BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF005H05

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004138765.1|  PREDICTED: COP9 signalosome complex subunit ...    147   9e-40   Cucumis sativus [cucumbers]
ref|XP_008445090.1|  PREDICTED: COP9 signalosome complex subunit ...    147   9e-40   Cucumis melo [Oriental melon]
ref|XP_002283561.1|  PREDICTED: COP9 signalosome complex subunit ...    143   3e-38   Vitis vinifera
gb|KDP33444.1|  hypothetical protein JCGZ_07015                         142   4e-38   Jatropha curcas
ref|XP_010111938.1|  COP9 signalosome complex subunit 5b                142   5e-38   
ref|XP_002527960.1|  jun activation domain binding protein, putative    141   1e-37   Ricinus communis
ref|XP_006351153.1|  PREDICTED: COP9 signalosome complex subunit ...    141   1e-37   Solanum tuberosum [potatoes]
ref|XP_006450163.1|  hypothetical protein CICLE_v10008736mg             140   1e-37   
ref|XP_006450164.1|  hypothetical protein CICLE_v10008736mg             140   3e-37   Citrus clementina [clementine]
ref|XP_006450165.1|  hypothetical protein CICLE_v10008736mg             140   3e-37   Citrus clementina [clementine]
gb|KDO67280.1|  hypothetical protein CISIN_1g018085mg                   140   3e-37   Citrus sinensis [apfelsine]
ref|XP_007221779.1|  hypothetical protein PRUPE_ppa007500mg             140   3e-37   Prunus persica
gb|KDO67279.1|  hypothetical protein CISIN_1g018085mg                   140   3e-37   Citrus sinensis [apfelsine]
ref|XP_011459046.1|  PREDICTED: COP9 signalosome complex subunit ...    139   4e-37   Fragaria vesca subsp. vesca
ref|XP_004291259.1|  PREDICTED: COP9 signalosome complex subunit ...    139   4e-37   Fragaria vesca subsp. vesca
ref|XP_009617619.1|  PREDICTED: COP9 signalosome complex subunit ...    139   8e-37   Nicotiana tomentosiformis
ref|XP_009786152.1|  PREDICTED: COP9 signalosome complex subunit ...    139   1e-36   Nicotiana sylvestris
ref|NP_001234331.1|  JAB                                                139   1e-36   
ref|XP_008378244.1|  PREDICTED: COP9 signalosome complex subunit ...    139   1e-36   Malus domestica [apple tree]
emb|CBL87025.1|  CSN5 protein                                           139   1e-36   Solanum lycopersicum
ref|XP_004241422.1|  PREDICTED: COP9 signalosome complex subunit 5b     138   2e-36   Solanum lycopersicum
ref|XP_006347307.1|  PREDICTED: COP9 signalosome complex subunit ...    138   2e-36   Solanum tuberosum [potatoes]
gb|KFK41544.1|  hypothetical protein AALP_AA2G143000                    137   2e-36   Arabis alpina [alpine rockcress]
ref|XP_008393958.1|  PREDICTED: COP9 signalosome complex subunit ...    138   3e-36   
ref|XP_010259860.1|  PREDICTED: COP9 signalosome complex subunit ...    137   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_007137114.1|  hypothetical protein PHAVU_009G100700g             136   7e-36   Phaseolus vulgaris [French bean]
ref|XP_010669282.1|  PREDICTED: COP9 signalosome complex subunit ...    136   8e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009338826.1|  PREDICTED: COP9 signalosome complex subunit ...    136   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_003522659.1|  PREDICTED: COP9 signalosome complex subunit 5a     135   1e-35   Glycine max [soybeans]
ref|XP_002887356.1|  hypothetical protein ARALYDRAFT_894961             135   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_003526451.1|  PREDICTED: COP9 signalosome complex subunit 5a     135   3e-35   Glycine max [soybeans]
gb|KJB55196.1|  hypothetical protein B456_009G068200                    134   3e-35   Gossypium raimondii
gb|KJB55192.1|  hypothetical protein B456_009G068200                    134   3e-35   Gossypium raimondii
gb|KHG19604.1|  COP9 signalosome complex subunit 5b -like protein       134   3e-35   Gossypium arboreum [tree cotton]
gb|KJB55193.1|  hypothetical protein B456_009G068200                    134   3e-35   Gossypium raimondii
gb|KJB55194.1|  hypothetical protein B456_009G068200                    134   3e-35   Gossypium raimondii
gb|KJB55195.1|  hypothetical protein B456_009G068200                    134   4e-35   Gossypium raimondii
ref|NP_177279.1|  COP9 signalosome complex subunit 5b                   134   6e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAC36343.1|  AJH2                                                    134   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471135.1|  PREDICTED: COP9 signalosome complex subunit ...    134   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006302454.1|  hypothetical protein CARUB_v10020540mg             133   1e-34   Capsella rubella
ref|XP_007011590.1|  COP9-signalosome 5B                                133   1e-34   
ref|XP_010427950.1|  PREDICTED: COP9 signalosome complex subunit ...    132   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011031359.1|  PREDICTED: COP9 signalosome complex subunit ...    132   2e-34   Populus euphratica
ref|XP_010551182.1|  PREDICTED: COP9 signalosome complex subunit 5b     132   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_010415831.1|  PREDICTED: COP9 signalosome complex subunit ...    132   4e-34   Camelina sativa [gold-of-pleasure]
gb|EYU29154.1|  hypothetical protein MIMGU_mgv1a0088022mg               126   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_011076561.1|  PREDICTED: COP9 signalosome complex subunit ...    131   6e-34   Sesamum indicum [beniseed]
dbj|BAJ34223.1|  unnamed protein product                                128   1e-33   Eutrema halophilum
ref|XP_004501247.1|  PREDICTED: COP9 signalosome complex subunit ...    130   1e-33   Cicer arietinum [garbanzo]
ref|XP_002324396.1|  COP9 complex family protein                        129   2e-33   
ref|XP_006390791.1|  hypothetical protein EUTSA_v10018788mg             129   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011082083.1|  PREDICTED: COP9 signalosome complex subunit ...    128   3e-33   Sesamum indicum [beniseed]
ref|XP_011082082.1|  PREDICTED: COP9 signalosome complex subunit ...    129   5e-33   Sesamum indicum [beniseed]
ref|XP_001775449.1|  predicted protein                                  126   4e-32   
ref|XP_011045010.1|  PREDICTED: COP9 signalosome complex subunit ...    125   1e-31   Populus euphratica
ref|XP_010048447.1|  PREDICTED: COP9 signalosome complex subunit ...    125   1e-31   Eucalyptus grandis [rose gum]
gb|KFK44380.1|  hypothetical protein AALP_AA1G249900                    124   2e-31   Arabis alpina [alpine rockcress]
ref|XP_006416142.1|  hypothetical protein EUTSA_v10008042mg             124   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_003603531.1|  COP9 signalosome complex subunit 5b                124   2e-31   
gb|AAC26484.1|  putative JUN kinase activation domain binding pro...    124   2e-31   Medicago sativa [alfalfa]
ref|XP_009115580.1|  PREDICTED: COP9 signalosome complex subunit 5b     124   4e-31   Brassica rapa
ref|XP_006305189.1|  hypothetical protein CARUB_v10009554mg             123   4e-31   Capsella rubella
ref|XP_010914180.1|  PREDICTED: COP9 signalosome complex subunit ...    122   1e-30   Elaeis guineensis
gb|ACJ84456.1|  unknown                                                 122   1e-30   Medicago truncatula
ref|XP_010498782.1|  PREDICTED: COP9 signalosome complex subunit ...    122   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002893252.1|  hypothetical protein ARALYDRAFT_472541             122   2e-30   
ref|XP_010929274.1|  PREDICTED: COP9 signalosome complex subunit ...    122   2e-30   Elaeis guineensis
ref|XP_006845674.1|  hypothetical protein AMTR_s00019p00231450          122   2e-30   Amborella trichopoda
gb|EPS57884.1|  hypothetical protein M569_16932                         119   2e-30   Genlisea aurea
ref|XP_010929275.1|  PREDICTED: COP9 signalosome complex subunit ...    121   2e-30   
ref|XP_008810007.1|  PREDICTED: COP9 signalosome complex subunit ...    121   3e-30   Phoenix dactylifera
ref|XP_010460061.1|  PREDICTED: COP9 signalosome complex subunit ...    121   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009420301.1|  PREDICTED: COP9 signalosome complex subunit ...    120   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24758.1|  unknown                                                 120   6e-30   Picea sitchensis
ref|XP_010477567.1|  PREDICTED: COP9 signalosome complex subunit 5b     120   7e-30   Camelina sativa [gold-of-pleasure]
gb|AAM65053.1|  putative JUN kinase activator protein                   119   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAC36344.1|  AJH1                                                    119   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001752249.1|  predicted protein                                  119   2e-29   
ref|NP_173705.1|  COP9 signalosome complex subunit 5a                   119   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382165.1|  COP9 complex family protein                        119   3e-29   Populus trichocarpa [western balsam poplar]
ref|NP_973890.1|  COP9 signalosome complex subunit 5a                   118   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652935.1|  PREDICTED: COP9 signalosome complex subunit ...    117   8e-29   Oryza brachyantha
ref|XP_004960128.1|  PREDICTED: COP9 signalosome complex subunit ...    117   9e-29   Setaria italica
tpg|DAA35639.1|  TPA: hypothetical protein ZEAMMB73_882531              114   1e-28   
ref|NP_001054112.1|  Os04g0654700                                       116   2e-28   
gb|EEC78160.1|  hypothetical protein OsI_17724                          116   2e-28   Oryza sativa Indica Group [Indian rice]
gb|KHG22386.1|  COP9 signalosome complex subunit 5a -like protein       115   3e-28   Gossypium arboreum [tree cotton]
ref|NP_001149650.1|  COP9 signalosome complex subunit 5b                115   4e-28   Zea mays [maize]
gb|KJB65954.1|  hypothetical protein B456_010G123100                    113   9e-28   Gossypium raimondii
gb|KJB65952.1|  hypothetical protein B456_010G123100                    113   1e-27   Gossypium raimondii
gb|KJB65950.1|  hypothetical protein B456_010G123100                    113   1e-27   Gossypium raimondii
gb|KJB65951.1|  hypothetical protein B456_010G123100                    113   2e-27   Gossypium raimondii
ref|XP_002961002.1|  hypothetical protein SELMODRAFT_73440              112   6e-27   
ref|XP_002967006.1|  hypothetical protein SELMODRAFT_168868             112   6e-27   
ref|XP_009103210.1|  PREDICTED: COP9 signalosome complex subunit ...    111   1e-26   Brassica rapa
emb|CDY25761.1|  BnaA07g10210D                                          111   1e-26   Brassica napus [oilseed rape]
ref|XP_010240543.1|  PREDICTED: COP9 signalosome complex subunit ...    108   1e-25   Brachypodium distachyon [annual false brome]
dbj|BAJ93853.1|  predicted protein                                      108   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09486.1|  hypothetical protein F775_29820                         108   1e-25   
emb|CAE03401.3|  OSJNBa0071I13.2                                        108   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EIE80444.1|  hypothetical protein RO3G_05149                         100   1e-22   Rhizopus delemar RA 99-880
gb|AAR10246.1|  similar to Drosophila melanogaster CSN5               97.4    2e-22   Drosophila yakuba
emb|CDY12502.1|  BnaC07g13420D                                        99.8    2e-22   Brassica napus [oilseed rape]
gb|EPB91337.1|  COP9 signalosome complex subunit 5a                   99.0    3e-22   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001990340.1|  GH19288                                          98.6    4e-22   Drosophila grimshawi
dbj|GAN00834.1|  COP9-signalosome 5B                                  99.0    4e-22   Mucor ambiguus
ref|XP_008217721.1|  PREDICTED: COP9 signalosome complex subunit ...  98.6    4e-22   
ref|XP_008217730.1|  PREDICTED: COP9 signalosome complex subunit ...  98.6    5e-22   Nasonia vitripennis
ref|XP_003424702.2|  PREDICTED: COP9 signalosome complex subunit ...  99.0    5e-22   Nasonia vitripennis
gb|AAD27862.2|AF132563_1  LD14392p                                    98.6    5e-22   Drosophila melanogaster
dbj|BAH71669.1|  ACYPI006786                                          95.1    6e-22   Acyrthosiphon pisum
emb|CEP10016.1|  hypothetical protein                                 99.0    6e-22   Parasitella parasitica
ref|XP_001954897.1|  GF18500                                          97.8    7e-22   
ref|XP_006675144.1|  hypothetical protein BATDEDRAFT_15731            97.8    9e-22   Batrachochytrium dendrobatidis JAM81
ref|NP_001262639.1|  COP9 complex homolog subunit 5, isoform B        97.4    1e-21   Drosophila melanogaster
ref|NP_477442.1|  COP9 complex homolog subunit 5, isoform A           97.4    1e-21   Drosophila melanogaster
ref|XP_002103175.1|  GD19103                                          97.4    1e-21   
ref|XP_002074130.1|  GK14483                                          97.4    1e-21   Drosophila willistoni
ref|XP_001980192.1|  GG17007                                          97.4    1e-21   Drosophila erecta
gb|AAD28608.1|AF129083_1  COP9 signalosome subunit 5 CSN5             97.4    1e-21   Drosophila melanogaster
emb|CEJ02827.1|  Putative COP9 signalosome complex subunit 5a         94.7    1e-21   Rhizopus microsporus
ref|XP_006565324.1|  PREDICTED: COP9 signalosome complex subunit ...  97.1    2e-21   Apis mellifera [bee]
gb|EFN79117.1|  COP9 signalosome complex subunit 5                    97.1    2e-21   Harpegnathos saltator
ref|XP_011147627.1|  PREDICTED: COP9 signalosome complex subunit ...  97.4    2e-21   Harpegnathos saltator
ref|XP_011267966.1|  PREDICTED: COP9 signalosome complex subunit 5    96.7    2e-21   Camponotus floridanus
ref|XP_002422812.1|  COP9 signalosome complex subunit, putative       96.3    2e-21   Pediculus humanus corporis [human body lice]
ref|XP_001636625.1|  predicted protein                                96.3    3e-21   Nematostella vectensis
ref|XP_002056387.1|  GJ10255                                          96.3    3e-21   Drosophila virilis
ref|XP_003700698.1|  PREDICTED: COP9 signalosome complex subunit ...  95.9    4e-21   Megachile rotundata
ref|XP_001998673.1|  GI23503                                          95.9    4e-21   Drosophila mojavensis
ref|XP_011332242.1|  PREDICTED: COP9 signalosome complex subunit 5    95.9    5e-21   Ooceraea biroi
ref|XP_008485715.1|  PREDICTED: COP9 signalosome complex subunit ...  95.9    5e-21   Diaphorina citri
ref|XP_008479869.1|  PREDICTED: COP9 signalosome complex subunit ...  95.9    5e-21   Diaphorina citri
ref|XP_001359383.1|  GA13321                                          95.5    5e-21   Drosophila pseudoobscura pseudoobscura
ref|XP_011502813.1|  PREDICTED: COP9 signalosome complex subunit 5    95.5    5e-21   Ceratosolen solmsi marchali
ref|NP_001138802.1|  JAB-MPN domain protein                           95.5    6e-21   Bombyx mori [silk moth]
gb|KDR11248.1|  COP9 signalosome complex subunit 5                    95.5    6e-21   Zootermopsis nevadensis
gb|KFM80396.1|  COP9 signalosome complex subunit 5                    91.7    6e-21   Stegodyphus mimosarum
ref|XP_011147629.1|  PREDICTED: COP9 signalosome complex subunit ...  94.7    9e-21   Harpegnathos saltator
ref|XP_011147628.1|  PREDICTED: COP9 signalosome complex subunit ...  94.7    9e-21   
ref|XP_008548790.1|  PREDICTED: COP9 signalosome complex subunit ...  94.7    1e-20   Microplitis demolitor
gb|EHL03671.1|  putative COP9 signalosome complex subunit 5           94.4    1e-20   Glarea lozoyensis 74030
emb|CEG64164.1|  Putative COP9 signalosome complex subunit 5a         94.4    1e-20   Rhizopus microsporus
ref|XP_638491.1|  Mov34/MPN/PAD-1 family protein                      94.4    1e-20   Dictyostelium discoideum AX4
ref|XP_008185322.1|  PREDICTED: COP9 complex homolog subunit 5 is...  94.4    1e-20   Acyrthosiphon pisum
ref|NP_001156462.1|  COP9 complex homolog subunit 5                   94.4    1e-20   Acyrthosiphon pisum
ref|XP_002129245.1|  PREDICTED: COP9 signalosome complex subunit ...  94.4    2e-20   Ciona intestinalis [sea vase]
ref|XP_008083662.1|  JAB1/MPN                                         94.0    2e-20   Glarea lozoyensis ATCC 20868
ref|XP_004205813.1|  PREDICTED: COP9 signalosome complex subunit ...  92.0    2e-20   
ref|XP_011182476.1|  PREDICTED: COP9 signalosome complex subunit 5    94.0    2e-20   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011209192.1|  PREDICTED: COP9 signalosome complex subunit 5    94.0    2e-20   Bactrocera dorsalis [papaya fruit fly]
ref|XP_003399828.1|  PREDICTED: COP9 signalosome complex subunit ...  94.0    2e-20   
ref|XP_003399827.1|  PREDICTED: COP9 signalosome complex subunit ...  94.0    2e-20   Bombus terrestris [large earth bumblebee]
ref|XP_623836.1|  PREDICTED: COP9 signalosome complex subunit 5 i...  94.0    2e-20   Apis mellifera [bee]
ref|XP_003486847.1|  PREDICTED: COP9 signalosome complex subunit ...  94.0    2e-20   Bombus impatiens
ref|XP_001649479.1|  AAEL014747-PA                                    93.6    2e-20   
emb|CCG82078.1|  putative COP9 signalosome subunit 5                  94.0    2e-20   Taphrina deformans PYCC 5710
ref|XP_007914606.1|  putative cop9 signalosome complex subunit 5 ...  93.6    3e-20   Phaeoacremonium minimum UCRPA7
gb|ESZ94555.1|  COP9 signalosome complex subunit 5                    93.6    3e-20   Sclerotinia borealis F-4128
gb|EMS48301.1|  COP9 signalosome complex subunit 5b                   93.2    3e-20   Triticum urartu
ref|XP_011171452.1|  PREDICTED: COP9 signalosome complex subunit 5    93.2    3e-20   Solenopsis invicta [imported red fire ant]
ref|XP_006956806.1|  hypothetical protein WALSEDRAFT_59607            93.2    4e-20   Wallemia mellicola CBS 633.66
ref|XP_011292660.1|  PREDICTED: COP9 signalosome complex subunit 5    93.2    4e-20   Musca domestica
gb|ADP30958.1|  COP9 constitutive photomorphogenic-like protein s...  93.2    4e-20   Penaeus monodon [giant tiger prawn]
ref|XP_001595259.1|  hypothetical protein SS1G_03348                  93.2    4e-20   Sclerotinia sclerotiorum 1980 UF-70
ref|NP_500841.1|  Protein CSN-5                                       93.2    5e-20   Caenorhabditis elegans [roundworm]
ref|XP_001862398.1|  COP9 signalosome complex subunit 5               93.6    5e-20   Culex quinquefasciatus
dbj|BAE87894.1|  unnamed protein product                              89.7    6e-20   Macaca fascicularis [crab eating macaque]
ref|XP_009267304.1|  COP9 signalosome complex subunit 5               92.4    6e-20   Wallemia ichthyophaga EXF-994
ref|XP_007825082.1|  signaling protein                                92.4    7e-20   Metarhizium robertsii ARSEF 23
ref|XP_002584116.1|  COP9 signalosome complex subunit 5               92.4    7e-20   Uncinocarpus reesii 1704
ref|XP_007779451.1|  COP9 signalosome complex subunit 5               92.4    7e-20   Coniosporium apollinis CBS 100218
ref|XP_011049626.1|  PREDICTED: COP9 signalosome complex subunit ...  92.4    7e-20   Acromyrmex echinatior
gb|KFG82749.1|  COP9 signalosome complex subunit 5                    92.4    7e-20   Metarhizium anisopliae
ref|XP_002633848.1|  C. briggsae CBR-CSN-5 protein                    92.4    7e-20   Caenorhabditis briggsae
ref|XP_003712833.1|  COP9 signalosome complex subunit 5               92.4    7e-20   Magnaporthe oryzae 70-15
ref|XP_011049625.1|  PREDICTED: COP9 signalosome complex subunit ...  92.4    7e-20   Acromyrmex echinatior
gb|KID75045.1|  COP9 signalosome complex subunit 5                    92.4    7e-20   Metarhizium brunneum ARSEF 3297
ref|XP_003101399.1|  CRE-CSN-5 protein                                92.4    8e-20   Caenorhabditis remanei
gb|AEE62710.1|  unknown                                               92.4    8e-20   Dendroctonus ponderosae
gb|KID87397.1|  COP9 signalosome complex subunit 5                    92.0    8e-20   Metarhizium guizhouense ARSEF 977
dbj|BAN21083.1|  jun activation domain binding protein                92.0    9e-20   Riptortus pedestris
ref|XP_011049624.1|  PREDICTED: COP9 signalosome complex subunit ...  92.4    9e-20   Acromyrmex echinatior
ref|XP_007248979.1|  PREDICTED: COP9 signalosome complex subunit 5    92.0    1e-19   Astyanax mexicanus [blind cave fish]
emb|CEG78022.1|  Putative COP9 signalosome complex subunit 5a         92.0    1e-19   Rhizopus microsporus
ref|XP_007811766.1|  COP9 signalosome complex subunit 5               92.0    1e-19   Metarhizium acridum CQMa 102
gb|KIW00274.1|  hypothetical protein PV09_08164                       91.7    1e-19   Verruconis gallopava
dbj|BAM18530.1|  COP9 complex homolog subunit 5                       91.7    2e-19   Papilio xuthus [Chinese swallowtail]
ref|XP_005099578.1|  PREDICTED: COP9 signalosome complex subunit ...  91.3    2e-19   Aplysia californica
ref|XP_002408598.1|  COP9 signalosome, subunit CSN5, putative         90.9    2e-19   
gb|EFW19686.1|  COP9 signalosome complex subunit 5                    91.3    2e-19   Coccidioides posadasii str. Silveira
ref|XP_003067409.1|  COP9 signalosome complex subunit 5, putative     91.3    2e-19   Coccidioides posadasii C735 delta SOWgp
ref|XP_001900779.1|  COP9 signalosome complex subunit 5               90.9    2e-19   Brugia malayi [agent of lymphatic filariasis]
dbj|GAM27607.1|  hypothetical protein SAMD00019534_107830             90.9    2e-19   Acytostelium subglobosum LB1
emb|CDS11961.1|  Putative COP9 signalosome complex subunit 5a         90.9    2e-19   Lichtheimia ramosa
emb|CDP99135.1|  Protein BM-CSN-5, isoform b                          91.3    2e-19   Brugia malayi [agent of lymphatic filariasis]
emb|CDP99134.1|  Protein BM-CSN-5, isoform d                          90.9    2e-19   Brugia malayi [agent of lymphatic filariasis]
ref|XP_972769.1|  PREDICTED: COP9 signalosome complex subunit 5       90.9    3e-19   
gb|EIT80237.1|  COP9 signalosome, subunit CSN5                        90.9    3e-19   Aspergillus oryzae 3.042
dbj|GAD91695.1|  COP9 signalosome complex subunit 5                   90.9    3e-19   Byssochlamys spectabilis No. 5
gb|KFZ02747.1|  hypothetical protein V502_11539                       90.9    3e-19   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_007885051.1|  PREDICTED: COP9 signalosome complex subunit ...  90.5    3e-19   Callorhinchus milii [Australian ghost shark]
gb|ADG37923.1|  AT1G22920-like protein                                85.5    3e-19   Capsella grandiflora
gb|KJB06586.1|  hypothetical protein B456_001G001700                  88.6    3e-19   Gossypium raimondii
ref|XP_001551965.1|  hypothetical protein BC1G_09577                  90.5    4e-19   Botrytis cinerea B05.10
gb|EJW89035.1|  JAB-MPN domain-containing protein                     90.1    4e-19   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_005663091.1|  PREDICTED: COP9 signalosome complex subunit ...  90.5    4e-19   Sus scrofa [pigs]
gb|ADG37922.1|  AT1G22920-like protein                                85.1    4e-19   Capsella grandiflora
gb|EPS32803.1|  hypothetical protein PDE_07763                        90.1    4e-19   Penicillium oxalicum 114-2
ref|XP_001249856.5|  PREDICTED: COP9 signalosome complex subunit ...  89.0    5e-19   
gb|KFY66915.1|  hypothetical protein V496_01853                       89.7    6e-19   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ACN61634.1|  COP9 signalosome subunit 5                            86.7    6e-19   Megaderma lyra [greater false vampire bat]
ref|XP_002626520.1|  COP9 signalosome complex subunit 5               89.7    6e-19   Blastomyces gilchristii SLH14081
ref|XP_003408260.1|  PREDICTED: COP9 signalosome complex subunit 5    88.6    6e-19   Loxodonta africana [African bush elephant]
emb|CAK42618.1|  unnamed protein product                              89.7    7e-19   Aspergillus niger
gb|ELR58372.1|  COP9 signalosome complex subunit 5                    89.7    7e-19   Bos mutus
gb|KFB47242.1|  hypothetical protein ZHAS_00015265                    89.7    7e-19   Anopheles sinensis
ref|XP_005770092.1|  hypothetical protein EMIHUDRAFT_75732            89.7    7e-19   Emiliania huxleyi CCMP1516
ref|XP_008148613.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    7e-19   
gb|ERG87648.1|  cop9 signalosome complex subunit 5                    89.7    7e-19   
ref|XP_001397194.2|  COP9 signalosome complex subunit 5               89.7    7e-19   Aspergillus niger CBS 513.88
ref|XP_007527171.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    7e-19   Erinaceus europaeus [common hedgehog]
ref|XP_004773046.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    7e-19   
emb|CDH56438.1|  cop9 signalosome complex subunit 5a-like             89.4    7e-19   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004588161.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    7e-19   Ochotona princeps [southern American pika]
dbj|GAA91502.1|  COP9 signalosome subunit CsnE                        89.4    7e-19   Aspergillus kawachii IFO 4308
ref|XP_006752490.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  89.4    7e-19   Leptonychotes weddellii
ref|XP_002609973.1|  hypothetical protein BRAFLDRAFT_124393           87.4    7e-19   Branchiostoma floridae
ref|XP_008106749.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    7e-19   Anolis carolinensis [Carolina anole]
ref|XP_011297758.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    8e-19   Fopius arisanus
ref|XP_001822456.2|  COP9 signalosome complex subunit 5               89.4    8e-19   
ref|NP_001179068.1|  COP9 signalosome complex subunit 5               89.4    8e-19   Bos taurus [bovine]
gb|EYC46046.1|  hypothetical protein Y032_0410g948                    90.1    8e-19   Ancylostoma ceylanicum
gb|EYC46045.1|  hypothetical protein Y032_0410g948                    89.7    8e-19   Ancylostoma ceylanicum
ref|XP_006150523.1|  PREDICTED: COP9 signalosome complex subunit ...  89.4    8e-19   
ref|NP_038743.1|  COP9 signalosome complex subunit 5 isoform 1        89.4    8e-19   Mus musculus [mouse]
ref|XP_003831400.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    8e-19   Pan paniscus [bonobo]
sp|Q5BBF1.2|CSN5_EMENI  RecName: Full=COP9 signalosome complex su...  89.4    8e-19   Aspergillus nidulans FGSC A4
ref|NP_001020866.1|  COP9 signalosome complex subunit 5               89.4    8e-19   Rattus norvegicus [brown rat]
ref|XP_535093.1|  PREDICTED: COP9 signalosome complex subunit 5 i...  89.4    8e-19   Canis lupus familiaris [dogs]
ref|XP_659733.1|  hypothetical protein AN2129.2                       89.4    8e-19   Aspergillus nidulans FGSC A4
ref|NP_006828.2|  COP9 signalosome complex subunit 5                  89.4    8e-19   Homo sapiens [man]
ref|XP_004602468.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    8e-19   Sorex araneus [Eurasian shrew]
gb|AAP36860.1|  Homo sapiens COP9 constitutive photomorphogenic h...  89.4    9e-19   synthetic construct
ref|XP_006860136.1|  PREDICTED: COP9 signalosome complex subunit 5    89.0    9e-19   Chrysochloris asiatica
ref|XP_001494265.1|  PREDICTED: COP9 signalosome complex subunit ...  89.4    9e-19   
gb|AAX37104.1|  COP9 constitutive photomorphogenic-like subunit 5     89.4    9e-19   synthetic construct
gb|AAB16847.1|  Jun activation domain binding protein                 89.4    9e-19   Homo sapiens [man]
gb|ACO14355.1|  COP9 signalosome complex subunit 5                    87.8    9e-19   Esox lucius
ref|NP_001086291.1|  COP9 signalosome complex subunit 5               89.0    1e-18   Xenopus laevis [clawed frog]
ref|NP_989109.1|  COP9 signalosome complex subunit 5                  89.0    1e-18   Xenopus tropicalis [western clawed frog]
gb|KHN97596.1|  COP9 signalosome complex subunit 5                    89.4    1e-18   Metarhizium album ARSEF 1941
gb|KFY87142.1|  hypothetical protein V500_07158                       89.4    1e-18   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|EYE96574.1|  COP9 signalosome subunit CsnE                         89.0    1e-18   Aspergillus ruber CBS 135680
ref|XP_004638141.1|  PREDICTED: COP9 signalosome complex subunit ...  89.0    1e-18   Octodon degus
ref|XP_001239887.1|  hypothetical protein CIMG_09508                  89.0    1e-18   Coccidioides immitis RS
ref|XP_004679877.1|  PREDICTED: COP9 signalosome complex subunit 5    89.0    1e-18   Condylura cristata
ref|XP_007839403.1|  COP9 signalosome complex subunit 5               89.4    1e-18   Pestalotiopsis fici W106-1
ref|XP_007429682.1|  PREDICTED: COP9 signalosome complex subunit 5    89.0    1e-18   Python bivittatus
ref|XP_003292126.1|  Mov34/MPN/PAD-1 family protein                   89.0    1e-18   Dictyostelium purpureum
gb|KID97652.1|  COP9 signalosome complex subunit 5                    89.0    1e-18   Metarhizium majus ARSEF 297
ref|XP_005066755.1|  PREDICTED: COP9 signalosome complex subunit 5    89.7    1e-18   
ref|XP_006131545.1|  PREDICTED: COP9 signalosome complex subunit ...  89.0    1e-18   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFY28089.1|  hypothetical protein V493_03095                       89.0    1e-18   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_004354957.1|  Mov34/MPN/PAD-1 family protein                   89.4    1e-18   Cavenderia fasciculata
ref|XP_006815652.1|  PREDICTED: COP9 signalosome complex subunit ...  88.6    1e-18   Saccoglossus kowalevskii
ref|XP_007651216.1|  PREDICTED: COP9 signalosome complex subunit ...  89.4    1e-18   
gb|ESA08506.1|  hypothetical protein GLOINDRAFT_349082                89.0    1e-18   
ref|XP_005866406.1|  PREDICTED: COP9 signalosome complex subunit 5    88.6    1e-18   Myotis brandtii
ref|XP_008072512.1|  PREDICTED: COP9 signalosome complex subunit 5    89.4    1e-18   Carlito syrichta
ref|XP_006069587.1|  PREDICTED: COP9 signalosome complex subunit ...  88.6    1e-18   
gb|EXX54839.1|  Rri1p                                                 88.2    1e-18   Rhizophagus irregularis DAOM 197198w
ref|XP_003045242.1|  predicted protein                                88.6    1e-18   [Nectria] haematococca mpVI 77-13-4
ref|XP_002145543.1|  COP9 signalosome subunit CsnE                    88.6    2e-18   Talaromyces marneffei ATCC 18224
ref|XP_006069586.1|  PREDICTED: COP9 signalosome complex subunit ...  89.4    2e-18   
ref|XP_007634273.1|  PREDICTED: COP9 signalosome complex subunit ...  89.4    2e-18   
gb|EKG20488.1|  Mov34/MPN/PAD-1                                       88.6    2e-18   Macrophomina phaseolina MS6
gb|ETE60341.1|  COP9 signalosome complex subunit 5                    89.0    2e-18   Ophiophagus hannah
gb|AET43978.1|  COP9 signalosome subunit 5                            88.2    2e-18   
ref|XP_009217063.1|  COP9 signalosome complex subunit 5               88.6    2e-18   
ref|XP_002486987.1|  COP9 signalosome subunit CsnE                    88.2    2e-18   
ref|NP_001098770.1|  COP9 signalosome complex subunit 5               88.2    2e-18   
ref|XP_005648133.1|  Mov34-domain-containing protein                  88.2    2e-18   
ref|XP_004842148.1|  PREDICTED: COP9 signalosome complex subunit ...  87.8    2e-18   
ref|XP_001368118.1|  PREDICTED: COP9 signalosome complex subunit 5    88.2    2e-18   
gb|KHN85679.1|  COP9 signalosome complex subunit 5                    88.2    3e-18   
gb|KIH48665.1|  Mov34/MPN/PAD-1 family protein                        84.7    3e-18   
gb|ETN63713.1|  jun activation domain binding protein                 87.8    3e-18   
ref|XP_006006856.1|  PREDICTED: COP9 signalosome complex subunit ...  87.4    3e-18   
gb|KFY26627.1|  hypothetical protein V491_01230                       88.2    3e-18   
gb|EGT48387.1|  hypothetical protein CAEBREN_22923                    88.2    3e-18   
gb|EGT56002.1|  hypothetical protein CAEBREN_15614                    88.2    3e-18   
gb|EFA83038.1|  Mov34/MPN/PAD-1 family protein                        88.2    3e-18   
gb|EPY74001.1|  COP9 signalosome complex subunit 5 isoform 1          89.7    3e-18   
emb|CAG00664.1|  unnamed protein product                              87.8    3e-18   
ref|XP_003967989.1|  PREDICTED: COP9 signalosome complex subunit ...  87.8    3e-18   
ref|XP_001538829.1|  COP9 signalosome complex subunit 5               87.8    3e-18   
gb|KFO20318.1|  COP9 signalosome complex subunit 5                    89.7    3e-18   
gb|ELW64697.1|  COP9 signalosome complex subunit 5                    89.4    3e-18   
gb|KIN05013.1|  hypothetical protein OIDMADRAFT_142793                87.8    4e-18   
gb|EEH04320.1|  COP9 signalosome complex subunit                      87.8    4e-18   
ref|XP_004842149.1|  PREDICTED: COP9 signalosome complex subunit ...  87.0    4e-18   
ref|XP_010756604.1|  COP9 signalosome complex subunit 5               87.4    4e-18   
ref|XP_312032.5|  AGAP002880-PA                                       87.4    4e-18   
ref|XP_010884175.1|  PREDICTED: COP9 signalosome complex subunit 5    87.4    4e-18   
ref|XP_001275909.1|  COP9 signalosome subunit CsnE                    87.4    4e-18   
ref|XP_004524029.1|  PREDICTED: COP9 signalosome complex subunit ...  87.4    4e-18   
ref|XP_004524030.1|  PREDICTED: COP9 signalosome complex subunit ...  87.4    4e-18   
ref|XP_001512862.1|  PREDICTED: COP9 signalosome complex subunit 5    87.4    4e-18   
ref|XP_006006855.1|  PREDICTED: COP9 signalosome complex subunit ...  87.4    4e-18   
gb|EGW14995.1|  COP9 signalosome complex subunit 5                    87.0    5e-18   
ref|XP_005311431.1|  PREDICTED: COP9 signalosome complex subunit ...  87.0    5e-18   
ref|XP_009029035.1|  hypothetical protein HELRODRAFT_185158           87.0    5e-18   
ref|XP_006262064.1|  PREDICTED: COP9 signalosome complex subunit 5    87.0    5e-18   
gb|ACO09632.1|  COP9 signalosome complex subunit 5                    87.0    5e-18   
ref|XP_001211499.1|  COP9 signalosome complex subunit 5               87.0    6e-18   
ref|XP_009957065.1|  PREDICTED: COP9 signalosome complex subunit ...  86.7    6e-18   
ref|XP_003323591.1|  COP9 signalosome complex subunit 5               87.0    7e-18   
ref|XP_005851620.1|  hypothetical protein CHLNCDRAFT_19207            87.0    7e-18   
gb|KFP96001.1|  COP9 signalosome complex subunit 5                    86.7    7e-18   
gb|ERE86124.1|  COP9 signalosome complex subunit 5                    89.4    7e-18   
gb|KEY80982.1|  COP9 signalosome subunit CsnE                         86.7    7e-18   
ref|XP_011448116.1|  PREDICTED: COP9 signalosome complex subunit ...  86.7    7e-18   
gb|EFO27045.2|  COP9 signalosome complex subunit 5                    87.0    8e-18   
gb|EDP55131.1|  COP9 signalosome subunit 5 (CsnE), putative           86.7    8e-18   
ref|XP_755961.2|  COP9 signalosome subunit CsnE                       86.7    8e-18   
emb|CDJ96405.1|  Mov34 MPN PAD-1 domain containing protein            87.0    8e-18   
ref|XP_002837843.1|  hypothetical protein                             86.7    8e-18   
gb|KFY77929.1|  hypothetical protein V499_02798                       86.7    9e-18   
gb|KFZ06481.1|  hypothetical protein V501_07359                       86.7    9e-18   
ref|XP_006634059.1|  PREDICTED: COP9 signalosome complex subunit ...  86.3    1e-17   
ref|XP_011448117.1|  PREDICTED: COP9 signalosome complex subunit ...  86.7    1e-17   
ref|XP_003842050.1|  hypothetical protein LEMA_P078100.1              87.0    1e-17   
ref|XP_006965508.1|  signaling protein                                86.3    1e-17   
ref|XP_007792821.1|  putative cop9 signalosome complex subunit 5 ...  86.3    1e-17   
gb|ACI68431.1|  COP9 signalosome complex subunit 5                    85.9    1e-17   
ref|XP_011400031.1|  COP9 signalosome complex subunit 5b              85.1    1e-17   
ref|XP_008597491.1|  Mov34/MPN/PAD-1 family protein                   85.9    1e-17   
dbj|GAK66062.1|  mov34-domain-containing protein                      86.3    2e-17   
gb|EGD96904.1|  COP9 signalosome complex subunit 5                    85.9    2e-17   
ref|XP_007410237.1|  hypothetical protein MELLADRAFT_116525           86.3    2e-17   
ref|XP_004081080.1|  PREDICTED: COP9 signalosome complex subunit 5    85.9    2e-17   
gb|KFY38702.1|  hypothetical protein V494_04244                       85.9    2e-17   
gb|KFY07234.1|  hypothetical protein V492_07331                       85.9    2e-17   
ref|XP_005797898.1|  PREDICTED: COP9 signalosome complex subunit ...  85.5    2e-17   
ref|XP_002791463.1|  COP9 signalosome complex subunit 5               85.5    2e-17   
ref|XP_007554550.1|  PREDICTED: COP9 signalosome complex subunit 5    85.5    2e-17   
ref|XP_008394459.1|  PREDICTED: COP9 signalosome complex subunit 5    85.5    2e-17   
ref|XP_003170580.1|  COP9 signalosome complex subunit 5               85.5    2e-17   
ref|XP_007876876.1|  hypothetical protein PFL1_01182                  85.9    2e-17   
ref|XP_003234683.1|  COP9 signalosome complex subunit 5               85.5    2e-17   
ref|XP_010732391.1|  PREDICTED: COP9 signalosome complex subunit 5    85.5    2e-17   
ref|XP_003301972.1|  hypothetical protein PTT_13630                   85.5    2e-17   
ref|XP_010777475.1|  PREDICTED: COP9 signalosome complex subunit 5    84.0    3e-17   
gb|KDE08164.1|  COP9 signalosome complex subunit 5                    85.5    3e-17   
gb|ELR02314.1|  COP9 signalosome complex subunit 5                    85.1    3e-17   
ref|XP_009045703.1|  hypothetical protein LOTGIDRAFT_224262           85.1    3e-17   
ref|XP_003443502.1|  PREDICTED: COP9 signalosome complex subunit ...  85.1    3e-17   
gb|KFX90480.1|  hypothetical protein V490_06441                       85.1    3e-17   
emb|CDJ85538.1|  Mov34 MPN PAD-1 domain containing protein            85.5    3e-17   
ref|XP_008305996.1|  PREDICTED: COP9 signalosome complex subunit 5    84.7    4e-17   
ref|NP_957019.1|  COP9 signalosome complex subunit 5                  84.7    4e-17   
dbj|GAC74200.1|  COP9 signalosome, subunit CSN5                       85.1    4e-17   
ref|XP_005517166.1|  PREDICTED: COP9 signalosome complex subunit ...  84.7    4e-17   
gb|KDN39096.1|  Mov34-domain-containing protein                       85.9    4e-17   
ref|NP_001232700.1|  putative JUN activation binding protein vari...  84.7    4e-17   
ref|NP_001034400.1|  COP9 signalosome complex subunit 5               84.7    4e-17   
ref|XP_009083861.1|  PREDICTED: COP9 signalosome complex subunit ...  84.7    4e-17   
ref|XP_005150843.1|  PREDICTED: COP9 signalosome complex subunit ...  84.7    4e-17   
ref|XP_010574204.1|  PREDICTED: COP9 signalosome complex subunit ...  84.7    4e-17   
gb|KFH67419.1|  COP9 signalosome complex subunit 5                    84.7    5e-17   
ref|NP_001158520.1|  COP9 signalosome complex subunit 5               84.3    5e-17   
gb|KIL95922.1|  hypothetical protein FAVG1_00660                      84.3    5e-17   
emb|CBN81931.1|  COP9 signalosome complex subunit 5                   84.3    5e-17   
ref|XP_002567243.1|  Pc21g01770                                       84.3    5e-17   
gb|KEZ45359.1|  COP9 signalosome complex subunit 5                    84.3    5e-17   
ref|XP_002848322.1|  COP9 signalosome complex subunit 5               84.3    6e-17   
emb|CEJ93266.1|  Putative COP9 signalosome complex subunit 5          84.0    7e-17   
ref|XP_009260100.1|  hypothetical protein FPSE_08707                  84.0    7e-17   
ref|XP_007586662.1|  putative cop9 signalosome complex subunit 5 ...  84.3    7e-17   
ref|XP_011318525.1|  COP9 signalosome complex subunit 5               84.0    7e-17   
gb|EGU11163.1|  COP9 signalosome complex subunit 5                    84.3    9e-17   
ref|XP_005712040.1|  unnamed protein product                          84.3    9e-17   
gb|KHJ34882.1|  putative cop9 signalosome complex subunit 5           83.2    1e-16   
ref|XP_008989617.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  84.0    1e-16   
gb|EPQ62061.1|  Catalytic subunit of the COP9 signalosome complex     83.2    1e-16   
ref|XP_005833249.1|  hypothetical protein GUITHDRAFT_107880           83.2    1e-16   
ref|XP_011109554.1|  hypothetical protein H072_3584                   83.6    1e-16   
ref|XP_004047172.1|  PREDICTED: COP9 signalosome complex subunit 5    84.7    1e-16   
gb|EFX73885.1|  hypothetical protein DAPPUDRAFT_109433                82.8    2e-16   
emb|CCU75067.1|  COP9 signalosome complex subunit 5                   83.2    2e-16   
ref|XP_011120074.1|  hypothetical protein AOL_s00054g456              83.2    2e-16   
gb|EME47502.1|  hypothetical protein DOTSEDRAFT_69442                 83.2    2e-16   
emb|CEG04727.1|  unnamed protein product                              83.2    2e-16   
gb|ETS64168.1|  hypothetical protein PaG_01404                        83.2    2e-16   
ref|XP_007066265.1|  PREDICTED: COP9 signalosome complex subunit 5    82.8    2e-16   
ref|XP_007674494.1|  hypothetical protein BAUCODRAFT_32485            82.8    2e-16   
gb|EPZ33258.1|  JAB1/Mov34/MPN/PAD-1 domain-containing protein        82.4    3e-16   
emb|CEF67816.1|  COP9 signalosome complex subunit 5                   83.2    3e-16   
gb|KIJ25292.1|  hypothetical protein M422DRAFT_785628                 82.8    3e-16   
gb|EHK17806.1|  hypothetical protein TRIVIDRAFT_43384                 82.4    3e-16   
dbj|BAE61323.1|  unnamed protein product                              82.0    3e-16   
gb|KIZ06923.1|  COP9 signalosome complex subunit 5                    82.8    3e-16   
dbj|GAM35035.1|  hypothetical protein TCE0_015r03023                  82.8    3e-16   
pdb|4D18|E  Chain E, Crystal Structure Of The Cop9 Signalosome        82.0    3e-16   
dbj|GAA27173.1|  COP9 signalosome complex subunit 5                   82.4    3e-16   
ref|XP_007923897.1|  CSN5 cop9 signalosome subunit 5                  82.4    3e-16   
gb|EMD90731.1|  hypothetical protein COCHEDRAFT_1022509               82.4    3e-16   
ref|XP_004363323.1|  constitutive photomorphogenic 9 complex chai...  82.4    3e-16   
ref|XP_001261089.1|  COP9 signalosome subunit 5 (CsnE), putative      82.0    3e-16   
gb|KFM00893.1|  COP9 signalosome complex subunit 5                    82.0    4e-16   
gb|EWC48220.1|  COP9 signalosome complex subunit 5                    82.0    4e-16   
gb|KIM42468.1|  hypothetical protein M413DRAFT_444883                 82.4    4e-16   
ref|XP_567446.1|  hypothetical protein                                82.4    4e-16   
ref|XP_008022372.1|  hypothetical protein SETTUDRAFT_146496           82.0    4e-16   
gb|KIJ37072.1|  hypothetical protein M422DRAFT_33926                  82.4    4e-16   
emb|CCX31218.1|  Similar to COP9 signalosome complex subunit 5; a...  81.6    5e-16   
gb|KDR72698.1|  hypothetical protein GALMADRAFT_252900                82.0    5e-16   
gb|EMS21844.1|  COP9 signalosome complex subunit 5                    82.4    5e-16   
ref|XP_003137030.1|  COP9 signalosome complex subunit 5               82.0    5e-16   
ref|WP_028836347.1|  hypothetical protein                             79.3    5e-16   
ref|XP_007705204.1|  hypothetical protein COCSADRAFT_31162            81.6    5e-16   
ref|XP_007715257.1|  hypothetical protein COCCADRAFT_103980           81.6    5e-16   
gb|EWZ38250.1|  COP9 signalosome complex subunit 5                    81.6    6e-16   
ref|XP_007682348.1|  hypothetical protein COCMIDRAFT_31624            81.6    6e-16   
gb|KGO74703.1|  JAB1/Mov34/MPN/PAD-1                                  81.3    6e-16   
gb|KIO31911.1|  hypothetical protein M407DRAFT_14046                  82.0    6e-16   
gb|KGO43020.1|  JAB1/Mov34/MPN/PAD-1                                  81.3    7e-16   
gb|AII16527.1|  COP9 signalosome complex subunit 5                    81.3    7e-16   
ref|XP_008041270.1|  Mov34-domain-containing protein                  81.6    7e-16   
gb|EFX02985.1|  cop9 signalosome complex subunit 5                    81.3    8e-16   
gb|EKV06221.1|  COP9 signalosome complex subunit 5                    80.9    8e-16   
emb|CEL63357.1|  COP9 signalosome complex subunit 5                   81.6    8e-16   
ref|XP_007263567.1|  Mov34-domain-containing protein                  81.3    8e-16   
ref|XP_007332426.1|  hypothetical protein AGABI1DRAFT_62649           81.3    9e-16   
gb|KEQ90620.1|  hypothetical protein AUEXF2481DRAFT_44949             81.3    9e-16   
gb|KIR85968.1|  COP9 signalosome complex subunit 5                    81.3    9e-16   
gb|KIR47282.1|  COP9 signalosome complex subunit 5                    81.3    9e-16   
gb|KGB79807.1|  COP9 signalosome complex subunit 5                    81.3    1e-15   
ref|XP_006464013.1|  hypothetical protein AGABI2DRAFT_209023          80.9    1e-15   
gb|KIR60500.1|  COP9 signalosome complex subunit 5                    81.3    1e-15   
gb|EXM23599.1|  COP9 signalosome complex subunit 5                    80.9    1e-15   
gb|KIW64077.1|  hypothetical protein PV04_09035                       81.3    1e-15   
ref|XP_002952633.1|  hypothetical protein VOLCADRAFT_81927            81.3    1e-15   
gb|ENH66122.1|  COP9 signalosome complex subunit 5                    80.9    1e-15   
ref|XP_003196240.1|  COP9 signalosome complex subunit 5a              81.3    1e-15   
gb|EGU77467.1|  hypothetical protein FOXB_12018                       80.9    1e-15   
gb|KIL64761.1|  hypothetical protein M378DRAFT_77858                  81.3    1e-15   
gb|KIR26311.1|  COP9 signalosome complex subunit 5                    81.3    1e-15   
gb|KIR33021.1|  COP9 signalosome complex subunit 5                    81.3    1e-15   
emb|CCF45142.1|  COP9 signalosome complex subunit 5                   78.6    1e-15   
gb|EPE04275.1|  cop9 signalosome complex subunit 5                    80.9    1e-15   
gb|ENH86283.1|  cop9 signalosome complex subunit 5                    80.5    1e-15   
ref|XP_004353437.1|  signalosome complex protein                      80.5    1e-15   
ref|XP_007760657.1|  COP9 signalosome complex subunit 5               80.9    2e-15   
ref|XP_006667797.1|  COP9 signalosome complex subunit 5               80.1    2e-15   
emb|CCO32282.1|  COP9 signalosome complex subunit 5                   82.4    2e-15   
gb|KIJ90495.1|  hypothetical protein K443DRAFT_686728                 80.5    2e-15   
gb|AFR97407.1|  COP9 signalosome complex subunit 5                    80.5    2e-15   
gb|EMT70768.1|  COP9 signalosome complex subunit 5                    80.1    2e-15   
ref|XP_001882520.1|  predicted protein                                80.5    2e-15   
gb|KIH87190.1|  COP9 signalosome complex subunit 5                    80.5    2e-15   
gb|EXA45836.1|  COP9 signalosome complex subunit 5                    80.5    2e-15   
pdb|4F7O|A  Chain A, Crystal Structure Of Csn5                        79.3    2e-15   
ref|XP_003010514.1|  hypothetical protein ARB_03215                   80.1    2e-15   
ref|XP_003023342.1|  hypothetical protein TRV_02444                   80.1    2e-15   
ref|XP_001418095.1|  predicted protein                                79.7    2e-15   
ref|XP_003003370.1|  COP9 signalosome complex subunit 5               80.1    2e-15   
ref|XP_009162505.1|  hypothetical protein T265_00468                  82.4    2e-15   
gb|EWG49634.1|  COP9 signalosome complex subunit 5                    79.7    2e-15   
emb|CEF98127.1|  JAB/MPN domain                                       79.7    2e-15   
gb|EHJ73122.1|  JAB-MPN domain protein                                80.5    3e-15   
gb|KEQ88208.1|  Mov34/MPN/PAD-1 family protein                        79.7    3e-15   
ref|XP_009274936.1|  PREDICTED: COP9 signalosome complex subunit 5    79.7    3e-15   
emb|CCT69379.1|  probable COP9 signalosome subunit 5 CSN5             79.7    3e-15   
ref|XP_007856350.1|  cop9 signalosome complex subunit 5               80.1    3e-15   
emb|CDO75755.1|  hypothetical protein BN946_scf184921.g31             79.7    3e-15   
emb|CDI54484.1|  probable COP9 signalosome subunit 5 CSN5             80.1    4e-15   
gb|ELU36317.1|  jun coactivator Jab1                                  79.7    4e-15   
ref|XP_011390212.1|  putative COP9 signalosome, subunit 5             80.1    4e-15   
gb|EXL57713.1|  COP9 signalosome complex subunit 5                    79.0    5e-15   
gb|EUC54240.1|  COP9 signalosome complex subunit 5                    79.3    5e-15   
gb|KDN64741.1|  putative Mov34/MPN/PAD-1 family protein               79.0    5e-15   
ref|XP_003029105.1|  hypothetical protein SCHCODRAFT_70193            79.3    5e-15   
emb|CBQ68370.1|  probable COP9 signalosome subunit 5 CSN5             79.7    6e-15   
gb|AAD03468.1|  38 kDa Mov34 homolog                                  78.6    6e-15   
ref|XP_001694818.1|  COP signalosome subunit 5                        78.6    6e-15   
ref|XP_007285194.1|  cop9 signalosome complex subunit 5               79.0    6e-15   
gb|KIY32538.1|  COP9 signalosome complex subunit 5                    79.0    6e-15   
ref|XP_003740357.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    7e-15   
gb|KIY62389.1|  Mov34-domain-containing protein                       78.6    8e-15   
gb|KFA65470.1|  hypothetical protein S40285_00541                     78.6    8e-15   
gb|KFA52787.1|  hypothetical protein S40293_00864                     78.6    8e-15   
ref|XP_003854884.1|  COP9 signalosome complex subunit 5               78.2    8e-15   
gb|KEY69019.1|  hypothetical protein S7711_03321                      78.6    8e-15   
ref|XP_007289754.1|  COP9 signalosome complex subunit 5               79.0    8e-15   
gb|EHK48656.1|  hypothetical protein TRIATDRAFT_134074                78.2    9e-15   
gb|EFQ25122.1|  Mov34/MPN/PAD-1 family protein                        78.2    1e-14   
gb|ELW70526.1|  COP9 signalosome complex subunit 5                    76.6    1e-14   



>ref|XP_004138765.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 ref|XP_004160845.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 gb|KGN62874.1| hypothetical protein Csa_2G378560 [Cucumis sativus]
Length=365

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  59   QNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  95



>ref|XP_008445090.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Cucumis 
melo]
Length=365

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  59   QNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  95



>ref|XP_002283561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Vitis vinifera]
Length=360

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 79/95 (83%), Gaps = 9/95 (9%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            SFTSSA+IAQKTWE+ENN+ +MD P         SA SD+IF+YD+ AQ KFQQEKPW N
Sbjct  5    SFTSSASIAQKTWELENNIASMDAP---------SADSDSIFFYDDAAQAKFQQEKPWAN  55

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYFKRVKISALALLKMVVHARSGG IEVMGLMQ
Sbjct  56   DPHYFKRVKISALALLKMVVHARSGGNIEVMGLMQ  90



>gb|KDP33444.1| hypothetical protein JCGZ_07015 [Jatropha curcas]
Length=366

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 3/98 (3%)
 Frame = +2

Query  65   MDSFTSSAA-IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  241
            MD + SS+A IAQKTWE+ENN+ T+D  PT+  +A AS+ +  IFYYDETAQ KFQQ+KP
Sbjct  1    MDPYPSSSALIAQKTWELENNIITVDTSPTTNSTADASSDA--IFYYDETAQAKFQQDKP  58

Query  242  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            W NDPHYF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  59   WANDPHYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  96



>ref|XP_010111938.1| COP9 signalosome complex subunit 5b [Morus notabilis]
 gb|EXC32056.1| COP9 signalosome complex subunit 5b [Morus notabilis]
Length=368

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLP-PTsadsaaasassdaIFYYDETAQTKFQQEKP  241
            M++F SS+ IAQ+TWE+ENN+  M+ P P +   ++   SSDA+FYYDE AQ KFQQEKP
Sbjct  1    MEAFPSSSQIAQQTWELENNIIPMETPTPPATAKSSGGDSSDAVFYYDEAAQAKFQQEKP  60

Query  242  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            W+NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   WSNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  98



>ref|XP_002527960.1| jun activation domain binding protein, putative [Ricinus communis]
 gb|EEF34372.1| jun activation domain binding protein, putative [Ricinus communis]
Length=367

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +SS+ IAQKTWE+ENN+ T+D PPT+  +A  S+ +  IFYYDE AQ KFQQ++PW+NDP
Sbjct  7    SSSSVIAQKTWELENNIITVDTPPTTNSTADPSSDA--IFYYDEPAQVKFQQDRPWSNDP  64

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            HYF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  65   HYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_006351153.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 87/97 (90%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_006450163.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 gb|ESR63403.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=337

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_006450164.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483569.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Citrus sinensis]
 gb|ESR63404.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=361

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_006450165.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483570.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Citrus sinensis]
 gb|ESR63405.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=360

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>gb|KDO67280.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=360

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_007221779.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
 ref|XP_008219932.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Prunus mume]
 gb|EMJ22978.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
Length=366

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A IAQ+TWE+ENN+  MD PP+ A S A  ++   IFYYDE AQ KFQQEKPWTNDPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKSKADPSADA-IFYYDEAAQAKFQQEKPWTNDPHYF  61

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQ  91



>gb|KDO67279.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=361

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_011459046.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=360

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   KRVKISALALLKMVVHARSGGTIEVMGLMQ  89



>ref|XP_004291259.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=359

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   KRVKISALALLKMVVHARSGGTIEVMGLMQ  89



>ref|XP_009617619.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
tomentosiformis]
Length=367

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   +++SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENSASDAIFHYDEAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   ASDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_009786152.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
sylvestris]
Length=367

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   + +SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENLASDAIFHYDEAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   ASDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|NP_001234331.1| JAB [Solanum lycopersicum]
 gb|AAG43411.1| JAB [Solanum lycopersicum]
Length=367

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 86/97 (89%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_008378244.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=367

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             A IAQ+TWE+ENNV  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHY
Sbjct  2    DAQIAQQTWELENNVIPMDTPPSVAKPKADPTADA-IFYYDEAAQVKFQQEKPWANDPHY  60

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   FKRVKISALALLKMVVHARSGGTIEVMGLMQ  91



>emb|CBL87025.1| CSN5 protein [Solanum lycopersicum]
Length=367

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 86/97 (89%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_004241422.1| PREDICTED: COP9 signalosome complex subunit 5b [Solanum lycopersicum]
Length=367

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSKPENSASDAIFHYDDAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   ASDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_006347307.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSTPENSASDAIFHYDDAAQTKFQREKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   ASDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>gb|KFK41544.1| hypothetical protein AALP_AA2G143000 [Arabis alpina]
Length=357

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+ENN+ T+D P +++DS         IFYYD+TAQ+KFQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDQPNSASDS---------IFYYDDTAQSKFQQEKPWANDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_008393958.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=376

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A +AQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    AQLAQQTWELENNIXPMDTPPSVAKPKADPKADA-IFYYDEAAQAKFQQEKPWANDPHYF  61

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQ  91



>ref|XP_010259860.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nelumbo 
nucifera]
Length=363

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 80/99 (81%), Gaps = 11/99 (11%)
 Frame = +2

Query  65   MDSFT--SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  238
            MDSF+  SSAA+AQ+TWE+ENN+  M+ P          A SDAI++YDE AQ KFQQEK
Sbjct  1    MDSFSVSSSAAMAQQTWELENNIVNMEGP---------LADSDAIYFYDEAAQAKFQQEK  51

Query  239  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  52   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_007137114.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
 gb|ESW09108.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
Length=374

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLP--PTsadsaaasassdaIFYYDETAQTKFQQEK  238
            M+  TSS+AIAQKTWE+ENN+  MD P   +S+ +A A+ + D+IFYYDE  Q +FQ++K
Sbjct  6    MEGLTSSSAIAQKTWELENNIIPMDTPGAASSSSTATATNADDSIFYYDEAGQNEFQRDK  65

Query  239  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  66   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  104



>ref|XP_010669282.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 6/101 (6%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMD------LPPTsadsaaasassdaIFYYDETAQTKFQQ  232
            + +SSAA+A++TWE+ENN+ET+D         T+  +  +S +SDAIF+YDE+AQTKFQQ
Sbjct  5    ALSSSAAMAKQTWELENNIETIDPTTTTTTTTTTTTTTTSSDASDAIFFYDESAQTKFQQ  64

Query  233  EKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            EKPW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  65   EKPWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  105



>ref|XP_009338826.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Pyrus x 
bretschneideri]
Length=367

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A IAQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW +DPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKPKADPTADA-IFYYDEAAQAKFQQEKPWASDPHYF  61

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQ  91



>ref|XP_003522659.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=374

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLP--PTsadsaaasassdaIFYYDETAQTKFQQEK  238
            M+  +SS+AIAQKTWE+ENN+  MD P     + +   +++ D+IFYYDE  Q +FQ++K
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAAISSTTTTTSADDSIFYYDEAGQNEFQRDK  65

Query  239  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  66   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  104



>ref|XP_002887356.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63615.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+ENN+ T+D P +++D+         IFYYD+T+Q++FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDSPDSTSDN---------IFYYDDTSQSRFQQEKPWENDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_003526451.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=375

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLP---PTsadsaaasassdaIFYYDETAQTKFQQE  235
            M+  +SS+AIAQKTWE+ENN+  MD P    TS+ +   + + D+IFYYDE  Q +FQ++
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAATSSTATTTTNADDSIFYYDEAGQNEFQRD  65

Query  236  KPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KPW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  66   KPWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  105



>gb|KJB55196.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=324

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>gb|KJB55192.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=350

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>gb|KHG19604.1| COP9 signalosome complex subunit 5b -like protein [Gossypium 
arboreum]
 gb|KJB55191.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=352

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>gb|KJB55193.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=318

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>gb|KJB55194.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=333

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 9/91 (10%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHY
Sbjct  2    DSAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHY  52

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  53   FKRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>gb|KJB55195.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=346

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>ref|NP_177279.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
 sp|Q9FVU9.1|CSN5A_ARATH RecName: Full=COP9 signalosome complex subunit 5a; Short=Signalosome 
subunit 5a; AltName: Full=Jun activation domain-binding 
homolog 2 [Arabidopsis thaliana]
 gb|AAG51882.1|AC016162_3 c-Jun coactivator-like protein (AJH2); 90304-88609 [Arabidopsis 
thaliana]
 gb|AAL06468.1|AF411778_1 At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AAL58104.1|AF395061_1 CSN complex subunit 5A [Arabidopsis thaliana]
 gb|AAM70525.1| At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AEE35176.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
Length=358

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>gb|AAC36343.1| AJH2 [Arabidopsis thaliana]
Length=358

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_010471135.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X1 [Camelina 
sativa]
 ref|XP_010471136.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X2 [Camelina 
sativa]
Length=358

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS  +A+KTWE+ENN+ T+D P +++D+         +FYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSTSDT---------VFYYDDTAQSRFQQEKPWANDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_006302454.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
 gb|EOA35352.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
Length=358

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS  IA+KTWE+ENN+ T+D P +++D+         IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTTIARKTWELENNILTVDPPDSTSDN---------IFYYDDTAQSRFQQEKPWENDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGG IE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGKIEIMGLMQ  86



>ref|XP_007011590.1| COP9-signalosome 5B [Theobroma cacao]
 gb|EOY29209.1| COP9-signalosome 5B [Theobroma cacao]
Length=351

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 73/91 (80%), Gaps = 9/91 (10%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             +AIAQK WE+ENN+ T+D P           SSD+IFYYD  AQTKFQQEKPW NDPHY
Sbjct  2    DSAIAQKRWELENNILTVDTP---------DPSSDSIFYYDGPAQTKFQQEKPWANDPHY  52

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  53   FKRVKISALALLKMVVHARSGGTIEVMGLMQ  83



>ref|XP_010427950.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=357

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 10/92 (11%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS  +A+KTWE+ENN+ T+D P ++            IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSNDT----------IFYYDDTAQSRFQQEKPWANDPH  53

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGG IE+MGLMQ
Sbjct  54   YFKRVKISALALLKMVVHARSGGNIEIMGLMQ  85



>ref|XP_011031359.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=365

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MD + SS+ IAQKTWE+ENN+  +D    +     + +S DAIFYYDE AQ KFQ+EKPW
Sbjct  1    MDPYPSSS-IAQKTWELENNIIPIDTATPTTKDTPSCSSLDAIFYYDEAAQAKFQKEKPW  59

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            +NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   SNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  96



>ref|XP_010551182.1| PREDICTED: COP9 signalosome complex subunit 5b [Tarenaya hassleriana]
Length=357

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 71/91 (78%), Gaps = 8/91 (9%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S+ IA+KTWE+ENN+ TM+  P  A           IFYYD+ AQ KFQQEKPW NDPHY
Sbjct  4    SSEIARKTWELENNILTMEPTPDPASDG--------IFYYDDVAQAKFQQEKPWANDPHY  55

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  56   FKRVKISALALLKMVVHARSGGTIEVMGLMQ  86



>ref|XP_010415831.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=358

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS  +A+KTWE+ENN+ T+D            ++SD IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNITTVD---------QLDSTSDTIFYYDDTAQSRFQQEKPWANDPH  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQ  86



>gb|EYU29154.1| hypothetical protein MIMGU_mgv1a0088022mg, partial [Erythranthe 
guttata]
 gb|EYU29173.1| hypothetical protein MIMGU_mgv1a0183041mg, partial [Erythranthe 
guttata]
Length=136

 Score =   126 bits (316),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 5/97 (5%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MD F+SS  IA++TWE+ENN+ T      +  + ++SA+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDLFSSST-IARQTWELENNIVT----TAADAADSSSAASDAIFYYDEAAQVKFQQEKPW  55

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            + DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  56   SIDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQ  92



>ref|XP_011076561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Sesamum 
indicum]
Length=361

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 6/97 (6%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MD F SSAAIA++TWE+ENN+ +         S +++A+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDPF-SSAAIARQTWELENNIVS-----AGDASDSSAAASDAIFYYDEAAQAKFQQEKPW  54

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  55   ANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  91



>dbj|BAJ34223.1| unnamed protein product [Thellungiella halophila]
Length=262

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 13/91 (14%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPHY
Sbjct  4    SSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPHY  50

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  51   FKRVKISALALLKMVVHARSGGTIEIMGLMQ  81



>ref|XP_004501247.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cicer arietinum]
Length=356

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 11/93 (12%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +SS+AIAQ+TWE+ENN+  MD P           + D+IF+YDE  Q +FQ++KPW NDP
Sbjct  4    SSSSAIAQQTWELENNIIPMDTP-----------ADDSIFHYDEAGQNEFQRDKPWANDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  53   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  85



>ref|XP_002324396.1| COP9 complex family protein [Populus trichocarpa]
 gb|EEF02961.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +2

Query  65   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  241
            MD + +SS++IAQKTWE+ENN++T+D   T   +   S  SDAIF+YD+ AQ KF QEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKTIDTS-TPTIATGTSFLSDAIFHYDDAAQAKFLQEKP  59

Query  242  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            W+NDP+YF+RV+ISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   WSNDPNYFRRVRISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_006390791.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
 gb|ESQ28077.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
Length=352

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 13/91 (14%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPHY
Sbjct  4    SSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPHY  50

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  51   FKRVKISALALLKMVVHARSGGTIEIMGLMQ  81



>ref|XP_011082083.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Sesamum indicum]
Length=318

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  55   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  87



>ref|XP_011082082.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Sesamum indicum]
Length=357

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  55   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  87



>ref|XP_001775449.1| predicted protein [Physcomitrella patens]
 gb|EDQ59778.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 7/97 (7%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            M++ TSSA IA++TWEIENN+   D P       AA++ SDAIF YDE AQ+  QQ+KPW
Sbjct  1    MEASTSSAMIARQTWEIENNIVATDSP-------AATSDSDAIFEYDEAAQSSIQQQKPW  53

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            T DPHYFK VKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  54   TRDPHYFKNVKISALALLKMVVHARSGGTIEVMGLMQ  90



>ref|XP_011045010.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=366

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +2

Query  65   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  241
            MD + +SS++IAQKTWE+ENN++ +D P T   +   S  SDAIF+YD+  Q KFQQEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKAIDTP-TPTTATDTSFLSDAIFHYDDATQAKFQQEKP  59

Query  242  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            W+NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   WSNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|XP_010048447.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Eucalyptus 
grandis]
 gb|KCW80696.1| hypothetical protein EUGRSUZ_C02093 [Eucalyptus grandis]
Length=375

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNV--------ETMDLPPTsadsaaasassdaIFYYDETAQT  220
            MD+  S AAIAQKTWE+ENN+         +           +    SD+IF+YDE  Q 
Sbjct  1    MDALASQAAIAQKTWELENNILSTTAAGSGSGSGAGAGPADPSKHDQSDSIFFYDEAGQV  60

Query  221  KFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            +FQQEKPW+++PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  61   RFQQEKPWSHEPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  105



>gb|KFK44380.1| hypothetical protein AALP_AA1G249900 [Arabis alpina]
Length=353

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 9/91 (10%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S++IA+KTWE+ENN+ T++ P +S+D          IFYYD++AQ K QQEKPWT DP+Y
Sbjct  4    SSSIARKTWELENNILTVEPPDSSSDG---------IFYYDDSAQAKVQQEKPWTTDPNY  54

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   FKRVQISALALLKMVVHARSGGTIEIMGLMQ  85



>ref|XP_006416142.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
 dbj|BAJ34114.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34495.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
Length=355

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 9/91 (10%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S+ IA+KTWE+ENN+ T+D P +S+D          IFYYD+TAQ K QQ+KPW +DP+Y
Sbjct  4    SSTIARKTWELENNILTVDPPDSSSDG---------IFYYDDTAQAKVQQDKPWASDPNY  54

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   FKRVQISALALLKMVVHARSGGTIEIMGLMQ  85



>ref|XP_003603531.1| COP9 signalosome complex subunit 5b [Medicago truncatula]
 gb|AES73782.1| COP9 signalosome complex subunit 5 [Medicago truncatula]
Length=357

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 11/89 (12%)
 Frame = +2

Query  89   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  268
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  269  RVKISALALLKMVVHARSGGTIEVMGLMQ  355
            RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  59   RVKISALALLKMVVHARSGGTIEVMGLMQ  87



>gb|AAC26484.1| putative JUN kinase activation domain binding protein [Medicago 
sativa]
Length=357

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 11/89 (12%)
 Frame = +2

Query  89   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  268
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  269  RVKISALALLKMVVHARSGGTIEVMGLMQ  355
            RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  59   RVKISALALLKMVVHARSGGTIEVMGLMQ  87



>ref|XP_009115580.1| PREDICTED: COP9 signalosome complex subunit 5b [Brassica rapa]
 emb|CDY21400.1| BnaA09g30270D [Brassica napus]
 emb|CDY04768.1| BnaC05g18210D [Brassica napus]
Length=356

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 8/91 (9%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
            S+ IA+KTWE+ENN+ T++ P +S+           IFYYDE +QTK QQEKPW  DP+Y
Sbjct  4    SSTIARKTWELENNILTVEQPDSSSSDG--------IFYYDEASQTKVQQEKPWATDPNY  55

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  56   FKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_006305189.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
 gb|EOA38087.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
Length=357

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIAKKTWELENNILTVEPPDSASDG---------IFHYDDAAQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_010914180.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Elaeis guineensis]
Length=360

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 11/97 (11%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MDS   SAAIA++TWE+ENN+  M+         A +A +DAI+YYDE  Q KFQQEKPW
Sbjct  1    MDSM--SAAIARQTWELENNIVAME---------AGAADADAIYYYDEAVQAKFQQEKPW  49

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQ  86



>gb|ACJ84456.1| unknown [Medicago truncatula]
Length=357

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 11/89 (12%)
 Frame = +2

Query  89   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  268
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  269  RVKISALALLKMVVHARSGGTIEVMGLMQ  355
            RVKISAL LLKMVVHARSGGTIEVMGLMQ
Sbjct  59   RVKISALTLLKMVVHARSGGTIEVMGLMQ  87



>ref|XP_010498782.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Camelina 
sativa]
Length=360

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  6    SSSAIARKTWELENNIFTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  56

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  57   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  88



>ref|XP_002893252.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69511.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+ T++  PT + S +       IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNILTVE--PTDSASDS-------IFHYDDAAQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_010929274.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Elaeis guineensis]
Length=360

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 11/97 (11%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQ  86



>ref|XP_006845674.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
 gb|ERN07349.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
Length=364

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 8/95 (8%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S ++SA +AQ+TWE+ENN+  M+ P         +  SD+I++YD+ A TK QQEKPW +
Sbjct  5    SSSNSARMAQQTWELENNIVNMESP--------GANDSDSIYFYDDAALTKIQQEKPWQS  56

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYFK+VKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  57   DPHYFKKVKISALALLKMVVHARSGGTIEVMGLMQ  91



>gb|EPS57884.1| hypothetical protein M569_16932, partial [Genlisea aurea]
Length=239

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNV--ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  238
            MD F+SSA IA++TWE+EN++  E       ++  ++A+A+SD+IF+YDE AQ K QQ+K
Sbjct  1    MDPFSSSA-IARQTWELENSIIAEGGVDETGASGQSSAAAASDSIFFYDEVAQAKVQQDK  59

Query  239  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            PW NDPHYFKRVKISALALLKMVVH+RSGGTIEVMGLMQ
Sbjct  60   PWVNDPHYFKRVKISALALLKMVVHSRSGGTIEVMGLMQ  98



>ref|XP_010929275.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Elaeis guineensis]
Length=339

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 11/97 (11%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQ  86



>ref|XP_008810007.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=360

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 11/97 (11%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MDS   SAA+A++TWE+ENNV  M+         A +A +DAI+YYDE AQ KFQQE+PW
Sbjct  1    MDSM--SAAMARQTWELENNVVAME---------AGTAEADAIYYYDEAAQGKFQQERPW  49

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
             +DP++F+RV+ISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  50   AHDPNFFRRVRISALALLKMVVHARSGGTIEVMGLMQ  86



>ref|XP_010460061.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Camelina sativa]
 ref|XP_010460063.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Camelina sativa]
Length=358

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_009420301.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            MDS  SSA +A++TWE+ENN+ ++D    S  + +  + +DAI+YYDE    KFQQEKPW
Sbjct  1    MDSSLSSA-LARQTWELENNIVSVDG--GSGGNGSGGSDADAIYYYDEAVLAKFQQEKPW  57

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            T DP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  58   TQDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  94



>gb|ABK24758.1| unknown [Picea sitchensis]
Length=363

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 9/88 (10%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQ+TWE+ENN+  MD P         SA SD+I+YYDE  Q K QQ+KPW  DPHYFK+
Sbjct  12   IAQQTWELENNIVNMDGP---------SAESDSIYYYDEVTQKKIQQDKPWARDPHYFKK  62

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
            VKISALALLKMVVH+RSGGTIEVMGLMQ
Sbjct  63   VKISALALLKMVVHSRSGGTIEVMGLMQ  90



>ref|XP_010477567.1| PREDICTED: COP9 signalosome complex subunit 5b [Camelina sativa]
Length=358

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW  DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWAADPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>gb|AAM65053.1| putative JUN kinase activator protein [Arabidopsis thaliana]
Length=357

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LRVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQ  86



>gb|AAC36344.1| AJH1 [Arabidopsis thaliana]
Length=357

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_001752249.1| predicted protein [Physcomitrella patens]
 gb|EDQ82982.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            M++ TSSA +A++TWEIENN+  M+ P       AA++ SDAIF YDE +Q+  QQ KPW
Sbjct  1    MEASTSSAMVARQTWEIENNIVAMESP-------AAASDSDAIFEYDEASQSSIQQLKPW  53

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
              DPH+FK VKISALALLKMVVH+RSGGTIEVMGLMQ
Sbjct  54   NRDPHFFKNVKISALALLKMVVHSRSGGTIEVMGLMQ  90



>ref|NP_173705.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 sp|Q8LAZ7.2|CSN5B_ARATH RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome 
subunit 5b; AltName: Full=Jun activation domain-binding 
homolog 1 [Arabidopsis thaliana]
 gb|AAL58105.1|AF395062_1 CSN complex subunit 5B [Arabidopsis thaliana]
 gb|AAB72159.1| unknown [Arabidopsis thaliana]
 gb|AAB96974.1| JAB1 [Arabidopsis thaliana]
 gb|ABL66743.1| At1g22920 [Arabidopsis thaliana]
 gb|AEE30309.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=357

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_006382165.1| COP9 complex family protein [Populus trichocarpa]
 gb|ERP59962.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 85/98 (87%), Gaps = 2/98 (2%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNV-ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  241
            MD + SS+ IA+KTWE+ENN+       PT+ D++++S+SSDAIFY+DE AQ KFQ+EKP
Sbjct  1    MDPYPSSS-IAKKTWELENNIIPIDTATPTTTDTSSSSSSSDAIFYFDEAAQAKFQKEKP  59

Query  242  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            W+NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQ
Sbjct  60   WSNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQ  97



>ref|NP_973890.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 gb|AEE30310.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=351

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_006652935.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Oryza brachyantha]
Length=362

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 75/93 (81%), Gaps = 7/93 (8%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSAA+A++TWE+ENN+ +         +AA + + DAI+ YDE AQ + QQEKPWTNDP
Sbjct  4    TSSAAMARQTWELENNIPSA-------AAAADTDALDAIYRYDEAAQARVQQEKPWTNDP  56

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R +ISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  57   HHFRRARISALALLKMVVHARAGGTIEVMGLMQ  89



>ref|XP_004960128.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Setaria 
italica]
Length=361

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ AQ + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAATDPDAMDA---------IYRYDDAAQARAQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  55   HHFRRAKISALALLKMVVHARAGGTIEVMGLMQ  87



>tpg|DAA35639.1| TPA: hypothetical protein ZEAMMB73_882531 [Zea mays]
Length=239

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  55   HHFRRTKISALALLKMVVHARAGGTIEVMGLMQ  87



>ref|NP_001054112.1| Os04g0654700 [Oryza sativa Japonica Group]
 gb|AAC33765.1| jab1 protein [Oryza sativa Indica Group]
 dbj|BAB72093.1| JUN-activation-domain-binding protein homolog [Oryza sativa]
 dbj|BAC22747.1| JUN-activation-domain-binding protein 1 [Oryza sativa Japonica 
Group]
 emb|CAE01552.2| OSJNBb0022F16.7 [Oryza sativa Japonica Group]
 dbj|BAF16026.1| Os04g0654700 [Oryza sativa Japonica Group]
 emb|CAH66701.1| OSIGBa0147J19.5 [Oryza sativa Indica Group]
Length=360

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H F+R KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  55   HPFRRAKISALALLKMVVHARAGGTIEVMGLMQ  87



>gb|EEC78160.1| hypothetical protein OsI_17724 [Oryza sativa Indica Group]
Length=385

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H F+R KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  55   HPFRRAKISALALLKMVVHARAGGTIEVMGLMQ  87



>gb|KHG22386.1| COP9 signalosome complex subunit 5a -like protein [Gossypium 
arboreum]
Length=335

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 9/89 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWANDPHFF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            KRVKISALALLKMV+HARSGGTIEVMGLM
Sbjct  54   KRVKISALALLKMVIHARSGGTIEVMGLM  82



>ref|NP_001149650.1| COP9 signalosome complex subunit 5b [Zea mays]
 gb|ACF85802.1| unknown [Zea mays]
 gb|ACG36237.1| COP9 signalosome complex subunit 5b [Zea mays]
 tpg|DAA35638.1| TPA: COP9 signalosome complex subunit 5b [Zea mays]
Length=362

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  55   HHFRRTKISALALLKMVVHARAGGTIEVMGLMQ  87



>gb|KJB65954.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65955.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=277

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMV+HAR+GG IEVMGLMQ
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQ  83



>gb|KJB65952.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65953.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=314

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMV+HAR+GG IEVMGLMQ
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQ  83



>gb|KJB65950.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=303

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMV+HAR+GG IEVMGLMQ
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQ  83



>gb|KJB65951.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=335

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 9/90 (10%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKISALALLKMV+HAR+GG IEVMGLMQ
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQ  83



>ref|XP_002961002.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
 gb|EFJ38541.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
Length=361

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 11/92 (12%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            +S++IA+++WE+ENN+  M+            A+ D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME-----------HAACDSIYAYDEAAQSAIQQQKPWTRDPH  51

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFK VKISALALLKMVVHARSGGT+EVMG+MQ
Sbjct  52   YFKNVKISALALLKMVVHARSGGTLEVMGIMQ  83



>ref|XP_002967006.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
 gb|EFJ31605.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
Length=373

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 9/92 (10%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            +S++IA+++WE+ENN+  M+          A++  D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME---------HAASGCDSIYAYDEAAQSAIQQQKPWTRDPH  53

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFK VKISALALLKMVVHARSGGT+EVMG+MQ
Sbjct  54   YFKNVKISALALLKMVVHARSGGTLEVMGIMQ  85



>ref|XP_009103210.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brassica 
rapa]
Length=356

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 8/92 (9%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+ENN+ T+  P        A +SSD IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVKPP--------ADSSSDNIFHYDGAAHAKVLKEKPWATDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>emb|CDY25761.1| BnaA07g10210D [Brassica napus]
Length=356

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 8/92 (9%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+ENN+ T+  P        A +SSD IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVKPP--------ADSSSDNIFHYDGAAHAKVLKEKPWATDPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQ  86



>ref|XP_010240543.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brachypodium 
distachyon]
Length=360

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSS+A+A++TWE+ENN+    + P          + D ++ +DE A  +  Q+KPW NDP
Sbjct  4    TSSSAMAKQTWELENNIPAKVIDP---------EAMDEVYRFDEVANARALQQKPWANDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+++RV+ISALALLKMVVHARSGGTIE+MGLMQ
Sbjct  55   HHYRRVRISALALLKMVVHARSGGTIEIMGLMQ  87



>dbj|BAJ93853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99562.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R +ISALALLKMVVHAR+GGTIE+MGLMQ
Sbjct  55   HHFRRARISALALLKMVVHARAGGTIEIMGLMQ  87



>gb|EMT09486.1| hypothetical protein F775_29820 [Aegilops tauschii]
Length=364

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 9/93 (10%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            H+F+R +ISALALLKMVVHAR+GGTIE+MGLMQ
Sbjct  55   HHFRRARISALALLKMVVHARAGGTIEIMGLMQ  87



>emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa Japonica Group]
Length=377

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 9/88 (10%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            +A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDPH F+R
Sbjct  1    MARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDPHPFRR  51

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
             KISALALLKMVVHAR+GGTIEVMGLMQ
Sbjct  52   AKISALALLKMVVHARAGGTIEVMGLMQ  79



>gb|EIE80444.1| hypothetical protein RO3G_05149 [Rhizopus delemar RA 99-880]
Length=319

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             A+IA K WE+ENN+ T+D               D I++YD     +   EKPW NDPH+
Sbjct  2    DASIALKNWELENNITTVD------------PEEDKIYFYDSEQDKQNVAEKPWKNDPHH  49

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FKRVKISA AL+KMV+HARSGG IEVMGLMQ
Sbjct  50   FKRVKISATALIKMVMHARSGGNIEVMGLMQ  80



>gb|AAR10246.1| similar to Drosophila melanogaster CSN5, partial [Drosophila 
yakuba]
Length=185

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>emb|CDY12502.1| BnaC07g13420D [Brassica napus]
Length=353

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 8/92 (9%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+ IA+KTWE+ENN+ T+ LP  S+           IF+YD  A  K  +EK W  +P+
Sbjct  3    SSSTIARKTWELENNILTVKLPADSSSDN--------IFHYDGAAHAKVLKEKTWATNPN  54

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFKRV+ISALALLKMVVHARSGGTIE+  L +
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIWVLCR  86



>gb|EPB91337.1| COP9 signalosome complex subunit 5a [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=334

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A+ +QK WE+ENN+ T+D  PT             +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNIITVD--PTQDQ----------VYFYDAAQDKENVAQKPWKNDPHYF  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IE+MGLMQ
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEIMGLMQ  80



>ref|XP_001990340.1| GH19288 [Drosophila grimshawi]
 gb|EDV93402.1| GH19288 [Drosophila grimshawi]
Length=327

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKTWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>dbj|GAN00834.1| COP9-signalosome 5B [Mucor ambiguus]
Length=396

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A+ +QK WE+ENN+ T+D             + D +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNITTVD------------PAQDQVYFYDAAQDKENVAQKPWKNDPHYF  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IE+MGLMQ
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEIMGLMQ  80



>ref|XP_008217721.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Nasonia 
vitripennis]
Length=366

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  23   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  69

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  70   FFKDIKISALALLKMVMHARSGGTLEVMGLL  100



>ref|XP_008217730.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
 ref|XP_008217737.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
Length=358

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  15   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  61

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  62   FFKDIKISALALLKMVMHARSGGTLEVMGLL  92



>ref|XP_003424702.2| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
 ref|XP_008217716.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
Length=390

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  47   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  93

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  94   FFKDIKISALALLKMVMHARSGGTLEVMGLL  124



>gb|AAD27862.2|AF132563_1 LD14392p, partial [Drosophila melanogaster]
Length=345

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 13/96 (14%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            + + T  +  AQKTWE+ENN++T  LP               IF YD   Q +    KPW
Sbjct  14   ISTITMDSDAAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPW  60

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
              DPH+FK +KISALALLKMV+HARSGGT+EVMGLM
Sbjct  61   EKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLM  96



>dbj|BAH71669.1| ACYPI006786 [Acyrthosiphon pisum]
Length=142

 Score = 95.1 bits (235),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPHYFK +KISALALLKMV+HARSGG +E+MGL+
Sbjct  52   DPHYFKDIKISALALLKMVMHARSGGILEIMGLL  85



>emb|CEP10016.1| hypothetical protein [Parasitella parasitica]
Length=432

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A+I+QK WE+EN++ T+D             + D +++YD     +   +KPW NDPHYF
Sbjct  130  ASISQKNWELENDIITVD------------PAQDQVYFYDAAHDKENVAQKPWKNDPHYF  177

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  178  KNVKISAIALIKMVMHARSGGNIEVMGLMQ  207



>ref|XP_001954897.1| GF18500 [Drosophila ananassae]
 gb|EDV43458.1| GF18500 [Drosophila ananassae]
Length=320

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             A  AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+
Sbjct  2    DADTAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHF  48

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLM  352
            FK +KISALALLKMV+HARSGGT+EVMGLM
Sbjct  49   FKDIKISALALLKMVMHARSGGTLEVMGLM  78



>ref|XP_006675144.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83607.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
Length=333

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 13/92 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS+  A+K +E+ENN++ +D             S DAIFYYD   Q + Q  +PW  DPH
Sbjct  4    SSSLSARKRFELENNIKEVD-------------SRDAIFYYDSNQQKQIQNSRPWAKDPH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            +FK++KISA+AL+KMV+H+RSGG IEVMG+MQ
Sbjct  51   HFKKIKISAVALIKMVIHSRSGGNIEVMGMMQ  82



>ref|NP_001262639.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
 gb|AGB96019.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
Length=325

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>ref|NP_477442.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 ref|XP_002041210.1| GM15160 [Drosophila sechellia]
 sp|Q9XZ58.1|CSN5_DROME RecName: Full=COP9 signalosome complex subunit 5; Short=Dch5; 
Short=Signalosome subunit 5; AltName: Full=JAB1 homolog [Drosophila 
melanogaster]
 gb|AAF55321.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 gb|EDW44858.1| GM15160 [Drosophila sechellia]
Length=327

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>ref|XP_002103175.1| GD19103 [Drosophila simulans]
 gb|EDX12678.1| GD19103 [Drosophila simulans]
Length=321

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>ref|XP_002074130.1| GK14483 [Drosophila willistoni]
 gb|EDW85116.1| GK14483 [Drosophila willistoni]
Length=327

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>ref|XP_001980192.1| GG17007 [Drosophila erecta]
 ref|XP_002097599.1| CSN5 [Drosophila yakuba]
 gb|EDV49150.1| GG17007 [Drosophila erecta]
 gb|EDW97311.1| CSN5 [Drosophila yakuba]
Length=327

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>gb|AAD28608.1|AF129083_1 COP9 signalosome subunit 5 CSN5 [Drosophila melanogaster]
Length=327

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>emb|CEJ02827.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=169

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 59/91 (65%), Gaps = 12/91 (13%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             AA A+K WE+ENNV T+D               D I++YD     +   +K W NDPHY
Sbjct  2    DAATARKNWELENNVTTVD------------PEQDRIYFYDAELDKQNVAQKLWKNDPHY  49

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            FK VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  50   FKYVKISAVALIKMVMHARSGGNIEVMGLMQ  80



>ref|XP_006565324.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Apis 
mellifera]
Length=358

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 13/103 (13%)
 Frame = +2

Query  44   SPRALHLMDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTK  223
            S + L++  + +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q  
Sbjct  9    SKKLLNMASTSSDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQD  55

Query  224  FQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
                KPW  DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  56   ILAAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  98



>gb|EFN79117.1| COP9 signalosome complex subunit 5 [Harpegnathos saltator]
Length=378

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 70/118 (59%), Gaps = 17/118 (14%)
 Frame = +2

Query  11   TAQELSYSGVSSPRALHLMDSFTSSAA----IAQKTWEIENNVETMDLPPTsadsaaasa  178
            T + LS    S    + L  S  S+++    IAQKTWE+ NN+ET+             +
Sbjct  14   TNEPLSIEMTSGSDNVDLFKSMASTSSDQNTIAQKTWELANNIETI-------------S  60

Query  179  ssdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            + D I+ YD   Q      KPW  DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  61   TIDEIYRYDRKEQQDILTAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  118



>ref|XP_011147627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Harpegnathos 
saltator]
Length=398

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 70/119 (59%), Gaps = 17/119 (14%)
 Frame = +2

Query  8    GTAQELSYSGVSSPRALHLMDSFTSSAA----IAQKTWEIENNVETMDLPPTsadsaaas  175
             T + LS    S    + L  S  S+++    IAQKTWE+ NN+ET+             
Sbjct  33   NTNEPLSIEMTSGSDNVDLFKSMASTSSDQNTIAQKTWELANNIETI-------------  79

Query  176  assdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            ++ D I+ YD   Q      KPW  DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  80   STIDEIYRYDRKEQQDILTAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  138



>ref|XP_011267966.1| PREDICTED: COP9 signalosome complex subunit 5 [Camponotus floridanus]
 gb|EFN60285.1| COP9 signalosome complex subunit 5 [Camponotus floridanus]
Length=346

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            T  + IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    TEQSGIAQKTWELSNNIETI-------------STMDEIYRYDRKEQHDILTAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_002422812.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
 gb|EEB10074.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
Length=332

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S  +IAQKTWE  NN+ET+             +  D I+ YD+  Q      KPW  DPH
Sbjct  9    SQCSIAQKTWEFANNIETI-------------SPIDEIYRYDKKQQQDILAAKPWDKDPH  55

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  56   FFKDIKISALALLKMVMHARSGGTLEVMGLL  86



>ref|XP_001636625.1| predicted protein [Nematostella vectensis]
 gb|EDO44562.1| predicted protein [Nematostella vectensis]
Length=333

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +A+A K+WE+ NN+E ++               D IF YD   Q +  Q KPW  DPHYF
Sbjct  3    SAMAMKSWELANNIENVN-------------GIDEIFKYDRQQQQEILQAKPWQKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +KISALALLKMV+HARSGG +EVMGLM
Sbjct  50   KNIKISALALLKMVMHARSGGNLEVMGLM  78



>ref|XP_002056387.1| GJ10255 [Drosophila virilis]
 gb|EDW59499.1| GJ10255 [Drosophila virilis]
Length=327

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 56/86 (65%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQK WE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKKWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+E+MGLM
Sbjct  53   KISALALLKMVMHARSGGTLEIMGLM  78



>ref|XP_003700698.1| PREDICTED: COP9 signalosome complex subunit 5-like [Megachile 
rotundata]
Length=345

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  + IAQKTWE+ NNVET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAQKTWEMSNNVETI-------------STVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_001998673.1| GI23503 [Drosophila mojavensis]
 gb|EDW14134.1| GI23503 [Drosophila mojavensis]
Length=327

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 56/86 (65%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQK WE+ENNV+T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKKWELENNVQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGLM
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLM  78



>ref|XP_011332242.1| PREDICTED: COP9 signalosome complex subunit 5 [Cerapachys biroi]
 gb|EZA58237.1| COP9 signalosome complex subunit [Cerapachys biroi]
Length=351

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 19/95 (20%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWT  247
            T  + IAQKTWE+ NN+E   TMD                 I+ YD   Q      KPW 
Sbjct  6    TDQSTIAQKTWELSNNIEAISTMD----------------EIYRYDRKEQQDILTAKPWE  49

Query  248  NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
             DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  50   KDPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_008485715.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
 ref|XP_008485716.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 13/93 (14%)
 Frame = +2

Query  74   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  253
             +  + IAQKTW +ENN+ET+             +++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETL-------------SATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  254  PHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            PH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  67   PHFFKDIKISALALLKMVMHARSGGTLEVMGLL  99



>ref|XP_008479869.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 13/93 (14%)
 Frame = +2

Query  74   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  253
             +  + IAQKTW +ENN+ET+             +++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETL-------------SATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  254  PHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            PH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  67   PHFFKDIKISALALLKMVMHARSGGTLEVMGLL  99



>ref|XP_001359383.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017203.1| GL22178 [Drosophila persimilis]
 gb|EAL28529.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34303.1| GL22178 [Drosophila persimilis]
Length=327

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLK+V+HARSGGT+EVMGLM
Sbjct  53   KISALALLKIVMHARSGGTLEVMGLM  78



>ref|XP_011502813.1| PREDICTED: COP9 signalosome complex subunit 5 [Ceratosolen solmsi 
marchali]
Length=342

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            ++IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    SSIAQKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|NP_001138802.1| JAB-MPN domain protein [Bombyx mori]
 gb|ACM24339.1| JAB-MPN domain protein [Bombyx mori]
Length=348

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  S A+IAQKTW + NN+ET+             ++ D I+ YD+  Q      KPW  
Sbjct  5    SADSQASIAQKTWVMANNIETV-------------SNVDDIYRYDKKQQQDILAAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  52   DPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  85



>gb|KDR11248.1| COP9 signalosome complex subunit 5 [Zootermopsis nevadensis]
Length=343

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ NN+ET+ +              D I+ YD   Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANNIETISI-------------IDEIYRYDRKQQQDILAAKPWEKDPHFFKD  59

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  60   IKISALALLKMVMHARSGGTLEVMGLL  86



>gb|KFM80396.1| COP9 signalosome complex subunit 5, partial [Stegodyphus mimosarum]
Length=108

 Score = 91.7 bits (226),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             + +AQ+TWE+ NN+E +              S D I+ YD+  Q      KPW  DPH+
Sbjct  2    DSVMAQRTWELSNNIENV-------------HSVDDIYCYDKKTQQDILTAKPWERDPHF  48

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLM  352
            FK +KISALALLKMV+HARSGGT+EVMG++
Sbjct  49   FKDIKISALALLKMVMHARSGGTLEVMGML  78



>ref|XP_011147629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Harpegnathos 
saltator]
Length=344

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  58   IKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_011147628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Harpegnathos 
saltator]
Length=351

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  18   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  64

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  65   IKISALALLKMVMHARSGGTLEVMGLL  91



>ref|XP_008548790.1| PREDICTED: COP9 signalosome complex subunit 5-like [Microplitis 
demolitor]
Length=342

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 19/95 (20%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWT  247
            +  + IAQKTWE+ NNVE   TMD                 I+ YD   Q      KPW 
Sbjct  6    SDQSTIAQKTWEMSNNVEMISTMD----------------EIYRYDRQEQQDILAAKPWE  49

Query  248  NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
             DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  50   KDPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>gb|EHL03671.1| putative COP9 signalosome complex subunit 5 [Glarea lozoyensis 
74030]
Length=291

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGDIEVMGLMQ  78



>emb|CEG64164.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=331

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 58/90 (64%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            AA A+K WE+ENNV T+D               D I++YD         +K W NDPHYF
Sbjct  3    AATARKNWELENNVTTVD------------PEQDRIYFYDAELDKLNVAQKLWKNDPHYF  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  51   KHVKISAVALIKMVMHARSGGNIEVMGLMQ  80



>ref|XP_638491.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 sp|Q54PF3.1|CSN5_DICDI RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Dictyostelium discoideum]
 gb|EAL65137.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 gb|ABC46697.1| COP9 signalosome complex subunit 5 [Dictyostelium discoideum]
Length=332

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 14/91 (15%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            + AA A KT+E+ENN++T+D               D +F YD     +F Q KPW+ DPH
Sbjct  4    NGAADALKTFELENNIQTID--------------HDQLFKYDPQQYQQFLQSKPWSKDPH  49

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK VKISA+ALLKMV+HARSGG +EVMG++
Sbjct  50   YFKHVKISAIALLKMVMHARSGGKLEVMGML  80



>ref|XP_008185322.1| PREDICTED: COP9 complex homolog subunit 5 isoform X1 [Acyrthosiphon 
pisum]
Length=339

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPHYFK +KISALALLKMV+HARSGG +E+MGL+
Sbjct  52   DPHYFKDIKISALALLKMVMHARSGGILEIMGLL  85



>ref|NP_001156462.1| COP9 complex homolog subunit 5 [Acyrthosiphon pisum]
 dbj|BAH72641.1| ACYPI006786 [Acyrthosiphon pisum]
Length=339

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPHYFK +KISALALLKMV+HARSGG +E+MGL+
Sbjct  52   DPHYFKDIKISALALLKMVMHARSGGILEIMGLL  85



>ref|XP_002129245.1| PREDICTED: COP9 signalosome complex subunit 5-like [Ciona intestinalis]
Length=386

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 13/93 (14%)
 Frame = +2

Query  74   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  253
             +  +++A KTWE++NN+ET+             ++ D I+ YD   Q      KPW  D
Sbjct  48   MSQGSSMAMKTWEMQNNIETV-------------SAVDEIYKYDYQGQQDMLAAKPWVKD  94

Query  254  PHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            PHYFK VKISALALLKMV+HARSGG +EVMGLM
Sbjct  95   PHYFKNVKISALALLKMVMHARSGGNLEVMGLM  127



>ref|XP_008083662.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
 gb|EPE29553.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
Length=345

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGDIEVMGLMQ  78



>ref|XP_004205813.1| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Hydra 
vulgaris]
Length=182

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            + IAQ+T+E++N++E+++             S D I+ Y    Q +   +KPWT DPHYF
Sbjct  3    SQIAQRTFELQNSIESVN-------------SVDEIYKYSHQQQQEILNKKPWTKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K VKISALALLKMV+HARSGG IE+MGLM
Sbjct  50   KHVKISALALLKMVMHARSGGNIEIMGLM  78



>ref|XP_011182476.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera cucurbitae]
Length=333

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 58/89 (65%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +KISAL+LLKMV+HARSGGT+E+MGL+
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLL  78



>ref|XP_011209192.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera dorsalis]
Length=333

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 58/89 (65%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +KISAL+LLKMV+HARSGGT+E+MGL+
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLL  78



>ref|XP_003399828.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 2 
[Bombus terrestris]
Length=345

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_003399827.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 1 
[Bombus terrestris]
Length=344

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_623836.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX2 [Apis 
mellifera]
 ref|XP_003695180.1| PREDICTED: COP9 signalosome complex subunit 5-like [Apis florea]
 ref|XP_006565325.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X4 [Apis 
mellifera]
 ref|XP_006612066.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X1 
[Apis dorsata]
 ref|XP_006612067.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Apis dorsata]
Length=344

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_003486847.1| PREDICTED: COP9 signalosome complex subunit 5-like [Bombus impatiens]
Length=344

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_001649479.1| AAEL014747-PA [Aedes aegypti]
 ref|XP_001657987.1| AAEL001058-PA [Aedes aegypti]
 gb|EAT33001.1| AAEL014747-PA [Aedes aegypti]
 gb|EAT47818.1| AAEL001058-PA [Aedes aegypti]
Length=336

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            + + +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  2    ADSELARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWDKDPH  48

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGG +EVMGL+
Sbjct  49   FFKDIKISALALLKMVMHARSGGALEVMGLL  79



>emb|CCG82078.1| putative COP9 signalosome subunit 5 [Taphrina deformans PYCC 
5710]
Length=359

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 13/88 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            I Q+T+E+ENNV+ +D             ++D IF YD   Q   + + PWT DPH+F+R
Sbjct  3    IPQQTFELENNVQLLD-------------NNDRIFEYDVAEQKAIRNDAPWTRDPHFFRR  49

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
             +ISA+AL+KMV HARSGG IEVMGLMQ
Sbjct  50   ARISAIALIKMVTHARSGGAIEVMGLMQ  77



>ref|XP_007914606.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
 gb|EOO00631.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
Length=349

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQK+WE+ENNV+ +D  PT             ++ YD  +Q   + +KPW  DP+YF+ V
Sbjct  5    AQKSWELENNVKLVD--PTRDS----------LYGYDPESQKDIRAKKPWRTDPNYFRTV  52

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KMV+HARSGG+IEVMGLMQ
Sbjct  53   RISAVALIKMVMHARSGGSIEVMGLMQ  79



>gb|ESZ94555.1| COP9 signalosome complex subunit 5 [Sclerotinia borealis F-4157]
Length=347

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A KTWE++NNV+ +D            A+ DA++ YD   Q   Q  KPW  DPH+FK V
Sbjct  4    AFKTWELDNNVQLVD------------ANRDALYTYDPEEQKAIQDAKPWKTDPHHFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQ  78



>gb|EMS48301.1| COP9 signalosome complex subunit 5b [Triticum urartu]
Length=335

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  191  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            I++YDE A  +  QEKPW  DPH+F+R +ISALALLKMVVHAR+GGTIE+MGLMQ
Sbjct  4    IYHYDEAANARAHQEKPWATDPHHFRRARISALALLKMVVHARAGGTIEIMGLMQ  58



>ref|XP_011171452.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
 ref|XP_011171453.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
Length=346

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            +  ++IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    SDQSSIAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDP  52

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            H+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLL  84



>ref|XP_006956806.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
 gb|EIM23431.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
Length=348

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 16/90 (18%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +++A KT+++EN+VE +DL                I+ YDE AQ     ++PW  DPHYF
Sbjct  3    SSVAMKTFDLENDVEEVDL----------------IYTYDEDAQRDINNKRPWKQDPHYF  46

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKIS +AL+KMV+HARSG   EVMGLMQ
Sbjct  47   KRVKISTVALIKMVLHARSGVPYEVMGLMQ  76



>ref|XP_011292660.1| PREDICTED: COP9 signalosome complex subunit 5 [Musca domestica]
Length=334

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A  A+++WE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    ADAARRSWELENNIKT--LPACDE-----------IFRYDADQQRQILDAKPWEKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +KISAL+LLKMV+HARSGGT+E+MGL+
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLL  78



>gb|ADP30958.1| COP9 constitutive photomorphogenic-like protein subunit 5 [Penaeus 
monodon]
Length=351

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            + + IAQ+ WE+ NN+E  +             ++D I+ YD   Q    Q KPW  DPH
Sbjct  14   NQSQIAQRMWEMANNMEYYN-------------AADEIYQYDRKQQQDILQAKPWEKDPH  60

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK++KISALALLKMV+HARSGGT+EVMGLM
Sbjct  61   FFKQIKISALALLKMVMHARSGGTLEVMGLM  91



>ref|XP_001595259.1| hypothetical protein SS1G_03348 [Sclerotinia sclerotiorum 1980]
 gb|EDO00874.1| hypothetical protein SS1G_03348 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=347

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A KTWE++NNV+ +D             + DA++ YD   Q   Q  KPW  DPH+FK V
Sbjct  4    AFKTWELDNNVQLVD------------PNRDALYTYDPKEQRAIQDAKPWKTDPHHFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQ  78



>ref|NP_500841.1| Protein CSN-5 [Caenorhabditis elegans]
 sp|P91001.1|CSN5_CAEEL RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5; AltName: Full=JAB1 homolog [Caenorhabditis 
elegans]
 emb|CCD62206.1| CSN-5 [Caenorhabditis elegans]
Length=368

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 16/97 (16%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            +D+   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNKQQVEIRNAKPW  46

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
              DPHYFK++KISA+ALLKM +HA+ GG +E+MGL+Q
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQ  83



>ref|XP_001862398.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
 gb|EDS37003.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
Length=426

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            + A +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  93   ADAEMARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWEKDPH  139

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            +FK +KISALALLKMV+HARSGG +E+MGL+
Sbjct  140  FFKDIKISALALLKMVMHARSGGALEIMGLL  170



>dbj|BAE87894.1| unnamed protein product [Macaca fascicularis]
Length=136

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
             S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D 
Sbjct  3    ASGSGMAQKTWELANNMQE-------------AQSIDEIYKYDKKQQQEILAAKPWTKDH  49

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            HYFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  50   HYFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_009267304.1| COP9 signalosome complex subunit 5 [Wallemia ichthyophaga EXF-994]
 gb|EOR01584.1| COP9 signalosome complex subunit 5 [Wallemia ichthyophaga EXF-994]
Length=350

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 16/90 (18%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            +++A KT+E+EN+VE +D                 I+ YD+ AQ +   ++PW  DPHYF
Sbjct  3    SSVAMKTFELENDVEEID----------------QIYSYDDNAQREINNKRPWRQDPHYF  46

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            KRVKIS++AL+KMV+HARSG   EVMGLMQ
Sbjct  47   KRVKISSVALIKMVLHARSGVPYEVMGLMQ  76



>ref|XP_007825082.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EFY95597.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EXU97339.1| JAB1/Mov34/MPN/PAD-1 ubiquitin protease domain protein [Metarhizium 
robertsii]
Length=335

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KM +HARSGG +EVMGLMQ
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQ  78



>ref|XP_002584116.1| COP9 signalosome complex subunit 5 [Uncinocarpus reesii 1704]
 gb|EEP79963.1| COP9 signalosome complex subunit 5 [Uncinocarpus reesii 1704]
Length=334

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQK+WEIEN+VE +D            A  DA++ YD  A       KPW+ DPHYF  +
Sbjct  4    AQKSWEIENSVELVD------------AHRDALYKYDPAASQAVVSSKPWSKDPHYFTSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_007779451.1| COP9 signalosome complex subunit 5 [Coniosporium apollinis CBS 
100218]
 gb|EON64134.1| COP9 signalosome complex subunit 5 [Coniosporium apollinis CBS 
100218]
Length=339

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+EN V+ +D  PT             ++ YD   Q      KPW  DP+YFK V
Sbjct  4    AQKTWELENVVKLVD--PTRDA----------LYNYDPDEQKAINAAKPWKKDPNYFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQ  78



>ref|XP_011049626.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049630.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049631.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 gb|EGI68489.1| COP9 signalosome complex subunit 5 [Acromyrmex echinatior]
Length=345

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  58   IKISALALLKMVMHARSGGTLEVMGLL  84



>gb|KFG82749.1| COP9 signalosome complex subunit 5 [Metarhizium anisopliae]
 gb|KID64982.1| COP9 signalosome complex subunit 5, partial [Metarhizium anisopliae 
ARSEF 549]
Length=335

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KM +HARSGG +EVMGLMQ
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQ  78



>ref|XP_002633848.1| C. briggsae CBR-CSN-5 protein [Caenorhabditis briggsae]
 emb|CAP37056.1| Protein CBR-CSN-5 [Caenorhabditis briggsae]
Length=367

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 16/97 (16%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    IDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQLEIRNAKPW  46

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
              DPHYFK++KISA+ALLKM +HA+ GG++E+MGL+Q
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGSLEIMGLLQ  83



>ref|XP_003712833.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|EHA53026.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|ELQ43145.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae Y34]
 gb|ELQ68262.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae P131]
Length=344

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 12/88 (14%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            +A K+WE++NNV+ +D  P+             ++ YD  +Q    Q++PW  DP+YFK 
Sbjct  3    VAMKSWELDNNVKLVD--PSRDA----------LYNYDAESQKAINQQRPWAKDPNYFKS  50

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
            V+ISA+AL+KMV+HARSGG++EVMG+MQ
Sbjct  51   VRISAIALIKMVMHARSGGSLEVMGMMQ  78



>ref|XP_011049625.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Acromyrmex 
echinatior]
Length=351

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  17   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  63

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  64   IKISALALLKMVMHARSGGTLEVMGLL  90



>gb|KID75045.1| COP9 signalosome complex subunit 5, partial [Metarhizium brunneum 
ARSEF 3297]
Length=335

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KM +HARSGG +EVMGLMQ
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQ  78



>ref|XP_003101399.1| CRE-CSN-5 protein [Caenorhabditis remanei]
 gb|EFP07253.1| CRE-CSN-5 protein [Caenorhabditis remanei]
Length=371

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (62%), Gaps = 16/97 (16%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQVEIRNAKPW  46

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
              DPHYFK++KISA+ALLKM +HA+ GG +E+MGL+Q
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQ  83



>gb|AEE62710.1| unknown [Dendroctonus ponderosae]
 gb|ENN70355.1| hypothetical protein YQE_12863, partial [Dendroctonus ponderosae]
 gb|ERL94202.1| hypothetical protein D910_11483 [Dendroctonus ponderosae]
Length=351

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQKTWE+ NN+ET+             +S D I+ YD   Q      KPW  DPH+FK +
Sbjct  16   AQKTWELSNNMETI-------------SSVDEIYKYDRKQQQDILTAKPWDKDPHFFKDI  62

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+HARSGGT+EVMGL+
Sbjct  63   KISALALLKMVMHARSGGTLEVMGLI  88



>gb|KID87397.1| COP9 signalosome complex subunit 5 [Metarhizium guizhouense ARSEF 
977]
Length=335

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KM +HARSGG +EVMGLMQ
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQ  78



>dbj|BAN21083.1| jun activation domain binding protein [Riptortus pedestris]
Length=342

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  + A++AQ+TWE+ NN+ET+             +  D I+ YD   Q      KPW  
Sbjct  5    SSETQASMAQQTWEMSNNIETI-------------SPIDEIYRYDRKQQQDILNAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPH+F  +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  52   DPHFFTDIKISALALLKMVMHARSGGTLEVMGLL  85



>ref|XP_011049624.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Acromyrmex 
echinatior]
Length=384

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  50   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  96

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  97   IKISALALLKMVMHARSGGTLEVMGLL  123



>ref|XP_007248979.1| PREDICTED: COP9 signalosome complex subunit 5 [Astyanax mexicanus]
Length=336

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            SS++IAQKTWE+ N+++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  4    SSSSIAQKTWELSNSIQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>emb|CEG78022.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=331

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            AA A+K WE+EN++ T+D               D I++Y+     +   +K W NDPHYF
Sbjct  3    AATARKNWELENDITTVD------------PEQDRIYFYNAEQDKQNVAQKLWKNDPHYF  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  51   KHVKISAVALIKMVMHARSGGNIEVMGLMQ  80



>ref|XP_007811766.1| COP9 signalosome complex subunit 5 [Metarhizium acridum CQMa 
102]
 gb|EFY88532.1| COP9 signalosome complex subunit 5 [Metarhizium acridum CQMa 
102]
Length=335

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+AL+KM +HARSGG +EVMGLMQ
Sbjct  52   RISAVALVKMTMHARSGGNLEVMGLMQ  78



>gb|KIW00274.1| hypothetical protein PV09_08164 [Verruconis gallopava]
Length=334

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 12/85 (14%)
 Frame = +2

Query  101  KTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKI  280
            K+WE+EN+++ +D            ++ DA++ +DE A    Q +KPW  DP+YFK V+I
Sbjct  6    KSWELENSIQLLD------------STRDALYDFDEAAYKALQTQKPWNKDPNYFKHVRI  53

Query  281  SALALLKMVVHARSGGTIEVMGLMQ  355
            SA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  54   SAVALLKMVMHARSGGSIEVMGLMQ  78



>dbj|BAM18530.1| COP9 complex homolog subunit 5 [Papilio xuthus]
Length=348

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 13/94 (14%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S  S +  AQKTW + NN+ET+             +S D I+ YD+  Q      KPW  
Sbjct  5    SADSQSTTAQKTWVMANNIETV-------------SSVDEIYRYDKKQQQDILAAKPWEK  51

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            DPH+FK +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  52   DPHFFKDIKISALALLKMVMHARSGGTLEVMGLL  85



>ref|XP_005099578.1| PREDICTED: COP9 signalosome complex subunit 5-like [Aplysia californica]
Length=334

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 13/89 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            + +A+KTWE+ NNVE++             +S D I+ YD   Q      KPW  DPHYF
Sbjct  3    SKVARKTWELTNNVESV-------------SSVDEIYRYDSKQQQDILTAKPWEKDPHYF  49

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLM  352
            K +K+SALALLKMV+HARSGG +EVMGL+
Sbjct  50   KHIKVSALALLKMVMHARSGGNLEVMGLL  78



>ref|XP_002408598.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
 gb|EEC10694.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
Length=257

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            +AQKTWE+ NNVET+              S D ++ Y++  Q      KPW  DPHYFK 
Sbjct  5    MAQKTWELSNNVETIQ-------------SVDDLYKYNKKQQQDILTAKPWEKDPHYFKD  51

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +K+SALALLKMV+HARSGGT+EVMGL+
Sbjct  52   MKVSALALLKMVMHARSGGTLEVMGLL  78



>gb|EFW19686.1| COP9 signalosome complex subunit 5 [Coccidioides posadasii str. 
Silveira]
Length=334

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WEIEN V  +D               DA++ YD  A       KPW+ DPHYFK +
Sbjct  4    AQRSWEIENCVNLVD------------PYRDALYTYDPAASQALMSAKPWSRDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_003067409.1| COP9 signalosome complex subunit 5, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER25264.1| COP9 signalosome complex subunit 5, putative [Coccidioides posadasii 
C735 delta SOWgp]
Length=334

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WEIEN V  +D               DA++ YD  A       KPW+ DPHYFK +
Sbjct  4    AQRSWEIENCVNLVD------------PYRDALYTYDPAASQALMSAKPWSRDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_001900779.1| COP9 signalosome complex subunit 5 [Brugia malayi]
Length=331

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%), Gaps = 16/95 (17%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+Q
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQ  91



>dbj|GAM27607.1| hypothetical protein SAMD00019534_107830 [Acytostelium subglobosum 
LB1]
Length=341

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 14/86 (16%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A K +EIENN++++D               D+IF YD+T    F + KPW  DPHYFK V
Sbjct  10   ALKRFEIENNIQSVD--------------RDSIFKYDQTQYNDFLKSKPWAKDPHYFKTV  55

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISA+ALLKMV+H+RSGG +EVMGL+
Sbjct  56   KISAIALLKMVMHSRSGGKLEVMGLL  81



>emb|CDS11961.1| Putative COP9 signalosome complex subunit 5a [Absidia idahoensis 
var. thermophila]
Length=333

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A  A+K WE+ENN+ T+D  PT             I+YYD     +  +++PW  +P+++
Sbjct  3    AETARKNWELENNITTVD--PTQDQ----------IYYYDAQKNKEALEQRPWKTNPNHY  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEVMGLMQ  80



>emb|CDP99135.1| Protein BM-CSN-5, isoform b [Brugia malayi]
Length=355

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%), Gaps = 16/95 (17%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+Q
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQ  91



>emb|CDP99134.1| Protein BM-CSN-5, isoform d [Brugia malayi]
Length=357

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%), Gaps = 16/95 (17%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+Q
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQ  91



>ref|XP_972769.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198243.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198244.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 gb|EFA09688.1| hypothetical protein TcasGA2_TC011816 [Tribolium castaneum]
Length=344

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQKTWE+ N VE ++             S D I+ YD+  Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANKVELVN-------------SVDDIYRYDKKQQQDILAAKPWEKDPHFFKD  59

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+EVMGL+
Sbjct  60   IKISALALLKMVMHARSGGTLEVMGLI  86



>gb|EIT80237.1| COP9 signalosome, subunit CSN5 [Aspergillus oryzae 3.042]
 gb|KDE78732.1| COP9 signalosome [Aspergillus oryzae 100-8]
Length=334

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE+EN +  +D               DA++ YDE        E+PW  DPHYFK +
Sbjct  5    AQQSWELENAISLID------------PQRDALYQYDEETHKALSAERPWAKDPHYFKSI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  53   RISAVALLKMVMHARSGGSLEVMGLMQ  79



>dbj|GAD91695.1| COP9 signalosome complex subunit 5 [Byssochlamys spectabilis 
No. 5]
Length=338

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE EN ++ +D               DA++ YDE A       +PW  DPHYFK +
Sbjct  4    AQQSWEFENTIDLID------------PQRDALYKYDEDAHKALVAARPWAKDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>gb|KFZ02747.1| hypothetical protein V502_11539 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=345

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 12/88 (14%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IA++ WE++NNV+ +D            A  D+++ YD T Q    + KPW  +P +FK 
Sbjct  3    IARRAWELDNNVQLVD------------AHRDSLYSYDATEQKSINEAKPWKTNPRHFKN  50

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
            V+ISA+ALLKMV+HARSGG++E+MGLMQ
Sbjct  51   VRISAVALLKMVIHARSGGSVEIMGLMQ  78



>ref|XP_007885051.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callorhinchus 
milii]
Length=336

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            +S  IAQKTWE+ NN++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  4    ASGNIAQKTWELANNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|ADG37923.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37925.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37928.1| AT1G22920-like protein, partial [Neslia paniculata]
Length=53

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  191  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGG  328
            IF+YD+ AQ K QQEKPW +DP+YFKRV+ISALALLKMVVHARSGG
Sbjct  8    IFHYDDAAQAKIQQEKPWASDPNYFKRVQISALALLKMVVHARSGG  53



>gb|KJB06586.1| hypothetical protein B456_001G001700 [Gossypium raimondii]
Length=182

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  200  YDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YDETA  KFQQ KP  ND HYFKRVKI ALALLKMVV+A+SGGTIEVMGLMQ
Sbjct  21   YDETALAKFQQGKPSANDHHYFKRVKIFALALLKMVVYAQSGGTIEVMGLMQ  72



>ref|XP_001551965.1| hypothetical protein BC1G_09577 [Botrytis cinerea B05.10]
 emb|CCD53906.1| similar to COP9 signalosome complex subunit 5 [Botrytis cinerea 
T4]
 gb|EMR88083.1| putative cop9 signalosome complex subunit 5 protein [Botrytis 
cinerea BcDW1]
Length=353

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A KTWE++NNV+ +D             + DA++ YD   Q   Q  KPW  DP++FK V
Sbjct  4    AFKTWELDNNVQLVD------------PNRDALYTYDPEEQKAIQNAKPWKTDPNHFKNV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQ  78



>gb|EJW89035.1| JAB-MPN domain-containing protein [Wuchereria bancrofti]
Length=322

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%), Gaps = 16/95 (17%)
 Frame = +2

Query  71   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  250
            S +++ ++A + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  4    SMSTATSVAFRNWQMSNNIESLE----------------TIYQYDSAEQQAIRAVKPWEK  47

Query  251  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+Q
Sbjct  48   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQ  82



>ref|XP_005663091.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Sus 
scrofa]
Length=358

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  93   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  139

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  140  YFKYCKISALALLKMVMHARSGGNLEVMGLM  170



>gb|ADG37922.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37924.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37926.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37927.1| AT1G22920-like protein, partial [Capsella grandiflora]
Length=53

 Score = 85.1 bits (209),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  191  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGG  328
            IF+YD+ AQ K QQEKPW +DP+YFKRV+ISALALLKMVVHARSGG
Sbjct  8    IFHYDDAAQAKIQQEKPWASDPNYFKRVQISALALLKMVVHARSGG  53



>gb|EPS32803.1| hypothetical protein PDE_07763 [Penicillium oxalicum 114-2]
Length=333

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE  N +   D               DA++ YDE  Q +   E+PW +DP+YFK V
Sbjct  4    AQQSWEFGNAISVFD------------PQKDALYQYDEATQKRLNAERPWASDPYYFKSV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_001249856.5| PREDICTED: COP9 signalosome complex subunit 5-like [Bos taurus]
Length=220

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQE-------------AQSVDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|KFY66915.1| hypothetical protein V496_01853 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY99144.1| hypothetical protein V498_00992 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=345

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 12/88 (14%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            +A+K WE++NNV+ +D            A  DA++ YD T Q    + KPW  +P +FK 
Sbjct  3    VARKAWELDNNVQLVD------------AHRDALYSYDATEQKAINEAKPWRTNPRHFKN  50

Query  272  VKISALALLKMVVHARSGGTIEVMGLMQ  355
            V+ISA+ALLKMV+HARSGG++E+MGLMQ
Sbjct  51   VRISAVALLKMVMHARSGGSVEIMGLMQ  78



>gb|ACN61634.1| COP9 signalosome subunit 5 [Megaderma lyra]
Length=116

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 13/88 (15%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D HYF
Sbjct  1    SGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHHYF  47

Query  266  KRVKISALALLKMVVHARSGGTIEVMGL  349
            K  KISALALLKMV+HARSGG +EVMGL
Sbjct  48   KYCKISALALLKMVMHARSGGNLEVMGL  75



>ref|XP_002626520.1| COP9 signalosome complex subunit 5 [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76173.1| COP9 signalosome complex subunit 5 [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ84515.1| COP9 signalosome complex subunit 5 [Blastomyces dermatitidis 
ER-3]
 gb|EGE81376.1| COP9 signalosome complex subunit 5 [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL37037.1| COP9 signalosome complex subunit 5 [Blastomyces dermatitidis 
ATCC 26199]
Length=348

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A++ WE+EN+++ +D               DA++ YD  A +    ++PW+ DPHYFK +
Sbjct  4    ARQAWELENSLQLID------------PHRDALYNYDPAAHSALTAQRPWSKDPHYFKHI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG+IEVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQ  78



>ref|XP_003408260.1| PREDICTED: COP9 signalosome complex subunit 5 [Loxodonta africana]
 dbj|BAE21497.1| unnamed protein product [Mus musculus]
Length=220

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQE-------------AQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>emb|CAK42618.1| unnamed protein product [Aspergillus niger]
Length=359

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE EN V  +D               DA++ YDE        ++PW+ DPHYFK +
Sbjct  4    AQQSWEFENAVTLID------------PHRDALYKYDEETHKALSAQRPWSKDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>gb|ELR58372.1| COP9 signalosome complex subunit 5, partial [Bos mutus]
Length=337

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  7    SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  53

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  54   YFKYCKISALALLKMVMHARSGGNLEVMGLM  84



>gb|KFB47242.1| hypothetical protein ZHAS_00015265 [Anopheles sinensis]
Length=338

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 13/86 (15%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            A+KTWE+ENN+ T  LP +             IF YD   Q +    +PW  DPH+FK +
Sbjct  4    ARKTWEMENNIVT--LPASDE-----------IFRYDAEQQQRILTARPWEKDPHFFKDI  50

Query  275  KISALALLKMVVHARSGGTIEVMGLM  352
            KISALALLKMV+H+RSGG +EVMGL+
Sbjct  51   KISALALLKMVMHSRSGGALEVMGLL  76



>ref|XP_005770092.1| hypothetical protein EMIHUDRAFT_75732 [Emiliania huxleyi CCMP1516]
 ref|XP_005789785.1| hypothetical protein EMIHUDRAFT_70490 [Emiliania huxleyi CCMP1516]
 gb|EOD17663.1| hypothetical protein EMIHUDRAFT_75732 [Emiliania huxleyi CCMP1516]
 gb|EOD37356.1| hypothetical protein EMIHUDRAFT_70490 [Emiliania huxleyi CCMP1516]
Length=350

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 16/94 (17%)
 Frame = +2

Query  74   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  253
              + A+ AQ  +E+EN++  +D                A++ YD   Q K+   KPWT D
Sbjct  1    MAAGASSAQARFELENDIRAVD----------------AVYTYDNPQQQKWLSAKPWTRD  44

Query  254  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            P YFK V+ISALAL+KMV+HAR GGTIEVMGLMQ
Sbjct  45   PRYFKNVRISALALIKMVMHARGGGTIEVMGLMQ  78



>ref|XP_008148613.1| PREDICTED: COP9 signalosome complex subunit 5 [Eptesicus fuscus]
Length=299

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSCMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|ERG87648.1| cop9 signalosome complex subunit 5 [Ascaris suum]
Length=338

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 16/97 (16%)
 Frame = +2

Query  65   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  244
            M++ +S A  A + W++ NNV   +                 I+ YD   Q   +  +PW
Sbjct  1    MEACSSDAPTALRNWQLANNVRLSE----------------TIYQYDANEQQLIRTVRPW  44

Query  245  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
              DPHYFK VKISALALLKMV+HARSGG++EVMGL+Q
Sbjct  45   EKDPHYFKEVKISALALLKMVMHARSGGSLEVMGLVQ  81



>ref|XP_001397194.2| COP9 signalosome complex subunit 5 [Aspergillus niger CBS 513.88]
Length=338

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE EN V  +D               DA++ YDE        ++PW+ DPHYFK +
Sbjct  4    AQQSWEFENAVTLID------------PHRDALYKYDEETHKALSAQRPWSKDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_007527171.1| PREDICTED: COP9 signalosome complex subunit 5 [Erinaceus europaeus]
Length=334

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S +++AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSSMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_004773046.1| PREDICTED: COP9 signalosome complex subunit 5 [Mustela putorius 
furo]
Length=302

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>emb|CDH56438.1| cop9 signalosome complex subunit 5a-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=333

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 12/90 (13%)
 Frame = +2

Query  86   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  265
            A  A+K WE+ENN+ T+D             + D I+YYD        ++KPW  +P+++
Sbjct  3    AETARKNWELENNIVTVD------------PAQDQIYYYDAQKNKDALEQKPWKTNPNHY  50

Query  266  KRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            K VKISA+AL+KMV+HARSGG IEVMGLMQ
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEVMGLMQ  80



>ref|XP_004588161.1| PREDICTED: COP9 signalosome complex subunit 5 [Ochotona princeps]
Length=299

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------ETQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>dbj|GAA91502.1| COP9 signalosome subunit CsnE [Aspergillus kawachii IFO 4308]
Length=339

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE EN V  +D               DA++ YDE        ++PW+ DPHYFK +
Sbjct  4    AQQSWEFENAVTLID------------PHRDALYQYDEETHKALSAQRPWSKDPHYFKSI  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|XP_006752490.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Leptonychotes 
weddellii]
Length=334

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_002609973.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
 gb|EEN65983.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
Length=168

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 56/90 (62%), Gaps = 13/90 (14%)
 Frame = +2

Query  83   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  262
             A +AQKTWE+ N +ET+              S D I+ YD+  Q +    KPWT D HY
Sbjct  2    DAKMAQKTWELANQMETVS-------------SVDEIYKYDKRQQQEILAAKPWTRDNHY  48

Query  263  FKRVKISALALLKMVVHARSGGTIEVMGLM  352
            FK  K SALALLKMV+HARSGG +EVMGLM
Sbjct  49   FKYCKXSALALLKMVMHARSGGNLEVMGLM  78



>ref|XP_008106749.1| PREDICTED: COP9 signalosome complex subunit 5 [Anolis carolinensis]
Length=343

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 13/92 (14%)
 Frame = +2

Query  77   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  256
            + S+ +AQKTWE+ NN++              + S D I+ YD   Q +    KPWT D 
Sbjct  12   SGSSGMAQKTWELANNMQ-------------EAQSIDEIYKYDRKQQQEILAAKPWTKDH  58

Query  257  HYFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            HYFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  59   HYFKYCKISALALLKMVMHARSGGNLEVMGLM  90



>ref|XP_011297758.1| PREDICTED: COP9 signalosome complex subunit 5 [Fopius arisanus]
Length=343

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = +2

Query  92   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  271
            IAQ+ WE+ N+VET+             +S D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQRMWEMTNDVETI-------------SSVDEIYRYDHQEQQSILAAKPWEKDPHFFKD  57

Query  272  VKISALALLKMVVHARSGGTIEVMGLM  352
            +KISALALLKMV+HARSGGT+E+MGL+
Sbjct  58   IKISALALLKMVMHARSGGTLEIMGLL  84



>ref|XP_001822456.2| COP9 signalosome complex subunit 5 [Aspergillus oryzae RIB40]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ++WE+EN +  +D               DA++ YD+        E+PW  DPHYFK +
Sbjct  5    AQQSWELENAISLID------------PQRDALYQYDQETHKALSAERPWAKDPHYFKSI  52

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  53   RISAVALLKMVMHARSGGSLEVMGLMQ  79



>ref|NP_001179068.1| COP9 signalosome complex subunit 5 [Bos taurus]
 ref|XP_004011770.1| PREDICTED: COP9 signalosome complex subunit 5 [Ovis aries]
 ref|XP_005689095.1| PREDICTED: COP9 signalosome complex subunit 5 [Capra hircus]
 ref|XP_005892993.1| PREDICTED: COP9 signalosome complex subunit 5 [Bos mutus]
 ref|XP_005977667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_010846758.1| PREDICTED: COP9 signalosome complex subunit 5 [Bison bison bison]
 tpg|DAA22731.1| TPA: COP9 signalosome subunit 5-like [Bos taurus]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|EYC46046.1| hypothetical protein Y032_0410g948 [Ancylostoma ceylanicum]
Length=391

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 16/92 (17%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S  ++A + W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  27   SEESVALRNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  70

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFK V+ISA+ALLKMV+HAR GG +EVMGLMQ
Sbjct  71   YFKEVRISAVALLKMVIHARRGGNLEVMGLMQ  102



>gb|EYC46045.1| hypothetical protein Y032_0410g948 [Ancylostoma ceylanicum]
Length=384

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 16/92 (17%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S  ++A + W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  20   SEESVALRNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  63

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLMQ  355
            YFK V+ISA+ALLKMV+HAR GG +EVMGLMQ
Sbjct  64   YFKEVRISAVALLKMVIHARRGGNLEVMGLMQ  95



>ref|XP_006150523.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Tupaia 
chinensis]
Length=320

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|NP_038743.1| COP9 signalosome complex subunit 5 isoform 1 [Mus musculus]
 ref|XP_005361944.1| PREDICTED: COP9 signalosome complex subunit 5 [Microtus ochrogaster]
 ref|XP_006974748.1| PREDICTED: COP9 signalosome complex subunit 5 [Peromyscus maniculatus 
bairdii]
 ref|XP_008852994.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nannospalax 
galili]
 sp|O35864.3|CSN5_MOUSE RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1; AltName: Full=Kip1 C-terminus-interacting 
protein 2 [Mus musculus]
 gb|AAF61318.1|AF068223_1 Kip1 C-terminus interacting protein-2 [Mus musculus]
 gb|AAD03470.1| 38 kDa Mov34 homolog [Mus musculus]
 gb|AAC17179.1| Jun coactivator Jab1 [Mus musculus]
 dbj|BAB28282.1| unnamed protein product [Mus musculus]
 gb|AAH46753.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Mus musculus]
 dbj|BAE30445.1| unnamed protein product [Mus musculus]
 dbj|BAE27030.1| unnamed protein product [Mus musculus]
 gb|EDL14298.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana), isoform CRA_a [Mus musculus]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_003831400.1| PREDICTED: COP9 signalosome complex subunit 5 [Pan paniscus]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>sp|Q5BBF1.2|CSN5_EMENI RecName: Full=COP9 signalosome complex subunit 5 [Aspergillus 
nidulans FGSC A4]
 gb|AAM95164.1| COP9 signalosome subunit 5 [Aspergillus nidulans]
 tpe|CBF86237.1| TPA: COP9 signalosome complex subunit 5 (EC 3.4.-.-) [Source:UniProtKB/Swiss-Prot;Acc:Q5BBF1] 
[Aspergillus nidulans FGSC 
A4]
Length=335

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ +WE+EN V  +D               D+++ YDE         +PWT DPHYFK V
Sbjct  4    AQLSWELENAVTLID------------PQRDSLYRYDEETHKYLSDTRPWTKDPHYFKSV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|NP_001020866.1| COP9 signalosome complex subunit 5 [Rattus norvegicus]
 gb|AAH98736.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Rattus norvegicus]
 gb|EDM11550.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Rattus norvegicus]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_535093.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Canis 
lupus familiaris]
 ref|XP_004653361.1| PREDICTED: COP9 signalosome complex subunit 5 [Jaculus jaculus]
 ref|XP_005638087.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Canis 
lupus familiaris]
 ref|XP_007947907.1| PREDICTED: COP9 signalosome complex subunit 5 [Orycteropus afer 
afer]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_659733.1| hypothetical protein AN2129.2 [Aspergillus nidulans FGSC A4]
 gb|EAA64961.1| hypothetical protein AN2129.2 [Aspergillus nidulans FGSC A4]
Length=354

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 12/87 (14%)
 Frame = +2

Query  95   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  274
            AQ +WE+EN V  +D               D+++ YDE         +PWT DPHYFK V
Sbjct  4    AQLSWELENAVTLID------------PQRDSLYRYDEETHKYLSDTRPWTKDPHYFKSV  51

Query  275  KISALALLKMVVHARSGGTIEVMGLMQ  355
            +ISA+ALLKMV+HARSGG++EVMGLMQ
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQ  78



>ref|NP_006828.2| COP9 signalosome complex subunit 5 [Homo sapiens]
 ref|NP_001247609.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 ref|XP_001162723.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pan 
troglodytes]
 ref|XP_002710500.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_002759014.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callithrix 
jacchus]
 ref|XP_002916425.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003274847.1| PREDICTED: COP9 signalosome complex subunit 5 [Nomascus leucogenys]
 ref|XP_003480111.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cavia 
porcellus]
 ref|XP_002819198.2| PREDICTED: COP9 signalosome complex subunit 5 [Pongo abelii]
 ref|XP_003797297.1| PREDICTED: COP9 signalosome complex subunit 5 [Otolemur garnettii]
 ref|XP_003942946.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_003999915.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Felis 
catus]
 ref|XP_004275000.1| PREDICTED: COP9 signalosome complex subunit 5 [Orcinus orca]
 ref|XP_004310611.1| PREDICTED: COP9 signalosome complex subunit 5 [Tursiops truncatus]
 ref|XP_004372600.1| PREDICTED: COP9 signalosome complex subunit 5 [Trichechus manatus 
latirostris]
 ref|XP_004402339.1| PREDICTED: COP9 signalosome complex subunit 5 [Odobenus rosmarus 
divergens]
 ref|XP_004436312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004436313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004481161.1| PREDICTED: COP9 signalosome complex subunit 5 [Dasypus novemcinctus]
 ref|XP_004814145.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_005322997.1| PREDICTED: COP9 signalosome complex subunit 5 [Ictidomys tridecemlineatus]
 ref|XP_005392180.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005563538.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Macaca 
fascicularis]
 ref|XP_006193800.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus ferus]
 ref|XP_006204770.1| PREDICTED: COP9 signalosome complex subunit 5 [Vicugna pacos]
 ref|XP_006150522.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Tupaia 
chinensis]
 ref|XP_006880503.1| PREDICTED: COP9 signalosome complex subunit 5 [Elephantulus edwardii]
 ref|XP_006924076.1| PREDICTED: COP9 signalosome complex subunit 5 [Pteropus alecto]
 ref|XP_007080736.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007130932.1| PREDICTED: COP9 signalosome complex subunit 5 [Physeter catodon]
 ref|XP_007185082.1| PREDICTED: COP9 signalosome complex subunit 5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448551.1| PREDICTED: COP9 signalosome complex subunit 5 [Lipotes vexillifer]
 ref|XP_007998988.1| PREDICTED: COP9 signalosome complex subunit 5 [Chlorocebus sabaeus]
 ref|XP_008565068.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008704972.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ursus 
maritimus]
 ref|XP_009211402.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_009211403.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_010369895.1| PREDICTED: COP9 signalosome complex subunit 5 [Rhinopithecus 
roxellana]
 ref|XP_010609774.1| PREDICTED: COP9 signalosome complex subunit 5 [Fukomys damarensis]
 ref|XP_010968931.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus bactrianus]
 ref|XP_010987306.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Camelus 
dromedarius]
 ref|XP_011362917.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pteropus 
vampyrus]
 sp|Q92905.4|CSN5_HUMAN RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1 [Homo sapiens]
 pdb|4D10|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D10|M Chain M, Crystal Structure Of The Cop9 Signalosome
 gb|AAH01187.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH01859.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH07272.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 emb|CAG46479.1| COPS5 [Homo sapiens]
 gb|EAW86928.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86929.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86931.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 dbj|BAG73052.1| COP9 constitutive photomorphogenic homolog subunit 5 [synthetic 
construct]
 gb|EFB14348.1| hypothetical protein PANDA_004498 [Ailuropoda melanoleuca]
 gb|ADZ15656.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[synthetic construct]
 gb|EHH28550.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 gb|EHH64214.1| COP9 signalosome complex subunit 5 [Macaca fascicularis]
 gb|AFV41219.1| c-Jun activation domain binding protein-1 [Sus scrofa]
 gb|ELK02355.1| COP9 signalosome complex subunit 5 [Pteropus alecto]
 gb|AIC50780.1| COPS5, partial [synthetic construct]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_004602468.1| PREDICTED: COP9 signalosome complex subunit 5 [Sorex araneus]
Length=334

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|AAP36860.1| Homo sapiens COP9 constitutive photomorphogenic homolog subunit 
5 (Arabidopsis) [synthetic construct]
 gb|AAX29363.1| COP9 constitutive photomorphogenic-like subunit 5, partial [synthetic 
construct]
Length=335

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_006860136.1| PREDICTED: COP9 signalosome complex subunit 5 [Chrysochloris 
asiatica]
Length=307

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELTNNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>ref|XP_001494265.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Equus 
caballus]
 ref|XP_008524909.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Equus 
przewalskii]
Length=334

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|AAX37104.1| COP9 constitutive photomorphogenic-like subunit 5 [synthetic 
construct]
Length=335

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|AAB16847.1| Jun activation domain binding protein [Homo sapiens]
Length=334

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  51   YFKYCKISALALLKMVMHARSGGNLEVMGLM  81



>gb|ACO14355.1| COP9 signalosome complex subunit 5 [Esox lucius]
Length=186

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 13/91 (14%)
 Frame = +2

Query  80   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  259
            + +++AQKTWE++N+++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  2    AGSSMAQKTWELQNSMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  48

Query  260  YFKRVKISALALLKMVVHARSGGTIEVMGLM  352
            YFK  KISALALLKMV+HARSGG +EVMGLM
Sbjct  49   YFKYCKISALALLKMVMHARSGGNLEVMGLM  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395