BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006J05

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ84853.1|  unknown                                                 130   3e-36   Medicago truncatula
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    136   2e-35   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                135   3e-35   
gb|AFK40703.1|  unknown                                                 134   5e-35   Medicago truncatula
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                134   5e-35   Medicago truncatula
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    134   1e-34   Glycine max [soybeans]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    133   1e-34   Glycine max [soybeans]
ref|NP_001237048.1|  enzymatic resistance protein                       133   1e-34   
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    133   2e-34   Solanum tuberosum [potatoes]
ref|NP_001265946.1|  Hop-interacting protein THI032                     133   2e-34   Solanum lycopersicum
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      132   3e-34   Genlisea aurea
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     132   4e-34   Sesamum indicum [beniseed]
dbj|BAJ33858.1|  unnamed protein product                                132   5e-34   Eutrema halophilum
dbj|BAJ90006.1|  predicted protein                                      132   6e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             132   6e-34   Phaseolus vulgaris [French bean]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     132   6e-34   Triticum urartu
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    132   6e-34   Phaseolus vulgaris [French bean]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     131   8e-34   Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     131   9e-34   Nicotiana sylvestris
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  130   1e-33   Citrus sinensis [apfelsine]
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     128   2e-33   
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    130   2e-33   Cucumis sativus [cucumbers]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    130   2e-33   Sesamum indicum [beniseed]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    130   2e-33   Cucumis melo [Oriental melon]
gb|ABQ81925.1|  aminotransferase 2                                      130   2e-33   Cucumis melo [Oriental melon]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  130   3e-33   Citrus sinensis [apfelsine]
emb|CDX89604.1|  BnaC03g45180D                                          130   3e-33   
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    130   3e-33   Citrus sinensis [apfelsine]
emb|CDP08481.1|  unnamed protein product                                130   3e-33   Coffea canephora [robusta coffee]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            129   3e-33   Cucumis melo [Oriental melon]
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    129   3e-33   Brassica rapa
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             129   4e-33   
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           129   4e-33   Cucumis melo [Oriental melon]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     129   4e-33   Brassica rapa
emb|CDY37208.1|  BnaA09g08290D                                          129   4e-33   Brassica napus [oilseed rape]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    129   4e-33   Glycine max [soybeans]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     129   5e-33   Glycine soja [wild soybean]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           129   5e-33   Glycine max [soybeans]
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             129   6e-33   Citrus clementina [clementine]
gb|ABQ81922.1|  aminotransferase 2                                      129   6e-33   Cucumis sativus [cucumbers]
emb|CDX81443.1|  BnaC09g08540D                                          129   7e-33   
gb|ABQ81924.1|  aminotransferase 2                                      128   9e-33   Cucumis sativus [cucumbers]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     128   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     128   1e-32   Phoenix dactylifera
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      123   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     127   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     127   3e-32   Eucalyptus grandis [rose gum]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          127   4e-32   Amborella trichopoda
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    127   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ56193.1|  aminotransferase 2                                      126   5e-32   Cucumis melo [Oriental melon]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     126   6e-32   Tarenaya hassleriana [spider flower]
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    125   1e-31   Camelina sativa [gold-of-pleasure]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      125   2e-31   Spirodela polyrhiza
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             125   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     125   2e-31   Populus euphratica
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             125   2e-31   Capsella rubella
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     124   2e-31   Elaeis guineensis
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    124   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    124   3e-31   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  124   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062170.1|  Os08g0502700                                       124   3e-31   
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                124   3e-31   Morus notabilis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    124   3e-31   Oryza brachyantha
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             124   3e-31   
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    124   4e-31   Elaeis guineensis
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         124   5e-31   Ricinus communis
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    123   5e-31   Populus euphratica
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             121   1e-30   
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         122   2e-30   Jatropha curcas
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     122   2e-30   Malus domestica [apple tree]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    122   2e-30   Cucumis sativus [cucumbers]
gb|AAQ56192.1|  aminotransferase 1                                      122   2e-30   Cucumis melo [Oriental melon]
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     122   2e-30   
gb|AAL47679.1|  aminotransferase 1                                      122   2e-30   Cucumis melo [Oriental melon]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     122   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             121   3e-30   
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     121   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    120   6e-30   
ref|XP_002313371.1|  aminotransferase 2 family protein                  120   8e-30   
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             120   8e-30   Fritillaria agrestis
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                120   8e-30   Cucumis melo [Oriental melon]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       120   9e-30   Gossypium arboreum [tree cotton]
gb|ABK96624.1|  unknown                                                 120   9e-30   Populus trichocarpa x Populus deltoides
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     119   1e-29   Gossypium hirsutum [American cotton]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     119   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      119   2e-29   
gb|ADO24297.1|  aminotransferase                                        113   2e-29   Valeriana jatamansi
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     119   2e-29   Prunus mume [ume]
gb|ADO24296.1|  aminotransferase                                        112   2e-29   Valeriana jatamansi
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     116   6e-29   Piper nigrum
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          117   7e-29   Sorghum bicolor [broomcorn]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    116   7e-29   Gossypium raimondii
gb|KJB54389.1|  hypothetical protein B456_009G074800                    117   1e-28   Gossypium raimondii
gb|ACN36238.1|  unknown                                                 116   2e-28   Zea mays [maize]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             116   2e-28   Prunus persica
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     116   2e-28   Fragaria vesca subsp. vesca
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              116   2e-28   
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     115   2e-28   Peperomia prostrata
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       116   2e-28   Gossypium arboreum [tree cotton]
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     115   3e-28   Asarum caudatum
ref|NP_001148339.1|  LOC100281949                                       116   3e-28   Zea mays [maize]
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    116   3e-28   Cicer arietinum [garbanzo]
gb|ADG26437.1|  putative aminotransferase                               109   9e-28   Valeriana jatamansi
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    114   1e-27   Setaria italica
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    114   2e-27   
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     113   4e-27   Vitis vinifera
emb|CAN84001.1|  hypothetical protein VITISV_007680                     112   4e-27   Vitis vinifera
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     110   8e-27   Xymalos monospora
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     109   2e-26   Calycanthus occidentalis [California-allspice]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                110   3e-26   Medicago truncatula
gb|ABR16309.1|  unknown                                               99.0    4e-24   Picea sitchensis
ref|XP_001763095.1|  predicted protein                                  102   1e-23   
gb|ABF70331.1|  aminotransferase 1                                      100   8e-23   Cucumis sativus [cucumbers]
gb|ABR16109.1|  unknown                                               99.0    3e-22   Picea sitchensis
gb|ACN39798.1|  unknown                                               99.0    4e-22   Picea sitchensis
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375           99.0    4e-22   Selaginella moellendorffii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279           99.0    4e-22   Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                98.6    5e-22   
gb|ABK24112.1|  unknown                                               98.6    6e-22   Picea sitchensis
ref|XP_001783551.1|  predicted protein                                95.9    5e-21   
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...  92.8    2e-20   Zea mays [maize]
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074            92.8    3e-20   
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                   89.4    5e-19   Saururus cernuus [swamp lily]
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066           89.4    1e-18   Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964           89.4    1e-18   
ref|WP_017485211.1|  serine--glyoxylate aminotransferase              85.9    3e-17   Methylobacterium sp. MB200
ref|WP_018410273.1|  serine--glyoxylate aminotransferase              85.5    4e-17   Methyloversatilis thermotolerans
ref|WP_015950680.1|  serine--glyoxylate aminotransferase              85.1    4e-17   Methylorubrum extorquens
ref|WP_003597639.1|  serine--glyoxylate aminotransferase              85.1    4e-17   Methylobacteriaceae
ref|WP_012253362.1|  serine--glyoxylate aminotransferase              85.1    4e-17   Methylobacteriaceae
ref|WP_012453656.1|  serine--glyoxylate aminotransferase              85.1    4e-17   Methylorubrum populi
ref|XP_005709273.1|  serine--glyoxylate transaminase                  81.3    1e-15   Galdieria sulphuraria
ref|WP_007559580.1|  serine--glyoxylate aminotransferase              81.3    1e-15   Methylobacterium
ref|WP_040580464.1|  serine--glyoxylate aminotransferase              80.9    2e-15   
gb|AIQ91949.1|  Aminotransferase class V                              80.5    3e-15   Methylobacterium oryzae CBMB20
ref|WP_017840623.1|  serine--glyoxylate aminotransferase              80.1    3e-15   Methylomicrobium buryatense
ref|WP_026597137.1|  serine--glyoxylate aminotransferase              80.1    3e-15   Methylobacterium sp. 77
ref|WP_014149643.1|  serine--glyoxylate aminotransferase              79.7    4e-15   Methylomicrobium alcaliphilum
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...  79.7    5e-15   Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                         79.3    6e-15   Methylobacterium mesophilicum
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...  79.3    6e-15   Methylobacterium
ref|WP_036271184.1|  serine--glyoxylate aminotransferase              79.3    6e-15   Methyloversatilis universalis
ref|WP_020092657.1|  serine--glyoxylate aminotransferase              79.3    6e-15   Methylobacterium
ref|WP_042673896.1|  serine--glyoxylate aminotransferase              79.3    7e-15   Methylobacterium sp. B34
gb|ABM96214.1|  serine-glyoxylate aminotransferase                    79.3    7e-15   Methylibium petroleiphilum PM1
ref|WP_041930245.1|  serine--glyoxylate aminotransferase              79.0    8e-15   
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...  79.0    9e-15   Methylibium
ref|WP_027172630.1|  serine--glyoxylate aminotransferase              79.0    1e-14   Methylobacterium
ref|WP_026175686.1|  serine--glyoxylate aminotransferase              78.6    1e-14   Methylobacterium sp. 88A
ref|WP_043355705.1|  serine--glyoxylate aminotransferase              78.6    1e-14   Methylobacterium
ref|WP_026362994.1|  serine--glyoxylate aminotransferase              78.2    2e-14   Methylopila sp. M107
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...  77.8    2e-14   Methylobacter
ref|WP_020188076.1|  hypothetical protein                             77.8    2e-14   Methylopila sp. 73B
ref|WP_036253086.1|  serine--glyoxylate aminotransferase              77.8    2e-14   Methylobacter sp. BBA5.1
ref|XP_005648727.1|  serine glyoxylate aminotransferase               77.8    3e-14   Coccomyxa subellipsoidea C-169
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase              75.9    7e-14   
ref|WP_008058631.1|  serine--glyoxylate aminotransferase              76.3    7e-14   Methyloversatilis universalis
ref|WP_027156802.1|  serine--glyoxylate aminotransferase              76.3    8e-14   Methylobacter luteus
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                   74.7    8e-14   Manekia incurva
ref|WP_029644281.1|  serine--glyoxylate aminotransferase              76.3    9e-14   Methyloversatilis discipulorum
ref|WP_043363897.1|  serine--glyoxylate aminotransferase              76.3    9e-14   Methyloversatilis discipulorum
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                  75.9    1e-13   Methylobacterium aquaticum
ref|WP_026610206.1|  serine--glyoxylate aminotransferase              75.5    2e-13   Methylocaldum szegediense
ref|WP_031437003.1|  serine--glyoxylate aminotransferase              75.1    2e-13   Methylobacter tundripaludum
ref|WP_006890572.1|  serine--glyoxylate aminotransferase              75.1    2e-13   Methylobacter tundripaludum
ref|WP_003613273.1|  serine--glyoxylate aminotransferase              75.1    2e-13   Methylosinus
ref|WP_035937801.1|  serine--glyoxylate aminotransferase              75.1    2e-13   Caballeronia glathei
ref|WP_018267457.1|  serine--glyoxylate aminotransferase              75.1    2e-13   Methylosinus sp. LW4
ref|WP_028212654.1|  serine--glyoxylate aminotransferase              75.1    3e-13   Paraburkholderia mimosarum
ref|WP_035525480.1|  serine--glyoxylate aminotransferase              74.7    3e-13   Paraburkholderia sacchari
ref|WP_024298006.1|  serine--glyoxylate aminotransferase              74.7    3e-13   Methylosarcina lacus
ref|WP_028223486.1|  serine--glyoxylate aminotransferase              74.7    3e-13   Paraburkholderia oxyphila
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...  74.3    3e-13   Methylomicrobium agile
ref|WP_010960683.1|  serine--glyoxylate aminotransferase              74.3    4e-13   Methylococcus capsulatus
ref|WP_026223456.1|  serine--glyoxylate aminotransferase              73.6    6e-13   Methylosarcina fibrata
ref|WP_036293367.1|  serine--glyoxylate aminotransferase              73.6    7e-13   Methylosinus
ref|WP_007742731.1|  serine--glyoxylate aminotransferase              73.6    9e-13   Burkholderiaceae
ref|WP_016921634.1|  serine--glyoxylate aminotransferase              73.2    9e-13   Methylocystis parvus
ref|WP_007585769.1|  serine--glyoxylate aminotransferase              73.6    9e-13   Paraburkholderia hospita
ref|WP_035994918.1|  serine--glyoxylate aminotransferase              73.2    1e-12   Paraburkholderia caribensis
ref|WP_042306504.1|  serine--glyoxylate aminotransferase              73.2    1e-12   Paraburkholderia terrae
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                   71.2    1e-12   Thottea sp. JN-2013
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA         72.8    1e-12   Methyloglobulus morosus
ref|WP_029648781.1|  serine--glyoxylate aminotransferase              72.8    1e-12   Methylocystis sp. SB2
ref|WP_018405893.1|  serine--glyoxylate aminotransferase              72.8    1e-12   Methylocystis rosea
ref|WP_018238561.1|  serine--glyoxylate aminotransferase              72.4    2e-12   Ensifer sp. BR816
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    2e-12   Methylocystaceae
ref|WP_013819317.1|  serine--glyoxylate aminotransferase              72.0    2e-12   Methylomonas methanica
ref|WP_014890662.1|  serine--glyoxylate aminotransferase              72.0    3e-12   Methylocystis sp. SC2
ref|WP_012590731.1|  serine--glyoxylate aminotransferase              72.0    3e-12   Methylocella silvestris
ref|WP_019867322.1|  serine--glyoxylate aminotransferase              71.6    4e-12   Methylovulum miyakonense
ref|WP_028367172.1|  serine--glyoxylate aminotransferase              71.6    4e-12   Burkholderia sp. UYPR1.413
ref|WP_026608295.1|  serine--glyoxylate aminotransferase              71.2    5e-12   Methylocapsa acidiphila
ref|WP_003535479.1|  serine--glyoxylate aminotransferase              70.9    6e-12   Sinorhizobium meliloti
ref|WP_014762956.1|  serine--glyoxylate aminotransferase              70.9    6e-12   Sinorhizobium fredii
ref|WP_033156535.1|  serine--glyoxylate aminotransferase              70.9    7e-12   Methylomonas
ref|WP_036274731.1|  serine--glyoxylate aminotransferase              70.9    7e-12   Methylomonas
ref|WP_022947294.1|  serine--glyoxylate aminotransferase              70.5    8e-12   Methylohalobius crimeensis
ref|WP_026604426.1|  serine--glyoxylate aminotransferase              70.5    9e-12   Methylomonas sp. 11b
ref|WP_020482091.1|  serine--glyoxylate aminotransferase              70.5    9e-12   Methylomonas sp. MK1
ref|WP_031434945.1|  serine--glyoxylate aminotransferase              70.5    9e-12   Methylomarinum vadi
ref|WP_036260471.1|  serine--glyoxylate aminotransferase              70.5    1e-11   Methylocapsa aurea
ref|WP_014955398.1|  serine--glyoxylate aminotransferase              70.1    1e-11   alpha proteobacterium HIMB59
ref|WP_012405153.1|  serine--glyoxylate aminotransferase              70.5    1e-11   Paraburkholderia phymatum
ref|WP_037416404.1|  serine--glyoxylate aminotransferase              70.1    1e-11   Sinorhizobium sp. CCBAU 05631
ref|WP_028755163.1|  serine--glyoxylate aminotransferase              70.1    1e-11   Rhizobium leucaenae
ref|WP_014329402.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Sinorhizobium fredii
ref|WP_026622911.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Ensifer sp. WSM1721
ref|WP_018329867.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Rhizobium giardinii
ref|WP_034858116.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Ensifer sojae
ref|WP_027999163.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Sinorhizobium arboris
ref|WP_036284904.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Methylocystis sp. ATCC 49242
ref|WP_040961132.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Sinorhizobium fredii
ref|WP_026616975.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Sinorhizobium/Ensifer group
ref|WP_015933415.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Methylobacterium nodulans
ref|WP_026190999.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase              69.7    2e-11   Methylobacterium sp. 4-46
ref|WP_037399714.1|  serine--glyoxylate aminotransferase              66.2    2e-11   
ref|WP_012709136.1|  serine--glyoxylate aminotransferase              68.9    3e-11   Sinorhizobium fredii
emb|CBI24214.3|  unnamed protein product                              68.6    3e-11   Vitis vinifera
ref|WP_037429329.1|  hypothetical protein                             66.2    4e-11   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase              68.6    4e-11   Mesorhizobium australicum
ref|WP_037437029.1|  hypothetical protein                             66.2    5e-11   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase              68.2    6e-11   Roseivivax isoporae
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                   66.6    7e-11   Zippelia begoniifolia
ref|WP_037131645.1|  serine--glyoxylate aminotransferase              67.8    9e-11   Rhizobium sp. CF097
ref|WP_031597721.1|  serine--glyoxylate aminotransferase              67.4    1e-10   Ferrovum
ref|WP_006203221.1|  serine--glyoxylate aminotransferase              67.0    1e-10   Mesorhizobium amorphae
ref|WP_037384071.1|  serine--glyoxylate aminotransferase              67.0    2e-10   Sinorhizobium americanum
ref|WP_027163728.1|  serine--glyoxylate aminotransferase              66.6    2e-10   Mesorhizobium
ref|WP_024505109.1|  serine--glyoxylate aminotransferase              66.6    2e-10   Mesorhizobium
ref|XP_001702107.1|  serine glyoxylate aminotransferase               67.0    2e-10   Chlamydomonas reinhardtii
ref|WP_027168976.1|  serine--glyoxylate aminotransferase              66.6    2e-10   Mesorhizobium sp. WSM3224
ref|WP_027051273.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Mesorhizobium erdmanii
ref|XP_001702106.1|  serine glyoxylate aminotransferase               66.6    3e-10   Chlamydomonas reinhardtii
ref|WP_027061369.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Mesorhizobium loti
ref|WP_027029542.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Mesorhizobium loti
ref|WP_013529882.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Mesorhizobium ciceri
ref|WP_027044922.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Mesorhizobium sp. URHC0008
ref|WP_028097617.1|  serine--glyoxylate aminotransferase              66.2    3e-10   Dongia sp. URHE0060
ref|WP_043847105.1|  serine--glyoxylate aminotransferase              65.9    4e-10   Roseivivax marinus
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980            65.9    5e-10   Volvox carteri f. nagariensis
ref|WP_040618186.1|  serine--glyoxylate aminotransferase              65.5    5e-10   Roseovarius nubinhibens
ref|WP_023829410.1|  serine--glyoxylate aminotransferase              65.5    5e-10   Mesorhizobium sp. L103C120A0
ref|WP_023779196.1|  serine--glyoxylate aminotransferase              65.5    6e-10   Mesorhizobium sp. LNHC221B00
ref|WP_015317366.1|  serine--glyoxylate aminotransferase              65.5    6e-10   Mesorhizobium australicum
ref|WP_042643125.1|  serine--glyoxylate aminotransferase              65.1    6e-10   Mesorhizobium sp. ORS 3359
ref|WP_023670792.1|  serine--glyoxylate aminotransferase              65.1    6e-10   Mesorhizobium sp. LSJC285A00
ref|WP_010910076.1|  serine--glyoxylate aminotransferase              65.1    6e-10   Mesorhizobium japonicum
ref|WP_037133426.1|  serine--glyoxylate aminotransferase              65.1    7e-10   Rhizobium sp. CF097
ref|WP_023805485.1|  serine--glyoxylate aminotransferase              65.1    7e-10   Mesorhizobium sp. L2C089B000
ref|WP_023714322.1|  serine--glyoxylate aminotransferase              65.1    7e-10   Mesorhizobium sp. LSHC422A00
ref|WP_023782620.1|  serine--glyoxylate aminotransferase              64.7    9e-10   Mesorhizobium sp. LNHC220B00
ref|WP_023822176.1|  serine--glyoxylate aminotransferase              64.7    9e-10   Mesorhizobium sp. L2C054A000
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...  64.7    1e-09   Mesorhizobium
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase              64.3    1e-09   
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...  64.3    1e-09   Mesorhizobium
ref|WP_023690293.1|  serine--glyoxylate aminotransferase              64.3    1e-09   Mesorhizobium sp. LSJC269B00
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...  64.3    2e-09   Mesorhizobium
ref|WP_023700366.1|  serine--glyoxylate aminotransferase              64.3    2e-09   Mesorhizobium sp. LSJC264A00
ref|WP_023698325.1|  serine--glyoxylate aminotransferase              64.3    2e-09   Mesorhizobium sp. LSJC265A00
ref|WP_013894918.1|  serine--glyoxylate aminotransferase              64.3    2e-09   Mesorhizobium opportunistum
ref|WP_032930697.1|  serine--glyoxylate aminotransferase              64.3    2e-09   Mesorhizobium
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...  63.9    2e-09   Mesorhizobium
ref|WP_023818017.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium sp. L2C066B000
ref|WP_023827347.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium sp. L103C131B0
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...  63.9    2e-09   Mesorhizobium
ref|WP_023685219.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium sp. LSJC277A00
ref|WP_019858769.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium loti
ref|WP_040969922.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium sp. ORS 3324
ref|WP_010968118.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Sinorhizobium meliloti
ref|WP_041007618.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium plurifarium
ref|WP_041011880.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium plurifarium
ref|WP_040981991.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Mesorhizobium plurifarium
ref|WP_009211467.1|  serine--glyoxylate aminotransferase              63.9    2e-09   Aurantimonas manganoxydans
ref|WP_041003840.1|  serine--glyoxylate aminotransferase              63.5    2e-09   Mesorhizobium sp. SOD10
ref|WP_027146511.1|  serine--glyoxylate aminotransferase              63.5    2e-09   Mesorhizobium sp. WSM3626
ref|WP_038515723.1|  serine--glyoxylate aminotransferase              63.2    3e-09   Granulibacter bethesdensis
ref|WP_038511699.1|  serine--glyoxylate aminotransferase              63.2    3e-09   Granulibacter bethesdensis
ref|WP_011630756.1|  serine--glyoxylate aminotransferase              63.2    3e-09   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                   63.5    3e-09   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                      63.5    3e-09   
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                      63.5    3e-09   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase              63.2    3e-09   
ref|WP_023741624.1|  serine--glyoxylate aminotransferase              63.2    4e-09   
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...  63.2    4e-09   
ref|WP_023763335.1|  serine--glyoxylate aminotransferase              62.8    4e-09   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...  62.8    5e-09   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase              62.4    5e-09   
ref|WP_025312373.1|  serine--glyoxylate aminotransferase              62.4    6e-09   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...  62.4    6e-09   
gb|AEX09263.1|  alanine glyoxylate aminotransferase                   62.0    7e-09   
ref|WP_020592928.1|  hypothetical protein                             62.4    7e-09   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase              62.4    7e-09   
gb|AEX09256.1|  alanine glyoxylate aminotransferase                   62.0    8e-09   
gb|AEX09300.1|  alanine glyoxylate aminotransferase                   62.0    8e-09   
gb|AEX09255.1|  alanine glyoxylate aminotransferase                   62.0    9e-09   
gb|AEX09245.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09277.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09295.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09304.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09293.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09286.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09249.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09301.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09305.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09275.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09267.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09253.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09283.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09266.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09274.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09257.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09250.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09298.1|  alanine glyoxylate aminotransferase                   61.6    1e-08   
gb|AEX09268.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09273.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09270.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09248.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
gb|AEX09311.1|  alanine glyoxylate aminotransferase                   61.2    1e-08   
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...  61.6    1e-08   
gb|AEX09306.1|  alanine glyoxylate aminotransferase                   61.2    2e-08   
ref|WP_037283573.1|  serine--glyoxylate aminotransferase              61.2    2e-08   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase              61.2    2e-08   
ref|WP_040971898.1|  hypothetical protein                             57.4    2e-08   
gb|AEX09242.1|  alanine glyoxylate aminotransferase                   60.8    2e-08   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase               60.8    2e-08   
ref|WP_013217108.1|  serine--glyoxylate aminotransferase              60.5    3e-08   
ref|WP_015599474.1|  serine--glyoxylate aminotransferase              60.5    3e-08   
ref|WP_009817966.1|  serine--glyoxylate aminotransferase              60.5    3e-08   
gb|AEX09258.1|  alanine glyoxylate aminotransferase                   60.1    3e-08   
ref|WP_041319044.1|  serine--glyoxylate aminotransferase              60.1    4e-08   
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                    60.1    4e-08   
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.1    4e-08   
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.1    5e-08   
ref|WP_037268413.1|  serine--glyoxylate aminotransferase              59.7    5e-08   
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614            60.1    5e-08   
gb|AEX09252.1|  alanine glyoxylate aminotransferase                   59.3    5e-08   
gb|AEX09299.1|  alanine glyoxylate aminotransferase                   59.7    5e-08   
ref|WP_019140317.1|  serine--glyoxylate aminotransferase              59.7    5e-08   
gb|AEX09310.1|  alanine glyoxylate aminotransferase                   59.3    6e-08   
gb|AEX09251.1|  alanine glyoxylate aminotransferase                   59.3    6e-08   
gb|AEX09309.1|  alanine glyoxylate aminotransferase                   59.3    7e-08   
gb|AEX09244.1|  alanine glyoxylate aminotransferase                   59.3    7e-08   
gb|AEX09288.1|  alanine glyoxylate aminotransferase                   59.3    7e-08   
gb|AEX09282.1|  alanine glyoxylate aminotransferase                   58.9    7e-08   
gb|AEX09246.1|  alanine glyoxylate aminotransferase                   58.9    7e-08   
ref|WP_008280158.1|  serine--glyoxylate aminotransferase              59.3    7e-08   
gb|AEX09287.1|  alanine glyoxylate aminotransferase                   58.9    7e-08   
ref|WP_019015661.1|  hypothetical protein                             59.3    7e-08   
gb|AEX09262.1|  alanine glyoxylate aminotransferase                   58.9    7e-08   
gb|AEX09260.1|  alanine glyoxylate aminotransferase                   58.9    7e-08   
gb|AEX09294.1|  alanine glyoxylate aminotransferase                   58.9    8e-08   
gb|ABZ06639.1|  putative aminotransferase class-V                     59.3    8e-08   
gb|AEX09302.1|  alanine glyoxylate aminotransferase                   58.9    8e-08   
gb|AAY68344.1|  putative serine-pyruvate aminotransferase             59.3    8e-08   
gb|ABZ06421.1|  putative aminotransferase class-V                     58.5    9e-08   
gb|AEX09254.1|  alanine glyoxylate aminotransferase                   58.5    1e-07   
ref|WP_043231295.1|  aminotransferase                                 58.5    1e-07   
ref|WP_020022085.1|  serine--glyoxylate aminotransferase              58.5    1e-07   
ref|WP_020085137.1|  serine--glyoxylate aminotransferase              58.2    2e-07   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase              58.2    2e-07   
ref|WP_011520033.1|  serine--glyoxylate aminotransferase              57.8    2e-07   
ref|WP_024570173.1|  MULTISPECIES: serine--glyoxylate aminotransf...  57.8    2e-07   
ref|WP_037245168.1|  serine--glyoxylate aminotransferase              57.8    3e-07   
ref|WP_008641541.1|  MULTISPECIES: Serine-glyoxylate aminotransfe...  57.8    3e-07   
ref|WP_043619319.1|  serine--glyoxylate aminotransferase              57.4    3e-07   
gb|AEX09292.1|  alanine glyoxylate aminotransferase                   57.0    3e-07   
ref|WP_023666824.1|  serine--glyoxylate aminotransferase              57.4    3e-07   
ref|WP_029563940.1|  serine--glyoxylate aminotransferase              57.4    3e-07   
gb|AEX09276.1|  alanine glyoxylate aminotransferase                   57.0    4e-07   
ref|WP_037251090.1|  serine--glyoxylate aminotransferase              57.4    4e-07   
ref|WP_020683672.1|  hypothetical protein                             57.4    4e-07   
ref|WP_020203952.1|  serine--glyoxylate aminotransferase              57.0    4e-07   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase              57.0    5e-07   
ref|WP_044456571.1|  serine--glyoxylate aminotransferase              57.0    5e-07   
gb|AIU26350.1|  serine--glyoxylate aminotransferase                   57.0    5e-07   
ref|WP_023871906.1|  MULTISPECIES: serine--glyoxylate aminotransf...  57.0    5e-07   
ref|WP_043355494.1|  serine--glyoxylate aminotransferase              57.0    5e-07   
ref|WP_023594988.1|  serine--glyoxylate aminotransferase              57.0    5e-07   
ref|WP_026227793.1|  serine--glyoxylate aminotransferase              56.6    5e-07   
ref|WP_017235233.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_035864362.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_006156375.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_010239996.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_028431641.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|XP_003391858.1|  PREDICTED: serine--glyoxylate aminotransfera...  56.6    6e-07   
ref|WP_042112271.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_039404613.1|  serine--glyoxylate aminotransferase              56.6    6e-07   
ref|WP_005860686.1|  serine--glyoxylate aminotransferase              56.6    7e-07   
ref|WP_039396834.1|  serine--glyoxylate aminotransferase              56.6    7e-07   
ref|WP_026850920.1|  serine--glyoxylate aminotransferase              56.2    7e-07   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase              56.2    7e-07   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase              56.2    7e-07   
ref|WP_039365002.1|  serine--glyoxylate aminotransferase              56.2    7e-07   
ref|WP_010808567.1|  aminotransferase class V                         56.2    7e-07   
ref|WP_028465459.1|  aminotransferase                                 56.2    8e-07   
ref|WP_028222088.1|  serine--glyoxylate aminotransferase              56.2    8e-07   
ref|WP_043145903.1|  serine--glyoxylate aminotransferase              56.2    8e-07   
ref|WP_033390460.1|  serine--glyoxylate aminotransferase              56.2    8e-07   
ref|WP_019452138.1|  serine--glyoxylate aminotransferase              56.2    9e-07   
ref|WP_038008200.1|  MULTISPECIES: serine--glyoxylate aminotransf...  56.2    9e-07   
ref|WP_038367477.1|  aminotransferase                                 55.8    1e-06   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase              55.8    1e-06   
ref|WP_007351739.1|  serine--glyoxylate aminotransferase              55.8    1e-06   
ref|WP_006344742.1|  serine--glyoxylate aminotransferase              55.8    1e-06   
ref|WP_026641447.1|  serine--glyoxylate aminotransferase              55.8    1e-06   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase              55.8    1e-06   
ref|WP_044852944.1|  serine--glyoxylate aminotransferase              55.5    1e-06   
ref|WP_043513639.1|  serine--glyoxylate aminotransferase              55.5    1e-06   
ref|WP_028435927.1|  serine--glyoxylate aminotransferase              55.5    1e-06   
ref|WP_016417666.1|  serine--glyoxylate aminotransferase              55.5    1e-06   
ref|WP_037126267.1|  serine--glyoxylate aminotransferase              55.5    1e-06   
ref|WP_009816678.1|  serine--glyoxylate aminotransferase              55.5    2e-06   
ref|WP_033381446.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_030670113.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_043283947.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_020636555.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_005162865.1|  Serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_025250491.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_018441455.1|  serine--glyoxylate aminotransferase              55.1    2e-06   
ref|WP_039596641.1|  serine--glyoxylate aminotransferase              54.7    2e-06   
ref|WP_040052491.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_035960196.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_022540099.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_038514775.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_037336675.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_008840237.1|  class V aminotransferase                         53.5    3e-06   
ref|WP_013695939.1|  serine--glyoxylate aminotransferase              54.7    3e-06   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase              54.3    3e-06   
ref|WP_028232152.1|  serine--glyoxylate aminotransferase              54.3    3e-06   
ref|WP_029048453.1|  serine--glyoxylate aminotransferase              54.3    3e-06   
ref|WP_037276433.1|  serine--glyoxylate aminotransferase              54.3    4e-06   
ref|WP_028213467.1|  serine--glyoxylate aminotransferase              54.3    4e-06   
ref|WP_025240731.1|  serine--glyoxylate aminotransferase              54.3    4e-06   
ref|WP_035934120.1|  serine--glyoxylate aminotransferase              54.3    4e-06   
ref|WP_038304102.1|  aminotransferase                                 54.3    4e-06   
ref|WP_044426635.1|  serine--glyoxylate aminotransferase              54.3    4e-06   
dbj|GAM48945.1|  serine-glyoxylate aminotransferase                   51.2    4e-06   
ref|WP_027568361.1|  aminotransferase                                 53.9    4e-06   
ref|WP_027515062.1|  aminotransferase                                 53.9    4e-06   
ref|WP_018456620.1|  aminotransferase                                 53.9    4e-06   
ref|WP_007598984.1|  aminotransferase                                 53.9    4e-06   
ref|WP_007604432.1|  aminotransferase                                 53.9    4e-06   
ref|WP_042083882.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
emb|CDS49539.1|  Serine--glyoxylate aminotransferase                  54.3    5e-06   
ref|WP_007811273.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_042793828.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_026847044.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_029524545.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_008347825.1|  MULTISPECIES: serine--glyoxylate aminotransf...  53.9    5e-06   
ref|WP_037247820.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_007589233.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_037012125.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase              53.9    5e-06   
ref|WP_028225682.1|  serine--glyoxylate aminotransferase              53.9    6e-06   
ref|WP_016348046.1|  serine--glyoxylate aminotransferase              53.5    6e-06   
ref|WP_036812108.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_028356096.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
gb|ERJ17559.1|  serine-pyruvate transaminase protein                  50.4    7e-06   
ref|WP_037459311.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_013394209.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_013961473.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_018916328.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_036336347.1|  serine--glyoxylate aminotransferase              53.5    7e-06   
ref|WP_013742650.1|  serine--glyoxylate aminotransferase              53.5    8e-06   
ref|WP_019308043.1|  hypothetical protein                             53.5    8e-06   
ref|WP_042262893.1|  serine--glyoxylate aminotransferase              53.5    8e-06   
ref|WP_030485989.1|  serine--glyoxylate aminotransferase              53.1    8e-06   
gb|EDM31480.1|  aminotransferase, class V                             53.1    8e-06   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_037297923.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_025769740.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_009360050.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_007004225.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_014743098.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_007178671.1|  serine--glyoxylate aminotransferase              53.1    9e-06   
ref|WP_040808396.1|  serine--glyoxylate aminotransferase              53.1    1e-05   
ref|WP_031362107.1|  serine--glyoxylate aminotransferase              53.1    1e-05   
ref|WP_007873936.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_007351730.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_009796741.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_031228637.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_030358204.1|  MULTISPECIES: serine--glyoxylate aminotransf...  52.8    1e-05   
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase           52.8    1e-05   
ref|WP_012078301.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_008943383.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_039689210.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_020058450.1|  hypothetical protein                             52.8    1e-05   
gb|EST32977.1|  serine--glyoxylate aminotransferase                   52.8    1e-05   
ref|WP_014869691.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_042304495.1|  serine--glyoxylate aminotransferase              52.8    1e-05   
ref|WP_010441851.1|  serine--glyoxylate aminotransferase              52.4    1e-05   
ref|WP_027284153.1|  serine--glyoxylate aminotransferase              52.4    1e-05   
ref|WP_007744696.1|  serine--glyoxylate aminotransferase              52.4    2e-05   
ref|WP_035999058.1|  serine--glyoxylate aminotransferase              52.4    2e-05   
ref|WP_007587761.1|  serine--glyoxylate aminotransferase              52.4    2e-05   



>gb|ACJ84853.1| unknown [Medicago truncatula]
Length=91

 Score =   130 bits (326),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   136 bits (342),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/64 (95%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   135 bits (340),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   134 bits (338),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   134 bits (338),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   134 bits (336),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   133 bits (335),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   133 bits (335),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   133 bits (335),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   133 bits (334),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   132 bits (332),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   132 bits (331),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   132 bits (332),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  153  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  332
            KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37   KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  333  GTPFL  347
            GTPF+
Sbjct  97   GTPFM  101



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   132 bits (331),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   132 bits (331),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   132 bits (331),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   132 bits (331),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   131 bits (330),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   131 bits (329),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   130 bits (327),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   130 bits (327),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   130 bits (327),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   130 bits (326),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   130 bits (326),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   130 bits (326),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   130 bits (326),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   129 bits (325),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   129 bits (325),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   129 bits (324),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   129 bits (324),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   129 bits (324),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   129 bits (324),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   129 bits (323),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   128 bits (322),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPF  344
            TPF
Sbjct  61   TPF  63



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   128 bits (322),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   128 bits (322),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/64 (92%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ABR26028.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=198

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFL  347
            PFL
Sbjct  63   PFL  65



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  144  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  323
            E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57   ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  324  TTSGTPFL  347
            TT+GTPFL
Sbjct  117  TTTGTPFL  124



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   127 bits (318),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   127 bits (318),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   126 bits (317),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            T FL
Sbjct  61   TLFL  64



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   126 bits (316),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   125 bits (315),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   124 bits (312),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   124 bits (312),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   124 bits (312),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFL  347
            PFL
Sbjct  63   PFL  65



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1    MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   124 bits (311),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/63 (89%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFL  347
            PFL
Sbjct  63   PFL  65



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   124 bits (311),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   122 bits (306),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  336  TPFL  347
            T FL
Sbjct  61   TTFL  64



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   122 bits (306),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFL  347
            T FL
Sbjct  61   TTFL  64



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFL  347
            T FL
Sbjct  61   TTFL  64



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   120 bits (301),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  336  TPFL  347
            T FL
Sbjct  61   TTFL  64



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>gb|ADO24297.1| aminotransferase [Valeriana jatamansi]
Length=116

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>gb|ADO24296.1| aminotransferase [Valeriana jatamansi]
Length=91

 Score =   112 bits (280),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  58



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  339  PFL  347
            PFL
Sbjct  63   PFL  65



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFL  347
            PF+
Sbjct  63   PFM  65



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFL  347
            T F+
Sbjct  61   TSFM  64



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1    MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFL  347
            PF+
Sbjct  63   PFM  65



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFI  58



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFM  64



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFL
Sbjct  1    PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFL  58



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFL  347
            PF+
Sbjct  63   PFM  65



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1    MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|ADG26437.1| putative aminotransferase [Valeriana jatamansi]
Length=116

 Score =   109 bits (272),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNH+FVPG VNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHMFVPGLVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  339  PFL  347
            PF+
Sbjct  63   PFI  65



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38   DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  339  PFL  347
            PF+
Sbjct  98   PFI  100



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFL
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFL  58



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFV  58



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1    MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  336  TPFL  347
             PFL
Sbjct  61   IPFL  64



>gb|ABR16309.1| unknown [Picea sitchensis]
Length=83

 Score = 99.0 bits (245),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1    MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   100 bits (250),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FL
Sbjct  1    GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFL  57



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFL  347
            TPF+
Sbjct  61   TPFI  64



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  336  TPFL  347
            T F+
Sbjct  61   TSFI  64



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFL  347
            TPFL
Sbjct  61   TPFL  64



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  336  TPFL  347
            T F+
Sbjct  61   TSFI  64



>ref|XP_008666464.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
Length=229

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFM  53



>tpg|DAA47874.1| TPA: hypothetical protein ZEAMMB73_131074 [Zea mays]
Length=290

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFM  53



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  207  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+
Sbjct  1    VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFM  47



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFL  347
            T F+
Sbjct  61   TSFI  64



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFL  347
            T F+
Sbjct  61   TSFI  64



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEGTIFL  64



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT
Sbjct  6    GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGT  59



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEGTIFL  64



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEGTIFL  64



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEGTIFL  64



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEGTIFL  64



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+
Sbjct  5    GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFI  61



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAGTVIL  64



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+
Sbjct  10   PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFV  67



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  147  GEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKT  326
            G  M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +
Sbjct  39   GNIMAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGS  98

Query  327  TSGTPFL  347
            T+GT  L
Sbjct  99   TAGTVIL  105



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFI  59



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEGTIFL  64



>ref|WP_014149643.1| serine--glyoxylate aminotransferase [Methylomicrobium alcaliphilum]
 ref|YP_004918468.1| serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE24883.1| Serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
Length=387

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFI  59



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAGTVIL  64



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNGTVIL  64



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNGTVIL  64



>ref|WP_036271184.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
Length=396

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            GRNHL+VPGP N P++++RAM    ED+RSP  P LTK++L D+KK+FKTT GT
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELTKSVLADLKKVFKTTEGT  59



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAGTVIL  64



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAGTVIL  64



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP +
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPII  59



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP +
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPII  59



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP +
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPII  59



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEGTIFL  64



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T GT FL
Sbjct  7    PGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEGTIFL  64



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L + LL+D K +F +T+GT  L
Sbjct  7    PGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVRPLLQDSKMVFGSTAGTVIL  64



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFI  62



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFV  59



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFI  62



>ref|WP_036253086.1| serine--glyoxylate aminotransferase [Methylobacter sp. BBA5.1]
Length=388

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFV  59



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+
Sbjct  41   PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFI  98



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 14/64 (22%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+   PGRNHLFVPG              NNE++R+PA+ ALTKTLL+DVKKIFKTTS 
Sbjct  1    MDFAYGPGRNHLFVPG--------------NNENHRTPAITALTKTLLDDVKKIFKTTSR  46

Query  336  TPFL  347
             PFL
Sbjct  47   IPFL  50



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPF  344
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLTDLKKVFKTTEGTIF  61



>ref|WP_027156802.1| serine--glyoxylate aminotransferase [Methylobacter luteus]
Length=388

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFI  59



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL
Sbjct  2    RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  36



>ref|WP_029644281.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. FAM1]
Length=396

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPF  344
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLADLKKVFKTTEGTIF  61



>ref|WP_043363897.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
Length=396

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPF  344
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLADLKKVFKTTEGTIF  61



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL
Sbjct  7    PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFL  64



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+
Sbjct  2    PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFI  59



>ref|WP_031437003.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
Length=388

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFI  59



>ref|WP_006890572.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
 gb|EGW22602.1| Serine--glyoxylate transaminase [Methylobacter tundripaludum 
SV96]
Length=388

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFI  59



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT SG  F+
Sbjct  7    PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESGQAFI  64



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+
Sbjct  10   PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFI  67



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT SG  F+
Sbjct  7    PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESGQAFI  64



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSSRFPELANGVLSDLKRLYKTTSGQPFI  67



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFI  67



>ref|WP_024298006.1| serine--glyoxylate aminotransferase [Methylosarcina lacus]
Length=388

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KKIF+T +G  F+
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDMKKIFRTENGQCFI  59



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFI  67



>ref|WP_005371842.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylomicrobium]
 gb|EIC29744.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Methylomicrobium album BG8]
Length=388

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM    ED+RSP  PA+ K LLED+KK+F+T  G  F+
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPAIFKPLLEDMKKVFRTEKGQCFI  59



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+
Sbjct  2    PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFI  59



>ref|WP_026223456.1| serine--glyoxylate aminotransferase [Methylosarcina fibrata]
Length=390

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KK+F+T  G  F+
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDLKKVFRTEDGQCFI  59



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT +G  F+
Sbjct  7    PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTETGQAFI  64



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFI  67



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRN LFVPGP N+PD+++RAM   +ED+RSP  P L K L   +KK+F T  G
Sbjct  1    MQNSRVPGRNFLFVPGPTNLPDRIVRAMAVASEDHRSPTFPDLVKPLFPGLKKVFGTEKG  60

Query  336  TPFL  347
              F+
Sbjct  61   HAFI  64



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFI  67



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFI  67



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFI  67



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFL
Sbjct  1    RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFL  35



>ref|WP_023496630.1| serine--glyoxylate aminotransferase SgaA [Methyloglobulus morosus]
 gb|ESS66030.1| serine--glyoxylate aminotransferase SgaA [Methyloglobulus morosus 
KoM1]
Length=388

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P++V+ AM    ED+RSP  P L   LL+D+KKIF+T +G  F+
Sbjct  3    GRNHLYIPGPTNVPNEVLNAMHIAMEDHRSPIFPQLLTPLLQDLKKIFRTETGQAFI  59



>ref|WP_029648781.1| serine--glyoxylate aminotransferase [Methylocystis sp. SB2]
Length=397

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+PD+++RAM+  +ED+RSP  P L K L   +KKIF T  G  F+
Sbjct  7    PGKNFLFVPGPTNLPDRIVRAMSVASEDHRSPTFPDLVKPLFPGLKKIFGTEKGHAFI  64



>ref|WP_018405893.1| serine--glyoxylate aminotransferase [Methylocystis rosea]
Length=397

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+PD+++RAM+  +ED+RSP  P L K L   +KKIF T  G  F+
Sbjct  7    PGKNFLFVPGPTNLPDRIVRAMSVASEDHRSPTFPDLVKPLFPGLKKIFGTEKGHAFI  64



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFI  59



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT S   F+
Sbjct  7    PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESAQAFI  64



>ref|WP_013819317.1| serine--glyoxylate aminotransferase [Methylomonas methanica]
 gb|AEG01082.1| Serine--glyoxylate transaminase [Methylomonas methanica MC09]
Length=388

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K LLED+KK+F+T +G  F+
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPIFPNLFKPLLEDLKKVFRTEAGQCFV  59



>ref|WP_014890662.1| serine--glyoxylate aminotransferase [Methylocystis sp. SC2]
 emb|CCJ06629.1| Aminotransferase class V [Methylocystis sp. SC2]
Length=397

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+PD+++RAM+  +ED+RSP  P L K L   +KK+F T  G  F+
Sbjct  7    PGKNFLFVPGPTNLPDRIVRAMSVASEDHRSPTFPDLVKPLFPGLKKVFGTEKGHAFI  64



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL
Sbjct  2    PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFL  59



>ref|WP_019867322.1| serine--glyoxylate aminotransferase [Methylovulum miyakonense]
Length=388

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL++PGP N+P++V+ AM    ED+RSP  P L   LLED+KK+F TT+G  F+
Sbjct  3    GRNHLYIPGPTNVPNEVLNAMHVPMEDHRSPIFPKLLTPLLEDLKKVFNTTTGQAFI  59



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRN L VPGP NIPD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+
Sbjct  11   GRNILAVPGPTNIPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFI  67



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+
Sbjct  2    PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFI  59



>ref|WP_003535479.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti]
 gb|EHK74228.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=396

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKKIFK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFSDVKKIFKNQNGRVFI  59



>ref|WP_014762956.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 gb|AFL50786.1| serine--glyoxylate aminotransferase SgaA [Sinorhizobium fredii 
USDA 257]
Length=396

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  SG  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHSGRVFI  59



>ref|WP_033156535.1| serine--glyoxylate aminotransferase [Methylomonas sp. LW13]
Length=388

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLFVPGP N P +++ AM    ED+RSP  P L   +LED+KK+F+T +G  F+
Sbjct  3    GRNHLFVPGPTNTPHEILSAMHVPMEDHRSPIFPKLLAPILEDLKKVFRTETGQCFV  59



>ref|WP_036274731.1| serine--glyoxylate aminotransferase [Methylomonas denitrificans]
 gb|KHD32132.1| serine--glyoxylate aminotransferase [Methylomonas denitrificans]
Length=388

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLFVPGP N P +++ AM    ED+RSP  P L   +LED+KK+F+T +G  F+
Sbjct  3    GRNHLFVPGPTNTPHEILSAMHVPMEDHRSPIFPKLLSPILEDLKKVFRTEAGQCFV  59



>ref|WP_022947294.1| serine--glyoxylate aminotransferase [Methylohalobius crimeensis]
Length=395

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHL+VPGP N PD V+ AM    ED+R+P    L K LLED+KK+F+T  G  FL
Sbjct  3    GRNHLYVPGPTNAPDSVLSAMHVPMEDHRAPDFSELVKPLLEDLKKVFRTEKGQVFL  59



>ref|WP_026604426.1| serine--glyoxylate aminotransferase [Methylomonas sp. 11b]
Length=388

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLFVPGP N P +++ AM    ED+RSP  P L   +LED+KK+F+T +G  F+
Sbjct  3    GRNHLFVPGPTNTPHEILSAMHVPMEDHRSPIFPKLLAPILEDLKKVFRTETGQCFV  59



>ref|WP_020482091.1| serine--glyoxylate aminotransferase [Methylomonas sp. MK1]
Length=388

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLFVPGP N P +++ AM    ED+RSP  P L   +LED+KK+F+T +G  F+
Sbjct  3    GRNHLFVPGPTNTPHEILSAMHVPMEDHRSPIFPKLLAPILEDLKKVFRTETGQCFV  59



>ref|WP_031434945.1| serine--glyoxylate aminotransferase [Methylomarinum vadi]
Length=388

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K +LED+KK+F+T +G  F+
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPDFPKLLKPVLEDLKKVFRTETGQAFI  59



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GR+ LFVPGP N+PD+V+RAM    ED+RS   P LT  L +D+KK+FK+T G  F+
Sbjct  3    GRHFLFVPGPTNVPDRVLRAMLVAMEDHRSSKFPELTLPLFQDLKKVFKSTDGQVFI  59



>ref|WP_014955398.1| serine--glyoxylate aminotransferase [alpha proteobacterium HIMB59]
 gb|AFS49567.1| Aminotransferase class-V [alpha proteobacterium HIMB59]
Length=386

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+  LFVPGP N+PD+V +AM  +NED+R+P +      L+ED++K+F+T +G PF+
Sbjct  2    PGKISLFVPGPTNMPDRVRQAMDISNEDHRAPGMEKFWHPLIEDLRKVFETNTGQPFI  59



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            GRN L VPGP N+PD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+
Sbjct  11   GRNILAVPGPTNVPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFI  67



>ref|WP_037416404.1| serine--glyoxylate aminotransferase [Sinorhizobium sp. CCBAU 
05631]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D+K++FK  SG  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADIKRVFKNQSGRVFI  59



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHNGRVFI  59



>ref|WP_014329402.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 emb|CCE96968.1| serine-glyoxylate aminotransferase-related [Sinorhizobium fredii 
HH103]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFI  59



>ref|WP_026622911.1| serine--glyoxylate aminotransferase [Ensifer sp. WSM1721]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPQYPELTLPLFADVKKVFKNRNGRVFI  59



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D++++FK  +G  F+
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADLRRVFKNQNGRVFI  59



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNENGRVFI  59



>ref|WP_027999163.1| serine--glyoxylate aminotransferase [Sinorhizobium arboris]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFI  59



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG+N LFVPGP N+PD+V+RAM   +ED+RSP  P L K L   +KK+F T  G  F+
Sbjct  7    PGKNFLFVPGPTNLPDRVVRAMAVASEDHRSPTFPDLVKPLFPGLKKVFGTEKGHAFI  64



>ref|WP_040961132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFI  59



>ref|WP_026616975.1| serine--glyoxylate aminotransferase [Ensifer sp. TW10]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DV+K+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVRKVFKNQNGRVFI  59



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFI  64



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFI  64



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFI  64



>ref|WP_037399714.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=118

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFI  59



>ref|WP_012709136.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 ref|YP_002827132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
 gb|ACP26379.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
Length=395

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+Q+ +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPEQIRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFI  59



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  237  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFL
Sbjct  1    MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFL  37



>ref|WP_037429329.1| hypothetical protein, partial [Sinorhizobium fredii]
Length=152

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  28   GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFI  84



>ref|WP_015314900.1| serine--glyoxylate aminotransferase [Mesorhizobium australicum]
 gb|AGB43428.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Mesorhizobium australicum WSM2073]
Length=400

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLFVPGP NIPD V RAM    +D R+P  P LT  L+ D+KK+FKT S + F+
Sbjct  4    GNAHLFVPGPTNIPDAVRRAMNVPMQDMRAPDFPELTLPLMADLKKVFKTASASIFI  60



>ref|WP_037437029.1| hypothetical protein, partial [Sinorhizobium fredii]
Length=152

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+
Sbjct  28   GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFI  84



>ref|WP_043774228.1| serine--glyoxylate aminotransferase [Roseivivax isoporae]
 gb|ETX27081.1| serine--glyoxylate aminotransferase [Roseivivax isoporae LMG 
25204]
Length=397

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG  HLF+PGP NIP++V  AM    +D R+P  P LTK + E V+K+F+ T+G  FL
Sbjct  2    PGYKHLFIPGPTNIPEEVRMAMNVAMQDMRAPDFPNLTKPIFEKVQKVFRNTTGRVFL  59



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  252  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFL
Sbjct  1    EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFL  32



>ref|WP_037131645.1| serine--glyoxylate aminotransferase [Rhizobium sp. CF097]
Length=396

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG +HLF+PGP NIP+QV +AM    ED RS   P LT  L  DVKK+FK  +G  F+
Sbjct  2    PGYSHLFIPGPTNIPEQVRQAMNLPMEDMRSSRYPELTLPLFADVKKVFKNQNGRVFI  59



>ref|WP_031597721.1| serine--glyoxylate aminotransferase [Ferrovum myxofaciens]
Length=398

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G N LFVPGP N+P++++RAM    ED+RS   PALT+ +L  +K++FKT S  P +
Sbjct  3    GHNFLFVPGPSNVPNRILRAMAVPMEDHRSVKFPALTQEILAGLKRVFKTESAAPIV  59



>ref|WP_006203221.1| serine--glyoxylate aminotransferase [Mesorhizobium amorphae]
 gb|EHH10543.1| class V aminotransferase [Mesorhizobium amorphae CCNWGS0123]
Length=396

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRAFI  59



>ref|WP_037384071.1| serine--glyoxylate aminotransferase [Ensifer americanum]
 gb|KEC78847.1| serine-glyoxylate aminotransferase [Sinorhizobium americanum 
CCGM7]
Length=395

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G NHLF+PGP NIP++V +AM    ED RSP  P LT  L  D+K++FK  +G  F+
Sbjct  3    GYNHLFIPGPTNIPERVRQAMNLPMEDMRSPRYPELTLPLFADIKQVFKNKTGRVFI  59



>ref|WP_027163728.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM1293]
Length=401

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIPD V RAM    +D R+P  P L   L  D+K+IFKT +G+ F+
Sbjct  4    GTAHLFIPGPTNIPDAVRRAMNVPMQDMRAPDFPELVLPLFHDLKRIFKTETGSVFI  60



>ref|WP_024505109.1| serine--glyoxylate aminotransferase [Mesorhizobium ciceri]
Length=401

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIPD V RAM    +D R+P  P L   L  D+K+IFKT +G+ F+
Sbjct  4    GTAHLFIPGPTNIPDAVRRAMNVPMQDMRAPDFPELVLPLFRDLKRIFKTETGSVFI  60



>ref|XP_001702107.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97196.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=437

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+
Sbjct  39   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFI  96



>ref|WP_027168976.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM3224]
Length=396

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFI  59



>ref|WP_027051273.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFI  59



>ref|XP_001702106.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97195.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=448

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+
Sbjct  50   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFI  107



>ref|WP_027061369.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFI  59



>ref|WP_027029542.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFI  59



>ref|WP_013529882.1| serine--glyoxylate aminotransferase [Mesorhizobium ciceri]
 ref|YP_004141244.1| class V aminotransferase [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
 gb|ADV11194.1| aminotransferase class V [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
Length=401

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIPD V RAM    +D R+P  P L   L  D+K+IFKT +G+ F+
Sbjct  4    GTAHLFIPGPTNIPDAVRRAMNVPMQDMRAPDFPELVLPLFRDLKQIFKTETGSVFI  60



>ref|WP_027044922.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. URHC0008]
Length=396

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFI  59



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G   LF+PGP N+PD+V RAM    ED R+P +P  T  L +DVKKIFK+  G  FL
Sbjct  3    GMRSLFIPGPTNVPDRVRRAMDIPMEDQRAPDLPEFTLPLFQDVKKIFKSQQGQVFL  59



>ref|WP_043847105.1| serine--glyoxylate aminotransferase [Roseivivax atlanticus]
 gb|ETW10944.1| serine-glyoxylate aminotransferase [Roseivivax atlanticus]
Length=397

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PG  HL +PGP N+P++V  AM    +D R+P  P LTK + E V+K+F+ TSG  FL
Sbjct  2    PGYTHLCIPGPTNVPERVRMAMNVAMQDMRAPDFPELTKPIFEKVQKVFRNTSGRVFL  59



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K I+ T   TPF+
Sbjct  52   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAQFFKDCLEDTKLIYGTKEATPFI  109



>ref|WP_040618186.1| serine--glyoxylate aminotransferase [Roseovarius nubinhibens]
Length=392

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+++ ++M    ED R+P  P L   LLEDVKK+++ +SG  F+
Sbjct  3    GTQHLFIPGPTNIPEKIRQSMNIPMEDMRAPDFPELVNGLLEDVKKVYRMSSGRVFV  59



>ref|WP_023829410.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
 gb|ESZ58200.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
Length=396

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+K++FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKRVFKNETGRVFI  59



>ref|WP_023779196.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC221B00]
 gb|ESY77993.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC221B00]
Length=396

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+K++FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKRVFKNETGRVFI  59



>ref|WP_015317366.1| serine--glyoxylate aminotransferase [Mesorhizobium australicum]
 gb|AGB45946.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Mesorhizobium australicum WSM2073]
Length=396

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+   P LT  L ED+K+IFK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAATFPDLTLPLFEDIKRIFKNETGRVFI  59



>ref|WP_042643125.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
 emb|CDX37204.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
Length=396

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+K++FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPNLTLPLFEDIKRVFKNETGRVFI  59



>ref|WP_023670792.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC285A00]
 gb|ESW79540.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC285A00]
Length=396

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+K++FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKRVFKNETGRVFI  59



>ref|WP_010910076.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
 dbj|BAB48723.1| probable serine-glyoxylate aminotransferase [Mesorhizobium loti 
MAFF303099]
Length=396

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+K++FK  +G  F+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKRVFKNETGRVFI  59



>ref|WP_037133426.1| serine--glyoxylate aminotransferase [Rhizobium sp. CF097]
Length=401

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFL  347
            G  HLFVPGP N+P+ V RAM    +D R+P  P L   L  D+K+IF+T +GT F+
Sbjct  4    GTTHLFVPGPTNVPEAVRRAMNVPMQDMRAPDFPELVLPLFSDLKRIFRTETGTVFI  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552569507840