BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006C18

Length=355
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                191   1e-55   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          190   3e-55   Ipomoea batatas [batate]
gb|AAC84138.1|  catalase                                                163   7e-48   Cichorium intybus [radicchio]
gb|AAC39465.1|  catalase 3                                              160   9e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29557.3|  unnamed protein product                                160   2e-47   Vitis vinifera
gb|ACL27272.1|  catalase                                                169   3e-47   Nicotiana benthamiana
ref|NP_001291326.1|  catalase isozyme 1                                 169   3e-47   Sesamum indicum [beniseed]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      169   4e-47   Solanum tuberosum [potatoes]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      169   4e-47   Nicotiana sylvestris
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 169   4e-47   Cucumis melo [Oriental melon]
dbj|BAC79443.1|  catalase                                               169   4e-47   Acacia ampliceps
gb|AGC65520.1|  catalase                                                169   4e-47   Eriobotrya japonica [loquat]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          169   4e-47   Vigna radiata var. radiata [golden gram]
gb|ADZ45555.1|  catalase                                                169   4e-47   Vigna radiata [mung bean]
emb|CCP37650.1|  catalase-1                                             168   4e-47   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              168   4e-47   Nicotiana tabacum [American tobacco]
gb|ACJ71245.1|  catalase 2                                              166   4e-47   Vigna unguiculata
gb|ACJ71244.1|  catalase 2                                              166   4e-47   Vigna unguiculata
gb|ADZ45556.1|  catalase                                                168   5e-47   Vigna radiata [mung bean]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      167   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             167   5e-47   
gb|AGE15298.2|  catalase 1                                              168   5e-47   Eriobotrya japonica [loquat]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             167   6e-47   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      168   8e-47   Nelumbo nucifera [Indian lotus]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             168   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              167   9e-47   Populus euphratica
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              167   1e-46   Cicer arietinum [garbanzo]
ref|XP_007018034.1|  Catalase 2                                         167   1e-46   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             167   1e-46   
gb|ABF93811.1|  Catalase-1, putative, expressed                         165   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         167   2e-46   Tarenaya hassleriana [spider flower]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       167   2e-46   Triticum aestivum [Canadian hard winter wheat]
gb|ACB11496.1|  catalase                                                167   2e-46   Pinus sylvestris [Scotch pine]
ref|NP_001237556.1|  catalase-1/2                                       167   2e-46   Glycine max [soybeans]
gb|AFU48609.1|  catalase 1                                              167   2e-46   Nicotiana benthamiana
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      167   2e-46   Prunus mume [ume]
gb|AHF27433.1|  catalase                                                167   2e-46   Cucurbita maxima [Boston marrow]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           166   2e-46   
tpg|DAA43177.1|  TPA: catalase2                                         166   2e-46   
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          166   2e-46   Soldanella alpina
gb|AET97564.1|  catalase                                                166   3e-46   Ziziphus jujuba [Chinese jujube]
gb|AIX10947.1|  putative catalase                                       166   3e-46   Gardenia jasminoides
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           166   3e-46   Sesamum indicum [beniseed]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      166   3e-46   Fragaria vesca subsp. vesca
ref|NP_001237571.1|  catalase-4                                         166   3e-46   Glycine max [soybeans]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            166   3e-46   Pisum sativum [garden pea]
gb|AII23739.1|  catalase                                                166   3e-46   Zostera marina
ref|NP_001235974.1|  catalase-3                                         166   3e-46   Glycine max [soybeans]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    166   4e-46   
gb|AFD29285.1|  catalase                                                166   4e-46   Vicia faba [broad bean]
dbj|BAH37035.1|  catalase 1                                             166   4e-46   Pisum sativum [garden pea]
gb|KEH36313.1|  catalase heme-binding enzyme                            165   4e-46   Medicago truncatula
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             166   4e-46   Prunus persica
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      166   4e-46   Nicotiana tomentosiformis
ref|NP_001289779.1|  catalase isozyme 1                                 166   4e-46   Nelumbo nucifera [Indian lotus]
emb|CAD42908.1|  catalase                                               166   4e-46   Prunus persica
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      166   5e-46   Cucumis melo [Oriental melon]
gb|AIZ77475.1|  catalase                                                166   5e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      166   5e-46   Nicotiana sylvestris
gb|AHF27430.1|  catalase                                                166   5e-46   Cucurbita moschata [ayote]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                166   5e-46   Erythranthe guttata [common monkey flower]
ref|NP_001240021.1|  catalase                                           166   5e-46   Glycine max [soybeans]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    166   6e-46   Gossypium raimondii
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     165   6e-46   Eucalyptus grandis [rose gum]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 166   6e-46   
dbj|BAA34205.1|  catalase                                               166   6e-46   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA43178.1|  TPA: catalase2                                         166   6e-46   
gb|AHF21552.1|  catalase                                                166   6e-46   Hylocereus undatus [dragon fruit]
ref|NP_001048861.1|  Os03g0131200                                       166   6e-46   
gb|KHG25152.1|  Catalase isozyme 1                                      166   6e-46   Gossypium arboreum [tree cotton]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               166   6e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      165   6e-46   Nicotiana tomentosiformis
ref|XP_010530333.1|  PREDICTED: catalase-2                              165   7e-46   Tarenaya hassleriana [spider flower]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                165   8e-46   Erythranthe guttata [common monkey flower]
gb|AAF61734.1|AF243519_1  catalase 4                                    165   8e-46   Helianthus annuus
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             165   9e-46   Phaseolus vulgaris [French bean]
gb|KEH36312.1|  catalase heme-binding enzyme                            165   1e-45   Medicago truncatula
gb|ACL81498.1|  catalase                                                165   1e-45   Ginkgo biloba [ginkgo]
ref|XP_010094556.1|  Catalase isozyme 1                                 165   1e-45   Morus notabilis
ref|XP_002521709.1|  catalase, putative                                 165   1e-45   Ricinus communis
gb|KJB17474.1|  hypothetical protein B456_003G002800                    164   1e-45   Gossypium raimondii
ref|NP_001234186.1|  catalase isozyme 2                                 164   1e-45   
gb|AIA61608.1|  catalase                                                164   1e-45   Gynostemma pentaphyllum [jiaogulan]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    164   1e-45   Gossypium raimondii
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               164   1e-45   Ricinus communis
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      164   1e-45   
gb|ACJ11733.1|  catalase                                                164   1e-45   Gossypium hirsutum [American cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               164   1e-45   Gossypium hirsutum [American cotton]
gb|EPS69543.1|  catalase                                                164   1e-45   Genlisea aurea
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               164   1e-45   Cucurbita pepo
ref|XP_007046520.1|  Catalase 2                                         164   1e-45   Theobroma cacao [chocolate]
gb|KHG12976.1|  Catalase isozyme 2                                      164   1e-45   Gossypium arboreum [tree cotton]
emb|CAG23920.1|  catalase                                               164   2e-45   Festuca arundinacea [tall fescue]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         164   2e-45   Jatropha curcas
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         164   2e-45   Oryza brachyantha
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               164   2e-45   Cucurbita pepo
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 164   2e-45   Populus euphratica
gb|ADC95629.1|  catalase                                                164   2e-45   Bruguiera gymnorhiza [Burma mangrove]
gb|AAR84577.1|  catalase 1b                                             163   2e-45   Lotus japonicus
emb|CDX72514.1|  BnaC07g45360D                                          164   2e-45   
dbj|BAJ90861.1|  predicted protein                                      164   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 164   2e-45   Nicotiana sylvestris
emb|CDX69111.1|  BnaC01g03420D                                          164   2e-45   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 164   3e-45   Nicotiana tomentosiformis
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          164   3e-45   Amborella trichopoda
emb|CAI43948.1|  catalase                                               164   3e-45   Populus deltoides
ref|NP_001031791.1|  catalase 2                                         163   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301920.1|  catalase family protein                            164   3e-45   Populus trichocarpa [western balsam poplar]
gb|AAR84578.1|  catalase 1a                                             164   3e-45   Lotus japonicus
gb|ACA50528.1|  putative catalase 2                                     164   3e-45   Brassica napus [oilseed rape]
ref|XP_009106100.1|  PREDICTED: catalase-2                              164   3e-45   Brassica rapa
gb|AAC19397.1|  leaf catalase                                           164   3e-45   Mesembryanthemum crystallinum
dbj|BAH19523.1|  AT4G35090                                              163   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 164   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             164   3e-45   Eutrema salsugineum [saltwater cress]
emb|CDY40645.1|  BnaA03g53180D                                          163   3e-45   Brassica napus [oilseed rape]
gb|AAD17935.1|  catalase                                                163   3e-45   Brassica juncea [brown mustard]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             163   3e-45   Capsella rubella
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      163   3e-45   
emb|CAA64220.1|  catalase                                               163   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                163   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAD17933.1|  catalase                                                163   4e-45   Brassica juncea [brown mustard]
gb|AAF71742.1|AF248491_1  catalase                                      163   4e-45   Raphanus sativus
gb|ADM96039.1|  catalase                                                163   4e-45   Cucumis sativus [cucumbers]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             163   4e-45   
ref|NP_195235.1|  catalase 2                                            163   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ACV92695.1|  catalase                                                163   4e-45   Brassica oleracea
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             163   4e-45   Eutrema salsugineum [saltwater cress]
gb|AGV54297.1|  peroxisomal catalase                                    163   4e-45   Phaseolus vulgaris [French bean]
dbj|BAJ33995.1|  unnamed protein product                                163   4e-45   Eutrema halophilum
gb|KFK30147.1|  catalase                                                163   4e-45   Arabis alpina [alpine rockcress]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         163   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_010437527.1|  PREDICTED: catalase-2                              163   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009138342.1|  PREDICTED: catalase-2                              163   4e-45   Brassica rapa
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         163   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_001784759.1|  predicted protein                                  163   4e-45   
gb|AFN81243.1|  catalase 1                                              163   4e-45   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             163   4e-45   Phaseolus vulgaris [French bean]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         163   4e-45   Camelina sativa [gold-of-pleasure]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     161   5e-45   Eucalyptus grandis [rose gum]
gb|AJE26131.1|  catalase                                                163   5e-45   Salix matsudana [tortured willow]
dbj|BAA34714.1|  catalase                                               163   5e-45   Oryza sativa [red rice]
gb|AAO17721.1|  catalase                                                163   5e-45   Hypericum perforatum
gb|AAF61733.1|AF243518_1  catalase 3                                    163   6e-45   Helianthus annuus
ref|XP_010692546.1|  PREDICTED: catalase                                163   6e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003558892.1|  PREDICTED: catalase-1                              163   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      162   6e-45   Vitis vinifera
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      162   6e-45   
gb|AHB72694.1|  catalase                                                162   6e-45   Beta vulgaris subsp. maritima [sea beet]
emb|CAE82295.1|  catalase                                               162   6e-45   Homogyne alpina
gb|ABK24453.1|  unknown                                                 162   7e-45   Picea sitchensis
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             155   7e-45   
gb|ACL35349.1|  catalase                                                162   7e-45   Picea glauca
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       161   7e-45   Cucumis sativus [cucumbers]
emb|CDP07287.1|  unnamed protein product                                162   7e-45   Coffea canephora [robusta coffee]
ref|XP_001752315.1|  predicted protein                                  162   7e-45   
gb|KJB57963.1|  hypothetical protein B456_009G187600                    162   8e-45   Gossypium raimondii
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 162   8e-45   Eucalyptus grandis [rose gum]
gb|AFU90823.1|  catalase                                                161   9e-45   Populus x beijingensis
gb|AAX88799.1|  catalase                                                162   1e-44   Euphorbia characias
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      162   1e-44   Solanum lycopersicum
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 161   1e-44   
gb|AAD17936.1|  catalase                                                162   1e-44   Brassica juncea [brown mustard]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      162   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABM47415.1|  catalase                                                162   1e-44   Prunus avium [gean]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          162   1e-44   Amborella trichopoda
ref|XP_009149539.1|  PREDICTED: catalase-3                              162   1e-44   Brassica rapa
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      162   1e-44   Eucalyptus grandis [rose gum]
gb|ABV55108.1|  catalase 2                                              162   1e-44   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      162   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      162   2e-44   Elaeis guineensis
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       161   2e-44   Cucumis sativus [cucumbers]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 161   2e-44   Manihot esculenta [manioc]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 161   2e-44   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         161   2e-44   Tarenaya hassleriana [spider flower]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    161   2e-44   Arabis alpina [alpine rockcress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      161   2e-44   Cucumis melo [Oriental melon]
gb|ABY21704.1|  catalase-1 precursor                                    161   2e-44   Panax ginseng [Asiatic ginseng]
gb|AFU90822.1|  catalase                                                161   2e-44   Populus tomentosa [Chinese white poplar]
ref|XP_002306976.2|  catalase family protein                            161   2e-44   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      161   2e-44   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 161   2e-44   Solanum tuberosum [potatoes]
gb|AIS20825.1|  CAT                                                     161   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      161   3e-44   Populus euphratica
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             159   3e-44   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              161   3e-44   Brassica rapa
emb|CDP01803.1|  unnamed protein product                                161   3e-44   Coffea canephora [robusta coffee]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               161   3e-44   Cucurbita pepo
gb|ADU56199.1|  catalase                                                160   3e-44   Hevea brasiliensis [jebe]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             160   3e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              160   4e-44   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              160   4e-44   
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               160   4e-44   Gossypium hirsutum [American cotton]
ref|NP_001268098.1|  catalase                                           160   4e-44   Vitis vinifera
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 160   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 160   4e-44   Vitis vinifera
emb|CDP07288.1|  unnamed protein product                                160   4e-44   Coffea canephora [robusta coffee]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             160   5e-44   Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      160   5e-44   Citrus sinensis [apfelsine]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      160   5e-44   Phoenix dactylifera
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 160   5e-44   Phoenix dactylifera
gb|AAB62892.1|  catalase-1                                              160   5e-44   Nicotiana glutinosa
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             160   6e-44   Capsella rubella
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             160   6e-44   
ref|XP_001779509.1|  predicted protein                                  160   7e-44   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             160   7e-44   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              160   7e-44   
ref|NP_973873.1|  catalase 3                                            159   7e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29519.1|  BnaA06g14510D                                          160   8e-44   Brassica napus [oilseed rape]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    160   8e-44   Arabis alpina [alpine rockcress]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             160   8e-44   Selaginella moellendorffii
gb|AAF19965.1|AF207906_1  catalase 1                                    160   8e-44   Zantedeschia aethiopica [arum-lily]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          159   9e-44   Helianthus annuus
prf||2104177A  catalase                                                 159   9e-44
prf||1906388A  catalase                                                 159   9e-44
gb|AAD30291.2|AF139538_1  catalase 2                                    159   1e-43   Raphanus sativus
emb|CAA45564.1|  catalase                                               159   1e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                              159   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      159   1e-43   Phoenix dactylifera
gb|AAD30292.1|AF139539_1  catalase 3                                    159   1e-43   Raphanus sativus
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         159   1e-43   Brassica rapa
ref|XP_009110221.1|  PREDICTED: catalase-3                              159   1e-43   Brassica rapa
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              159   1e-43   Populus euphratica
ref|NP_001031073.1|  catalase 3                                         159   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33636.1|  BnaC08g19360D                                          159   1e-43   Brassica napus [oilseed rape]
gb|ADU56189.1|  catalase 1                                              151   1e-43   Jatropha curcas
gb|AAC49807.1|  catalase 3                                              159   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                            159   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01364.1|  BnaA07g11370D                                          160   1e-43   
emb|CDY31878.1|  BnaC07g15280D                                          159   1e-43   Brassica napus [oilseed rape]
gb|AAM65021.1|  unknown                                                 159   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AHA50082.1|  catalase                                                159   1e-43   Eleutherococcus senticosus
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     160   2e-43   Eucalyptus grandis [rose gum]
gb|AAK67359.2|AF390210_1  catalase                                      159   2e-43   Suaeda salsa
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      159   2e-43   Elaeis guineensis
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         159   2e-43   Setaria italica
ref|XP_010061175.1|  PREDICTED: catalase-like                           159   2e-43   Eucalyptus grandis [rose gum]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      158   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 162   3e-43   
gb|AAB70006.1|  catalase                                                158   3e-43   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                158   3e-43   Chlamydomonas reinhardtii
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 158   3e-43   Prunus mume [ume]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             158   3e-43   Prunus persica
emb|CAD42909.1|  catalase                                               158   3e-43   Prunus persica
ref|XP_009103333.1|  PREDICTED: catalase-1                              158   3e-43   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                          158   3e-43   
emb|CDY31877.1|  BnaC07g15270D                                          158   4e-43   Brassica napus [oilseed rape]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      158   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               157   4e-43   Zea mays [maize]
prf||1803522A  catalase                                                 157   4e-43
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 157   4e-43   Oryza brachyantha
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      157   5e-43   Phoenix dactylifera
gb|AAF61732.1|AF243517_1  catalase 2                                    157   5e-43   Helianthus annuus
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          157   5e-43   
gb|ACH63223.1|  catalase                                                157   5e-43   Rheum australe [Himalayan rhubarb]
gb|AAY59707.1|  catalase                                                157   6e-43   Oryza sativa Indica Group [Indian rice]
dbj|BAA34204.1|  catalase                                               157   6e-43   Oryza sativa Japonica Group [Japonica rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    157   6e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001058635.1|  Os06g0727200                                       157   6e-43   
gb|AIU99480.1|  catalase                                                157   6e-43   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                157   6e-43   Saccharum spontaneum [fodder cane]
gb|AIU99479.1|  catalase                                                157   6e-43   Saccharum arundinaceum
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               157   7e-43   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               157   7e-43   Zea mays [maize]
gb|AIU99487.1|  catalase                                                157   7e-43   Saccharum hybrid cultivar ROC22
gb|AAB86582.2|  catalase                                                157   7e-43   Raphanus sativus
gb|AIU99488.1|  catalase                                                157   8e-43   Saccharum hybrid cultivar ROC22
ref|NP_001105415.1|  catalase isozyme 1                                 157   8e-43   
emb|CAA42720.1|  catalase-1                                             157   8e-43   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 157   8e-43   Zea mays [maize]
ref|NP_001105310.1|  catalase isozyme 2                                 157   9e-43   
gb|AIP93616.1|  CAT1                                                    157   9e-43   Bassia scoparia [burning bush]
gb|AFR53082.1|  CAT                                                     157   1e-42   Anthurium andraeanum [flamingo-lily]
ref|XP_010692544.1|  PREDICTED: catalase-like                           157   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 157   1e-42   Elaeis guineensis
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               156   1e-42   Solanum tuberosum [potatoes]
ref|XP_010498496.1|  PREDICTED: catalase-3                              156   1e-42   Camelina sativa [gold-of-pleasure]
ref|NP_001274863.1|  catalase isozyme 1                                 156   1e-42   Solanum tuberosum [potatoes]
ref|NP_001234827.1|  catalase isozyme 1                                 156   1e-42   Solanum lycopersicum
gb|AIM43584.1|  catalase                                                156   2e-42   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               156   2e-42   
emb|CDX76313.1|  BnaA08g10870D                                          156   2e-42   
gb|AIU99486.1|  catalase                                                156   2e-42   
emb|CDY17510.1|  BnaC03g65530D                                          156   2e-42   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     156   2e-42   
emb|CDY52649.1|  BnaAnng11640D                                          155   2e-42   
emb|CDY29518.1|  BnaA06g14520D                                          155   2e-42   
gb|AAM97542.1|  catalase 3                                              155   2e-42   
emb|CDY31490.1|  BnaC05g15990D                                          155   2e-42   
ref|XP_009149540.1|  PREDICTED: catalase-1                              155   3e-42   
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               155   3e-42   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          155   3e-42   
gb|AAC19398.1|  root catalase                                           155   3e-42   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 156   3e-42   
ref|XP_002950455.1|  catalase                                           155   3e-42   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      155   3e-42   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          155   3e-42
gb|ABB51561.1|  truncated catalase 2                                    154   4e-42   
emb|CAA73663.1|  catalase                                               155   4e-42   
gb|ABC01913.1|  catalase isozyme 1-like protein                         155   4e-42   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    155   4e-42   
dbj|BAJ88747.1|  predicted protein                                      155   4e-42   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      155   4e-42   
gb|AEB22071.1|  catalase 2                                              147   4e-42   
dbj|BAF91369.1|  catalase                                               155   5e-42   
gb|AAG61140.2|AF332973_1  catalase 2                                    155   5e-42   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          155   5e-42   
gb|ADQ28492.1|  catalase                                                155   5e-42   
gb|AAM97541.1|  catalase 2                                              154   6e-42   
gb|AAR97905.1|  catalase                                                154   6e-42   
ref|XP_011396830.1|  Catalase isozyme 2                                 154   6e-42   
gb|ABK24543.1|  unknown                                                 154   6e-42   
dbj|BAA05494.1|  catalase                                               154   7e-42   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 154   7e-42   
ref|XP_002510677.1|  catalase, putative                                 157   7e-42   
gb|AIU99485.1|  catalase                                                154   7e-42   
emb|CAA85470.1|  catalase                                               154   9e-42   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             154   1e-41   
gb|ACJ76836.3|  catalase                                                154   1e-41   
ref|NP_564121.1|  catalase 1                                            154   1e-41   
gb|AAC17731.1|  catalase 1                                              154   1e-41   
gb|AAB07026.1|  catalase 1                                              154   1e-41   
gb|AIU99482.1|  catalase                                                153   2e-41   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    153   2e-41   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      153   2e-41   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      153   2e-41   
gb|ABK24449.1|  unknown                                                 153   2e-41   
gb|AGI65617.1|  catalase                                                153   2e-41   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      153   2e-41   
gb|AIU99483.1|  catalase                                                153   3e-41   
gb|ABK41476.1|  catalase                                                152   4e-41   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        152   4e-41   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               152   4e-41   
ref|NP_001105416.1|  catalase isozyme 3                                 152   5e-41   
gb|AIU99484.1|  catalase                                                152   6e-41   
gb|ABB72796.1|  catalase isozyme 1-like protein                         152   6e-41   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         152   7e-41   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               152   7e-41   
gb|ACJ22771.1|  catalase 1                                              151   8e-41   
emb|CDY31488.1|  BnaC05g15970D                                          151   8e-41   
ref|XP_005645077.1|  catalase                                           151   9e-41   
gb|AHZ13843.1|  catalase                                                151   1e-40   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      151   1e-40   
emb|CAA43814.1|  catalase                                               151   1e-40   
gb|AFW66787.1|  catalase3                                               151   1e-40   
ref|NP_001045673.1|  Os02g0115700                                       151   1e-40   
gb|ABN71233.2|  catalase                                                151   1e-40   
gb|AGT16310.1|  catalase                                                151   1e-40   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           151   1e-40
gb|AFW66788.1|  catalase3                                               151   1e-40   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               151   1e-40   
gb|EMS61345.1|  Catalase isozyme 1                                      152   1e-40   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      150   2e-40   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      150   2e-40   
gb|ADU56198.1|  catalase                                                150   2e-40   
gb|AAC48918.1|  salicylic acid binding catalase                         150   3e-40   
gb|AFW66785.1|  catalase3 isoform 1                                     151   3e-40   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         150   3e-40   
gb|AAP80622.1|AF475100_1  catalase isozyme                              145   3e-40   
ref|XP_010477308.1|  PREDICTED: catalase-1                              149   4e-40   
emb|CAH61266.1|  catalase                                               149   5e-40   
gb|ADY02963.1|  catalase                                                149   5e-40   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               149   5e-40   
dbj|BAJ92414.1|  predicted protein                                      149   5e-40   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    149   6e-40   
gb|AAG43363.1|AF151368_1  catalase                                      149   8e-40   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             148   9e-40   
gb|AAF79625.1|AC027665_26  F5M15.5                                      152   1e-39   
gb|ADN94253.1|  catalase                                                148   2e-39   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             148   2e-39   
gb|ABB88582.1|  catalase                                                147   2e-39   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         147   4e-39   
ref|XP_009362858.1|  PREDICTED: catalase-4-like                         139   5e-39   
gb|AAZ29552.1|  catalase-C                                              146   6e-39   
gb|EMT05040.1|  Catalase-1                                              146   7e-39   
ref|XP_002890395.1|  F5M15.5                                            149   1e-38   
gb|AEQ30070.1|  catalase                                                145   1e-38   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              145   1e-38   
gb|EMS51034.1|  Catalase isozyme 2                                      144   4e-38   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          144   6e-38   
gb|AJF34884.1|  catalase                                                142   2e-37   
gb|AGT16188.1|  catalase                                                142   2e-37   
gb|AGT16203.1|  catalase                                                142   2e-37   
gb|AGT16054.1|  catalase                                                142   2e-37   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 142   2e-37   
gb|AGT15888.1|  catalase                                                140   9e-37   
gb|EMT06167.1|  Catalase isozyme 2                                      141   1e-36   
ref|XP_005708279.1|  catalase                                           139   3e-36   
gb|KHG21219.1|  Catalase isozyme 1                                      136   2e-35   
gb|AAR14052.2|  catalase                                                136   2e-35   
dbj|BAQ21275.1|  catalase                                               135   7e-35   
gb|KDD77132.1|  catalase                                                134   2e-34   
ref|XP_005536240.1|  catalase                                           132   9e-34   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                130   4e-33   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   130   6e-33   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          127   5e-32   
gb|KHG11966.1|  Catalase isozyme 2                                      122   4e-31   
ref|XP_005642928.1|  catalase                                           119   3e-29   
ref|XP_005644653.1|  catalase-domain-containing protein                 115   2e-27   
ref|XP_005647994.1|  catalase-domain-containing protein                 112   8e-27   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          110   6e-26   
gb|AHF27432.1|  catalase                                                109   8e-26   
gb|AHF27429.1|  catalase                                                109   8e-26   
dbj|BAH20307.1|  AT1G20620                                              108   3e-25   
gb|ADR01107.1|  catalase 3                                              107   3e-25   
ref|WP_030085542.1|  catalase                                         98.6    1e-23   
gb|KFK81701.1|  catalase family protein                                 100   3e-23   
ref|WP_026009813.1|  hypothetical protein                             97.8    3e-23   
ref|WP_030064609.1|  catalase                                         97.8    3e-23   
gb|AHG98056.1|  catalase                                                101   3e-23   
emb|CEG67568.1|  Putative Catalase                                      102   4e-23   
emb|CEI86636.1|  Putative Catalase                                      102   5e-23   
ref|XP_011022275.1|  PREDICTED: catalase-like                           102   8e-23   
ref|XP_005712277.1|  unnamed protein product                            102   9e-23   
ref|WP_031000846.1|  catalase                                           101   9e-23   
ref|WP_013390447.1|  catalase                                           101   9e-23   
gb|ADI58890.1|  catalase                                              97.8    1e-22   
ref|WP_039073350.1|  catalase                                           101   1e-22   
ref|WP_015846975.1|  catalase                                           101   1e-22   
ref|WP_020618147.1|  catalase                                           101   1e-22   
ref|WP_010788026.1|  Catalase                                           101   1e-22   
ref|WP_040058190.1|  catalase                                           101   2e-22   
ref|WP_007915547.1|  catalase                                           101   2e-22   
ref|WP_028783654.1|  catalase                                           101   2e-22   
ref|WP_034285200.1|  catalase                                           101   2e-22   
ref|WP_019393152.1|  catalase                                           101   2e-22   
emb|CEP18685.1|  hypothetical protein                                   100   2e-22   
ref|WP_018395773.1|  catalase                                           100   2e-22   
ref|WP_030352990.1|  catalase                                           100   2e-22   
dbj|GAN06759.1|  catalase                                               100   2e-22   
gb|EPB92634.1|  catalase                                                100   2e-22   
ref|WP_030024662.1|  catalase                                           100   2e-22   
ref|WP_019121620.1|  catalase                                           100   2e-22   
ref|WP_035511089.1|  MULTISPECIES: catalase                             100   3e-22   
emb|CDS08738.1|  Putative Catalase                                      100   3e-22   
ref|WP_029326408.1|  catalase                                           100   3e-22   
ref|WP_029420398.1|  catalase                                           100   3e-22   
gb|EIE85094.1|  catalase                                                100   3e-22   
dbj|GAN01536.1|  catalase                                               100   3e-22   
gb|EPB86922.1|  catalase-A                                              100   3e-22   
emb|CDH60495.1|  catalase                                               100   3e-22   
ref|WP_030671953.1|  catalase                                           100   4e-22   
ref|WP_028609851.1|  catalase                                           100   4e-22   
ref|WP_030641057.1|  catalase                                           100   4e-22   
ref|WP_015595454.1|  catalase                                         99.8    6e-22   
ref|WP_030360132.1|  MULTISPECIES: catalase                           99.4    7e-22   
ref|WP_010052614.1|  catalase                                         99.4    7e-22   
ref|WP_019534434.1|  catalase                                         99.4    7e-22   
ref|WP_024714768.1|  catalase                                         99.4    7e-22   
ref|WP_015077590.1|  vegetative catalase                              99.4    7e-22   
ref|WP_041992375.1|  catalase                                         99.4    7e-22   
ref|WP_038828315.1|  catalase                                         99.0    9e-22   
ref|WP_033370129.1|  catalase                                         99.4    9e-22   
ref|WP_042184995.1|  catalase                                         99.0    1e-21   
dbj|GAF39996.1|  catalase                                             95.5    1e-21   
ref|WP_028396461.1|  catalase                                         99.0    1e-21   
ref|WP_043684569.1|  catalase                                         99.0    1e-21   
emb|CAB04807.1|  catalase                                             99.0    1e-21   
ref|WP_014663291.1|  catalase                                         99.0    1e-21   
dbj|BAB21251.1|  catalase                                             99.0    1e-21   
ref|XP_011496239.1|  PREDICTED: catalase                              99.4    1e-21   
ref|WP_040083657.1|  catalase                                         99.0    1e-21   
ref|WP_014476225.1|  MULTISPECIES: catalase                           99.0    1e-21   
ref|WP_003245322.1|  catalase                                         99.0    1e-21   
ref|WP_015252505.1|  catalase                                         99.0    1e-21   
ref|WP_019913466.1|  catalase                                         99.0    1e-21   
ref|WP_010327729.1|  catalase                                         99.0    1e-21   
ref|WP_041351614.1|  catalase                                         99.0    1e-21   
ref|WP_035038622.1|  catalase                                         99.0    1e-21   
ref|WP_019257854.1|  catalase                                         99.0    1e-21   
ref|WP_003239645.1|  catalase                                         99.0    1e-21   
ref|WP_044444974.1|  catalase                                         99.0    1e-21   
ref|WP_003224015.1|  MULTISPECIES: catalase                           99.0    1e-21   
ref|WP_028552752.1|  catalase                                         99.0    1e-21   
ref|WP_044640681.1|  catalase                                         98.6    1e-21   
gb|AAA22402.1|  vegetative catalase                                   98.6    1e-21   
ref|WP_044156672.1|  catalase                                         98.6    1e-21   
gb|KFF57258.1|  catalase                                              98.6    1e-21   
ref|WP_024120674.1|  catalase                                         98.6    1e-21   
ref|WP_010333483.1|  catalase                                         98.6    1e-21   
ref|WP_027323106.1|  catalase                                         98.6    1e-21   
ref|WP_007933642.1|  MULTISPECIES: catalase                           93.2    1e-21   
ref|WP_018561398.1|  catalase                                         98.6    1e-21   
ref|WP_040949987.1|  catalase                                         98.6    1e-21   
ref|WP_042124255.1|  catalase                                         98.6    1e-21   
ref|WP_030586952.1|  catalase                                         98.6    1e-21   
ref|WP_036686886.1|  MULTISPECIES: catalase                           98.6    1e-21   
ref|WP_015612335.1|  Catalase                                         98.6    2e-21   
ref|WP_018932076.1|  catalase                                         98.6    2e-21   
ref|WP_031086753.1|  catalase                                         95.1    2e-21   
ref|WP_043926878.1|  catalase                                         98.6    2e-21   
ref|WP_036835295.1|  catalase                                         98.6    2e-21   
ref|WP_032753795.1|  catalase                                         98.6    2e-21   
ref|WP_031127238.1|  catalase                                         98.6    2e-21   
ref|WP_003470096.1|  catalase                                         98.6    2e-21   
ref|WP_003982732.1|  MULTISPECIES: catalase                           98.6    2e-21   
ref|WP_042203871.1|  catalase                                         98.6    2e-21   
ref|WP_030628527.1|  catalase                                         98.2    2e-21   
ref|WP_025688646.1|  catalase                                         97.1    2e-21   
ref|WP_044786024.1|  catalase                                         98.2    2e-21   



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/91 (98%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGATAKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLR  91



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/91 (98%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   163 bits (412),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AAC39465.1| catalase 3 [Arabidopsis thaliana]
Length=115

 Score =   160 bits (405),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADF+R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFVR  91



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   160 bits (406),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLR  91



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLR  91



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLR  91



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLR  91



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLR  91



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLR  91



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLR  91



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGATAKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLR  91



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLR  354
            RVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLR  90



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP+K+RPSS FN+P+ TTN GAPVWNN  +LTVGSRGPILLEDYHL+EKI  F RERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLR  91



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLR  91



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLR  91



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTH+I+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLR  91



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLR  91



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT+LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLR  91



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+H+TCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLR  91



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLT ADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLR  91



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLR  91



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVH RGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLR  91



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLR  91



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLR  91



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKG FEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLR  91



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLR  91



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+R
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMR  91



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFE THDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLR  91



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLR  91



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+R
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMR  91



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLR  91



>ref|XP_006306503.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
 gb|EOA39401.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
Length=201

 Score =   155 bits (393),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT LT ADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLR  91



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLR  91



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  91   SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERV  270
            S  RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIPERV
Sbjct  3    SHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERV  62

Query  271  VHARGATAKGFFEVTHDITHLTCADFLR  354
            VHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  63   VHARGASAKGFFEVTHDITHLTCADFLR  90



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLR  354
            RVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLR  90



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFF+VTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLR  91



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLR  91



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA+AKGFFEVTHDI+HLTCAD LR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLR  91



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +1

Query  73   LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRE  252
             I+MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  253  RIPERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            RIPERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  109  RIPERVVHARGISAKGFFEVTHDISNLTCADFLR  142



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFE THD+THLTCADFLR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLR  91



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFE THD+THLTCADFLR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLR  91



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLR  91



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLR  91



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLR  354
            RVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLR  90



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLR  91



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLR  91



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLR  91



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLR  91



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA++KGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLR  91



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLR  91



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLR  91



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLR  91



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF TT+ GAPVW+N  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD+++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLR  91



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD+++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLR  91



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVT+D++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLR  91



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  274  HARGATAKGFFEVTHDITHLTCADFLR  354
            HARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLR  89



>ref|XP_001779509.1| predicted protein [Physcomitrella patens]
 gb|EDQ55685.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP +YRPSS++NTP+ T N G PV+NNT ++T+GSRGP+LLEDYHLVEKI NF RERIP
Sbjct  1    MDPYRYRPSSAYNTPYMTNNQGGPVFNNTSSMTIGSRGPVLLEDYHLVEKIANFHRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ER+VHARGA AKG+FEVTHDITHLTCADFLR
Sbjct  61   ERIVHARGAGAKGYFEVTHDITHLTCADFLR  91



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  274  HARGATAKGFFEVTHDITHLTCADFLR  354
            HARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLR  92



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLR  91



>prf||2104177A catalase
Length=492

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLR  91



>prf||1906388A catalase
Length=492

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLR  91



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  274  HARGATAKGFFEVTHDITHLTCADFLR  354
            HARGA+AKGFFEVT+DI+HLTCADFLR
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLR  110



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>gb|ADU56189.1| catalase 1 [Jatropha curcas]
Length=152

 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+ PSS+ NTPF TTN GAPVWNN  ++TVG RGPILLEDYH++EK+ NF RERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTH+I++LTCADFLR
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLR  91



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  79   SMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERI  258
            +MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERI
Sbjct  64   TMDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERI  123

Query  259  PERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            PERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  124  PERVVHARGISAKGFFEVTHDISNLTCADFLR  155



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARG +AKGFFEVTHDI++LTCADFLR
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLR  91



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+P+ TTN GAP WNN  +LTVG+RGPILLEDY LVE I NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLR  91



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  70   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTR  249
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  250  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLR  183



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLR  91



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFE THD+THL+CADFLR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLR  91



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLR  91


 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  100  RPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHA  279
            RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIPERVVHA
Sbjct  488  RPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVHA  547

Query  280  RGATAKGFFEVTHDITHLTCADFLR  354
            RGA+AKGFFEVTHDITHLTCADFLR
Sbjct  548  RGASAKGFFEVTHDITHLTCADFLR  572



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score =   158 bits (400),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA AKGFFEVTHDI+ LT ADFLR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLR  91



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score =   158 bits (400),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA AKGFFEVTHDI+ LT ADFLR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLR  91



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLR  91



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLR  91



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFE THD+THL+CADFLR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLR  91



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLR  90



>prf||1803522A catalase
Length=491

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLR  354
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLR  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395