S A+++
Sbjct  61   VLIVLVFGTFVTLFLSSAVYN  81



>ref|XP_009360735.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Pyrus x bretschneideri]
Length=640

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +2

Query  104  GASPGL--IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKL  277
            G SP    IEPR RLSS    EDTNKRR  R+K  K+ +KAL    ++R L CK P LKL
Sbjct  3    GPSPTTTPIEPRHRLSSP-PHEDTNKRRPQRNKVLKDIEKALHFHAQERILNCK-PTLKL  60

Query  278  VFAVIALGALFTLWHSPAIHS  340
            V  V+  G   TL+ S A+++
Sbjct  61   VLIVLVFGTFVTLFLSSAVYN  81



>gb|KJB80584.1| hypothetical protein B456_013G105100 [Gossypium raimondii]
Length=644

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+S    EPR R+S  T  EDT++R   R+K +K+ +K L  P + R+  CK   LK V 
Sbjct  3    GSSISPKEPRHRVS--TFFEDTSRRGFQRNKVFKDVEKDLNVPIRYRNWNCKISTLKAVL  60

Query  284  AVIALGALFTLWHSPAIH  337
             +I LG LFTL  SPA++
Sbjct  61   VIILLGTLFTLLCSPAVY  78



>ref|XP_004290562.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Fragaria vesca subsp. vesca]
Length=640

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SP  +EPR RLS+S S  D  KRR  R+K  K+ +K+L +  +DRSL CK P LKLV AV
Sbjct  5    SPSPVEPRHRLSASAS--DDAKRRPPRNK-VKDVEKSLTALAQDRSLNCK-PTLKLVLAV  60

Query  290  IALGALFTLWHSPAIH  337
            I +G   T   SP IH
Sbjct  61   IIVGTFATFLFSPVIH  76



>ref|XP_006472929.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            E R RLSSS  +E+T+KRR  R+K +K+ +KAL  P + R+   +   L++V  +I LG+
Sbjct  10   EARHRLSSS--NEETSKRRFPRNKYFKDVEKALHVPIQCRNFNFRISTLQVVLVIILLGS  67

Query  305  LFTLWHSPAIH  337
              TL+ SPA+H
Sbjct  68   FLTLFRSPAVH  78



>ref|XP_006434392.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
 gb|ESR47632.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
Length=638

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            E R RLSSS  +E+T+KRR  R+K +K+ +KAL  P + R+   +   L++V  +I LG+
Sbjct  10   EARHRLSSS--NEETSKRRFPRNKYFKDVEKALHVPIQCRNFNFRISTLQVVLVIILLGS  67

Query  305  LFTLWHSPAIH  337
              TL+ SPA+H
Sbjct  68   FLTLFRSPAVH  78



>gb|KDO58344.1| hypothetical protein CISIN_1g006648mg [Citrus sinensis]
Length=637

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 5/79 (6%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G S G +E R RLSSS   ED  KRR+ +SK  K  DK      +DR   CKFP+LKLV 
Sbjct  2    GNSTGSVEARHRLSSSI--EDIYKRRIKKSK-VKGIDKPFH--IQDRVSCCKFPLLKLVL  56

Query  284  AVIALGALFTLWHSPAIHS  340
             +I  G   TL +SP +++
Sbjct  57   VIIICGTFLTLMYSPEVYN  75



>ref|XP_006578795.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Glycine max]
 ref|XP_006578796.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Glycine max]
Length=639

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRGT+    G SP  +E R RL +S   ED  KRRL R+K+ K+ +K      +DRS  C
Sbjct  1    MRGTMSM--GTSPLAVEARHRLPASI--EDLYKRRLPRNKA-KDAEKPFHLSVQDRSSRC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            K   LKL+  +   G   TL +SP +++
Sbjct  56   KLSFLKLILLITICGIFVTLLYSPEVYN  83



>gb|KHG12057.1| Glycogenin-2 [Gossypium arboreum]
Length=646

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R+++S ++E+T++R   R+K +++ +KAL  P + R+  CK   LK+V  +I +G+
Sbjct  10   EPRHRVAAS-AAEETSRRGFQRNKVFRDVEKALHVPIRYRNWNCKISTLKVVLVIILVGS  68

Query  305  LFTLWHSPAIH  337
            L TL  SPA++
Sbjct  69   LITLLRSPAVY  79



>gb|KHG05573.1| Glycogenin-2 [Gossypium arboreum]
Length=644

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+S    EPR R+S+   SEDT++R   R+K +K+ +K L  P + R+  CK   LK V 
Sbjct  3    GSSISPKEPRHRVSAF--SEDTSRRGFQRNKVFKDVEKDLNVPIRYRNWNCKISTLKAVL  60

Query  284  AVIALGALFTLWHSPAIH  337
             +I LG LFTL   PA++
Sbjct  61   VIILLGTLFTLLCYPAVY  78



>ref|XP_007137705.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
 gb|ESW09699.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
Length=636

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRGT+G    ASP  +E R RL +S   ED  KRRL RSK+  E  K      +DRS  C
Sbjct  1    MRGTMG----ASPHSVEARHRLPASI--EDLYKRRLPRSKANAE--KPFHLSVQDRSSRC  52

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            K   LK +  +   G   TL +SP +++
Sbjct  53   KLSFLKFILLITISGTFVTLLYSPEVYN  80



>gb|KHN09596.1| Glycogenin-1 [Glycine soja]
Length=639

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRGT+    G SP  +E R RL +S   E+  KRRL RSK  K+ +K      +DRS  C
Sbjct  1    MRGTMSM--GNSPHAVEARHRLPASI--EELYKRRLPRSK-VKDAEKPFHLSVQDRSSRC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            K   LKL+  +   G   TL +SP +++
Sbjct  56   KLSFLKLILLITICGTFVTLLYSPEVYN  83



>ref|XP_006581757.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=639

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRGT+    G SP  +E R RL +S   E+  KRRL RSK  K+ +K      +DRS  C
Sbjct  1    MRGTMSM--GNSPHAVEARHRLPASI--EELYKRRLPRSK-VKDAEKPFHLSVQDRSSRC  55

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            K   LKL+  +   G   TL +SP +++
Sbjct  56   KLSFLKLILLITICGTFVTLLYSPEVYN  83



>gb|KEH40452.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=627

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  158  SEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALFTLWHSPAIH  337
            SEDT KRR  ++K +K+ +KA   P +DRS+ CK P  K++  +I LG L T++H PA++
Sbjct  2    SEDTTKRRSQKNKDFKDVEKASHIPFQDRSINCK-PNWKIILVIIVLGTLLTIFHPPAVY  60

Query  338  S  340
            +
Sbjct  61   N  61



>ref|XP_002307480.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|EEE94476.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=651

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R      +ED ++RR LR +  ++ +KA   P + ++L CK   LK+V  +IA G 
Sbjct  17   EPRLR--PFALNEDASRRRFLRGRDLRDVEKAFQVPIQYKNLNCKISTLKVVLLIIAFGT  74

Query  305  LFTLWHSPAIH  337
            L T +HSP ++
Sbjct  75   LVTFYHSPVVY  85



>gb|KDP24792.1| hypothetical protein JCGZ_25413 [Jatropha curcas]
Length=630

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SP  +E R RLSSS   ED  KRRL +SK  K  +K    P +DRS  CK P+LKL   +
Sbjct  4    SPATVEARHRLSSSI--EDIYKRRLQKSK-VKGSEKGFHVPIQDRSSCCKSPLLKLALII  60

Query  290  IALGALFTLWHSPAI  334
            +    +  L H P +
Sbjct  61   VICFTIIALMHPPEV  75



>ref|XP_010110482.1| hypothetical protein L484_003528 [Morus notabilis]
 gb|EXC26583.1| hypothetical protein L484_003528 [Morus notabilis]
Length=660

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  158  SEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALFTLWHSPAI-  334
            SED+NKRR  R+K +   +KAL  P +DR+L  K P LKLV  +I LG   TL+ SPAI 
Sbjct  37   SEDSNKRRSHRNKVFGHIEKALRIPVQDRNLNYK-PTLKLVLVIITLGTFVTLFLSPAIY  95

Query  335  HSE  343
            H+E
Sbjct  96   HTE  98



>gb|KHG15344.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG ++ R RLS+S   E   KRRL R+K    G K      +DR+  CK+P+LKLV 
Sbjct  3    GNSPGSVDTRHRLSASI--EAIYKRRLNRNKVKGTG-KPFHISVQDRNSCCKYPLLKLVL  59

Query  284  AVIALGALFTLWHSPAIHS  340
              I  G   +L +SP  ++
Sbjct  60   IAIVCGTFVSLLYSPEAYT  78



>ref|XP_010930628.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Elaeis guineensis]
Length=648

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G +   ++ R R++ + +  DT+KRR  R+  +KE  K +     +RS TCK   LKLV 
Sbjct  6    GFAAAPVDARHRMAGTPA--DTSKRRSHRNNDFKEAGKLVSILIPERSSTCKLRSLKLVL  63

Query  284  AVIALGALFTLWHSPAIH  337
             VI  G+   L HSPAIH
Sbjct  64   LVIICGSFLLLLHSPAIH  81



>ref|XP_004502919.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cicer arietinum]
Length=695

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 9/90 (10%)
 Frame = +2

Query  74   NMRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT  253
            NMRGT+G     SP  +E R RL +S   ED  KRR+ +SK  K+ +K      +DRS  
Sbjct  58   NMRGTMG----TSPRAVEARHRLPASI--EDLYKRRVPKSK-VKDVEKPFHLSIQDRSSK  110

Query  254  CKFPILKLVFAVIALGALFTLW-HSPAIHS  340
            CKF  LKL+  +I + A F ++ +SP +++
Sbjct  111  CKFSFLKLIL-LITISATFVMFLYSPEVYN  139



>ref|XP_009348499.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348515.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=631

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 15/78 (19%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
             +SP  IE R RLS+S +SED N+RR  R+K +K           DR+L    P LKLV 
Sbjct  3    ASSPAPIEHRHRLSAS-ASEDCNRRRPQRNKDFK-----------DRNLK---PTLKLVL  47

Query  284  AVIALGALFTLWHSPAIH  337
            AVI LG   TL+ SP +H
Sbjct  48   AVIILGTFLTLFFSPGVH  65



>ref|XP_002517237.1| glycogenin, putative [Ricinus communis]
 gb|EEF45137.1| glycogenin, putative [Ricinus communis]
Length=630

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  146  SSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALFTLWHS  325
            S+ +SED  KRR+ ++K  K  +K    P +D+S  CKFP+LKL   +I  G + TL HS
Sbjct  18   SNWNSEDIYKRRIQKNK-IKGAEKPFHIPIQDKSSCCKFPLLKLALVIIVCGTIVTLLHS  76

Query  326  PAI  334
            P +
Sbjct  77   PEV  79



>gb|KHG03827.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+S    EPR R+      EDT++R   R+K +K+ +K L  P + R+  CK   LK V 
Sbjct  3    GSSISPKEPRHRV------EDTSRRGFQRNKVFKDVEKDLNVPIRYRNWNCKISTLKAVL  56

Query  284  AVIALGALFTLWHSPAIH  337
             +I LG LFTL   PA++
Sbjct  57   VIILLGTLFTLLCYPAVY  74



>gb|KHN31133.1| Glycogenin-2 [Glycine soja]
Length=633

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SP  +E R RL +S   ED  KRRL R+K+ K+ +K      +DRS  CK   LKL+ 
Sbjct  2    GTSPLAVEARHRLPASI--EDLYKRRLPRNKA-KDAEKPFHLSVQDRSSRCKLSFLKLIL  58

Query  284  AVIALGALFTLWHSPAIHS  340
             +   G   TL +SP +++
Sbjct  59   LITICGIFVTLLYSPEVYN  77



>gb|KJB60000.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=645

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R ++++++E+T++R   R+K ++  +KAL  P + R+  CK   LK+V  +I +G+
Sbjct  10   EPRHR-AAASAAEETSRRGFQRNKVFRNVEKALHVPIRYRNWNCKISTLKVVLVIILVGS  68

Query  305  LFTLWHSPAIH  337
            L TL  SPA++
Sbjct  69   LITLLRSPAVY  79



>gb|KJB59999.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=646

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  125  EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGA  304
            EPR R ++++++E+T++R   R+K ++  +KAL  P + R+  CK   LK+V  +I +G+
Sbjct  10   EPRHR-AAASAAEETSRRGFQRNKVFRNVEKALHVPIRYRNWNCKISTLKVVLVIILVGS  68

Query  305  LFTLWHSPAIH  337
            L TL  SPA++
Sbjct  69   LITLLRSPAVY  79



>ref|XP_003602583.1| Secondary cell wall-related glycosyltransferase family [Medicago 
truncatula]
 gb|AES72834.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=637

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = +2

Query  95   GVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILK  274
            G+ G SP  +E R RL SS   ED  KR++ RSK  K+ +K      +DR+L CKF  LK
Sbjct  3    GIMGTSPRSVEARHRLPSSI--EDLYKRKVSRSK-VKDLEKPFHLSIQDRNLRCKFSFLK  59

Query  275  LVFAVIALGALFTLW-HSPAIHS  340
            L+  +I + A F ++ +SP I++
Sbjct  60   LIL-LITISATFVMFLYSPEIYN  81



>ref|XP_006485174.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  158  SEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALFTLWHSPAIH  337
            SE+T+KRR  R+K +K+ +KAL  P + R+   +   L++V  +I LG+  TL+ SPA+H
Sbjct  19   SEETSKRRFPRNKYFKDVEKALHVPIQCRNFNFRISTLQVVLVIILLGSFLTLFRSPAVH  78



>ref|XP_008373923.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=631

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 15/77 (19%)
 Frame = +2

Query  107  ASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFA  286
            +SP  IEPR RLS+S +SED ++RR  R++ +K           DR+L    P LKLV A
Sbjct  4    SSPTSIEPRHRLSAS-ASEDCSRRRPQRNRDFK-----------DRNLK---PTLKLVLA  48

Query  287  VIALGALFTLWHSPAIH  337
            VI LG   TL+ SP ++
Sbjct  49   VIILGTFLTLFFSPGVY  65



>ref|XP_008373924.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X3 [Malus domestica]
Length=625

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 15/77 (19%)
 Frame = +2

Query  107  ASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFA  286
            +SP  IEPR RLS+S +SED ++RR  R++ +K           DR+L    P LKLV A
Sbjct  4    SSPTSIEPRHRLSAS-ASEDCSRRRPQRNRDFK-----------DRNLK---PTLKLVLA  48

Query  287  VIALGALFTLWHSPAIH  337
            VI LG   TL+ SP ++
Sbjct  49   VIILGTFLTLFFSPGVY  65



>ref|XP_008373922.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 15/77 (19%)
 Frame = +2

Query  107  ASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFA  286
            +SP  IEPR RLS+S +SED ++RR  R++ +K           DR+L    P LKLV A
Sbjct  4    SSPTSIEPRHRLSAS-ASEDCSRRRPQRNRDFK-----------DRNLK---PTLKLVLA  48

Query  287  VIALGALFTLWHSPAIH  337
            VI LG   TL+ SP ++
Sbjct  49   VIILGTFLTLFFSPGVY  65



>ref|XP_010539695.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Tarenaya hassleriana]
Length=644

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SPG +EPR R+SSS+      +   LR +  K+ +K +    + R+   KFP LK+V A+
Sbjct  5    SPGPVEPRHRMSSSSEETSRRRS--LRYRDVKDVEKGVHGSFQYRNWNVKFPTLKVVLAL  62

Query  290  IALGALFTLWHSPAIH  337
            I LG LF L+HSPA++
Sbjct  63   IVLGTLFMLFHSPAVY  78



>ref|XP_010539696.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Tarenaya hassleriana]
Length=640

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SPG +EPR R+SSS+      +   LR +  K+ +K +    + R+   KFP LK+V A+
Sbjct  5    SPGPVEPRHRMSSSSEETSRRRS--LRYRDVKDVEKGVHGSFQYRNWNVKFPTLKVVLAL  62

Query  290  IALGALFTLWHSPAIH  337
            I LG LF L+HSPA++
Sbjct  63   IVLGTLFMLFHSPAVY  78



>gb|KCW69223.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=637

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G SPG IEP         S++T KRR  RSK +K  +KA + P + R+L CK   LK+V 
Sbjct  3    GPSPGSIEP---------SDETFKRRFQRSKYFKGVEKAFYLPIQARNLNCKISTLKVVL  53

Query  284  AVIALGALFTLWHSPAIHS  340
             +I LG   TL+ SPAI++
Sbjct  54   LIILLGTFLTLYCSPAIYN  72



>ref|XP_008786543.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=644

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G++   ++ R R + + +  DT+KRR  R   +KE DK +     +RS TCK   LK+V 
Sbjct  2    GSAAVPVDARHRTAGAPA--DTSKRRSHRGSDFKEADKFVSILIPERSSTCKLRSLKVVL  59

Query  284  AVIALGALFTLWHSPAI  334
             +I  G+   L HSPAI
Sbjct  60   IIIICGSFLMLLHSPAI  76



>gb|KJB40458.1| hypothetical protein B456_007G064800 [Gossypium raimondii]
Length=640

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 10/88 (11%)
 Frame = +2

Query  77   MRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTC  256
            MRG L       PG  + R RLS+S   E   KR+L R+K    G K      +DR+  C
Sbjct  1    MRGNL-------PGSADTRHRLSASI--EAIYKRQLNRNKVKGTG-KPFHISVQDRNSCC  50

Query  257  KFPILKLVFAVIALGALFTLWHSPAIHS  340
            K+P+LKLV   I  G   +L +SP  ++
Sbjct  51   KYPLLKLVLIAIVCGTFVSLLYSPEAYT  78



>gb|KCW62287.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=633

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+S   +E + RLS   S+ED +KR+L RSK    G K+L  P + +S  CKF +LK + 
Sbjct  2    GSSDDNLEIKHRLS--LSNEDIHKRKLQRSKPKGIG-KSLQLPLQYKSANCKFSLLKFLL  58

Query  284  AVIALGALFTLWHSPAIH  337
            AV   G L T+ + P ++
Sbjct  59   AVTICGTLATILYRPEVY  76



>ref|XP_010025567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 ref|XP_010025568.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 gb|KCW62286.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=639

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  104  GASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVF  283
            G+S   +E + RLS   S+ED +KR+L RSK    G K+L  P + +S  CKF +LK + 
Sbjct  2    GSSDDNLEIKHRLS--LSNEDIHKRKLQRSKPKGIG-KSLQLPLQYKSANCKFSLLKFLL  58

Query  284  AVIALGALFTLWHSPAIH  337
            AV   G L T+ + P ++
Sbjct  59   AVTICGTLATILYRPEVY  76



>gb|KFK44246.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=643

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SP  +EPR RLSS   +++T++RR LRS+  K+ +K +    + R+   KF  LK+V  +
Sbjct  5    SPSPVEPRHRLSSQ--ADETSRRRSLRSRDAKDLEKGVHGSFQYRNWNGKFSTLKVVLIL  62

Query  290  IALGALFTLWHSPAIH  337
            I LG ++TL+ SPA+H
Sbjct  63   IVLGTVYTLFRSPAVH  78



>gb|KFK44245.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=639

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAV  289
            SP  +EPR RLSS   +++T++RR LRS+  K+ +K +    + R+   KF  LK+V  +
Sbjct  5    SPSPVEPRHRLSSQ--ADETSRRRSLRSRDAKDLEKGVHGSFQYRNWNGKFSTLKVVLIL  62

Query  290  IALGALFTLWHSPAIH  337
            I LG ++TL+ SPA+H
Sbjct  63   IVLGTVYTLFRSPAVH  78



>ref|XP_008373920.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  131  RQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALF  310
            R RLSS    EDTNKRR  R+K  K+ +KAL    ++R+L CK   LKLV  ++  G   
Sbjct  14   RHRLSSP-PHEDTNKRRPQRNKVLKDIEKALHFHAQERALNCKL-TLKLVLIILVFGTFM  71

Query  311  TLWHSPAIHS  340
            TL+ S  +++
Sbjct  72   TLFLSSTVYN  81



>ref|XP_009408314.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=631

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 13/92 (14%)
 Frame = +2

Query  74   NMRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDK--ALFSPTKDRS  247
            NMRG    +  ASP L E R    SS  S++T+KR++ R +  +EGD+   +FS     S
Sbjct  2    NMRG----LNTASPNLAEGRY---SSAISDETSKRKM-RCRDSREGDRYRVMFSGW---S  50

Query  248  LTCKFPILKLVFAVIALGALFTLWHSPAIHSE  343
              CKF  LKL   V+   A  TL H PA H+E
Sbjct  51   SGCKFHSLKLALFVMTCCAALTLLHCPAAHNE  82



>ref|XP_009348497.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348516.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=646

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  131  RQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGALF  310
            R RLSS    EDTNKRR  R+K  K+ +KAL    ++R+L CK   LKLV  V+  G   
Sbjct  14   RHRLSSP-PHEDTNKRRPQRNKVLKDIEKALHFHAQERALNCKL-TLKLVLIVLVFGTFM  71

Query  311  TL  316
            TL
Sbjct  72   TL  73



>ref|XP_009149665.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Brassica rapa]
Length=643

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKA-LFSPTKDRSLTCKFPILKLVFA  286
            SP  +EPR RLSS T  ++++KRR LR++  K+ +K  L      R+ T KF  LK+V  
Sbjct  5    SPSPVEPRHRLSSQT--DESSKRRSLRNRDAKDLEKGGLHGSFHYRNWTGKFSTLKVVLL  62

Query  287  VIALGALFTLWHSPAIH  337
            +I LG ++TL+ SPA+H
Sbjct  63   LIVLGTVYTLYRSPAVH  79



>ref|XP_009149666.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Brassica rapa]
Length=639

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKA-LFSPTKDRSLTCKFPILKLVFA  286
            SP  +EPR RLSS T  ++++KRR LR++  K+ +K  L      R+ T KF  LK+V  
Sbjct  5    SPSPVEPRHRLSSQT--DESSKRRSLRNRDAKDLEKGGLHGSFHYRNWTGKFSTLKVVLL  62

Query  287  VIALGALFTLWHSPAIH  337
            +I LG ++TL+ SPA+H
Sbjct  63   LIVLGTVYTLYRSPAVH  79



>emb|CDY50243.1| BnaA06g15200D [Brassica napus]
Length=1035

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  110  SPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKA-LFSPTKDRSLTCKFPILKLVFA  286
            SP  +EPR RLSS T  ++++KRR LR++  K+ +K  L      R+ T KF  LK+V  
Sbjct  5    SPSPVEPRHRLSSQT--DESSKRRSLRNRDAKDLEKGGLHGSFHYRNWTAKFSTLKVVLL  62

Query  287  VIALGALFTLWHSPAIH  337
            +I LG ++TL+ SPA+H
Sbjct  63   LIVLGTVYTLYRSPAVH  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569837304960