BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF005E21

Length=391
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008783474.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    182   2e-51   Phoenix dactylifera
ref|XP_007017510.1|  Sugar isomerase family protein isoform 1           183   2e-51   
ref|XP_011021922.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    181   3e-51   Populus euphratica
ref|XP_002312387.2|  hypothetical protein POPTR_0008s11770g             181   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_007017511.1|  Sugar isomerase (SIS) family protein isoform 2     180   1e-50   
gb|KDO84533.1|  hypothetical protein CISIN_1g007374mg                   180   2e-50   Citrus sinensis [apfelsine]
gb|KDO84532.1|  hypothetical protein CISIN_1g007374mg                   179   2e-50   Citrus sinensis [apfelsine]
ref|XP_010254873.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    179   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010942803.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    179   2e-50   Elaeis guineensis
ref|XP_011083695.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    179   2e-50   Sesamum indicum [beniseed]
ref|XP_004291883.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    178   4e-50   Fragaria vesca subsp. vesca
ref|XP_010481952.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    178   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009114042.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    178   5e-50   Brassica rapa
gb|EYU45142.1|  hypothetical protein MIMGU_mgv1a003701mg                178   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_009775389.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    178   5e-50   Nicotiana sylvestris
gb|EYU45143.1|  hypothetical protein MIMGU_mgv1a003701mg                178   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_009775388.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    178   6e-50   Nicotiana sylvestris
gb|KJB14511.1|  hypothetical protein B456_002G128400                    177   9e-50   Gossypium raimondii
gb|KJB14509.1|  hypothetical protein B456_002G128400                    177   9e-50   Gossypium raimondii
gb|KJB14513.1|  hypothetical protein B456_002G128400                    177   9e-50   Gossypium raimondii
ref|XP_010481956.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    177   1e-49   Camelina sativa [gold-of-pleasure]
emb|CDP07526.1|  unnamed protein product                                173   1e-49   Coffea canephora [robusta coffee]
sp|O82059.2|G6PI_SPIOL  RecName: Full=Glucose-6-phosphate isomera...    177   1e-49   Spinacia oleracea
dbj|BAB17645.1|  cytosolic phosphoglucose isomerase                     177   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473486.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    177   2e-49   Citrus sinensis [apfelsine]
emb|CDX95172.1|  BnaC09g16980D                                          172   2e-49   
dbj|BAB17636.1|  cytosolic phosphoglucose isomerase                     176   2e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17650.1|  cytosolic phosphoglucose isomerase                     176   2e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17649.1|  cytosolic phosphoglucose isomerase                     176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001265881.1|  glucose-6-phosphate isomerase                      176   2e-49   Solanum lycopersicum
dbj|BAB17639.1|  cytosolic phosphoglucose isomerase                     176   3e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17648.1|  cytosolic phosphoglucose isomerase                     176   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199088.1|  glucose-6-phosphate isomerase                         176   3e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17654.1|  cytosolic phosphoglucose isomerase                     176   3e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC11913.1|  cytosolic phosphoglucose isomerase                     176   3e-49   Turritis glabra
ref|XP_010313627.1|  PREDICTED: glucose-6-phosphate isomerase iso...    176   3e-49   Solanum lycopersicum
ref|XP_002510371.1|  glucose-6-phosphate isomerase, putative            176   3e-49   
gb|AAK50107.1|AF372970_1  AT5g42740/MJB21_12                            176   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403357.1|  hypothetical protein EUTSA_v10003173mg             176   4e-49   
gb|KJB14514.1|  hypothetical protein B456_002G128400                    176   4e-49   Gossypium raimondii
ref|XP_010263691.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    175   5e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006434973.1|  hypothetical protein CICLE_v10000722mg             175   6e-49   Citrus clementina [clementine]
ref|XP_009365601.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    175   6e-49   Pyrus x bretschneideri [bai li]
gb|KHG04167.1|  Glucose-6-phosphate isomerase, cytosolic                174   7e-49   Gossypium arboreum [tree cotton]
emb|CDY64430.1|  BnaA09g16190D                                          175   8e-49   Brassica napus [oilseed rape]
ref|XP_006281946.1|  hypothetical protein CARUB_v10028158mg             174   9e-49   Capsella rubella
dbj|BAB17635.1|  cytosolic phosphoglucose isomerase                     174   1e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17643.1|  cytosolic phosphoglucose isonerase                     174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481955.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    174   1e-48   Camelina sativa [gold-of-pleasure]
gb|KHN22258.1|  Glucose-6-phosphate isomerase, cytosolic                174   1e-48   Glycine soja [wild soybean]
ref|XP_010677508.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    174   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010442128.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    174   1e-48   Camelina sativa [gold-of-pleasure]
dbj|BAB17646.1|  cytosolic phosphoglucose isomerase                     174   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04166.1|  Glucose-6-phosphate isomerase, cytosolic                174   2e-48   Gossypium arboreum [tree cotton]
sp|Q9FXM5.2|G6PI_ARAHG  RecName: Full=Glucose-6-phosphate isomera...    174   2e-48   Arabidopsis halleri subsp. gemmifera
dbj|BAB17655.1|  cytosolic phosphoglucose isomerase                     173   3e-48   Arabidopsis halleri subsp. gemmifera
ref|XP_009598843.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    173   3e-48   Nicotiana tomentosiformis
gb|AII20189.1|  glucose-6-phosphate isomerase                           173   4e-48   Nicotiana tabacum [American tobacco]
dbj|BAC11915.1|  cytosolic phosphoglucose isomerase                     172   5e-48   Arabidopsis halleri subsp. gemmifera
dbj|BAC77717.1|  cytosolic phosphoglucose isomerase                     172   5e-48   Arabidopsis halleri subsp. gemmifera
dbj|BAC77708.1|  cytosolic phosphoglucose isomerase                     172   5e-48   Arabidopsis halleri subsp. gemmifera
ref|XP_010494215.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    172   5e-48   Camelina sativa [gold-of-pleasure]
dbj|BAC11914.1|  cytosolic phosphoglucose isomerase                     172   6e-48   Crucihimalaya himalaica
dbj|BAC77716.1|  cytosolic phosphoglucose isomerase                     172   6e-48   Arabidopsis halleri subsp. gemmifera
ref|XP_009364475.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    172   8e-48   Pyrus x bretschneideri [bai li]
ref|NP_001275223.1|  glucose-6-phosphate isomerase                      172   9e-48   Solanum tuberosum [potatoes]
gb|KHN45846.1|  Glucose-6-phosphate isomerase, cytosolic                172   1e-47   Glycine soja [wild soybean]
dbj|BAC77714.1|  cytosolic phosphoglucose isomerase                     172   1e-47   Arabidopsis halleri subsp. gemmifera
dbj|BAB17637.1|  cytosolic phosphoglucose isomerase                     171   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865489.1|  glucose-6-phosphate isomerase                      171   1e-47   Arabidopsis lyrata subsp. lyrata
ref|NP_001242028.1|  uncharacterized protein LOC100807719               171   1e-47   Glycine max [soybeans]
ref|XP_006582469.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...    170   1e-47   
dbj|BAC77715.1|  cytosolic phosphoglucose isomerase                     171   2e-47   Arabidopsis halleri subsp. gemmifera
dbj|BAC77709.1|  cytosolic phosphoglucose isomerase                     171   2e-47   Arabidopsis halleri subsp. gemmifera
dbj|BAC77720.1|  cytosolic phosphoglucose isomerase                     171   2e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_007136588.1|  hypothetical protein PHAVU_009G057500g             171   3e-47   Phaseolus vulgaris [French bean]
ref|XP_006837344.1|  hypothetical protein AMTR_s00111p00094320          171   3e-47   Amborella trichopoda
dbj|BAC77719.1|  cytosolic phosphoglucose isomerase                     170   3e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_008377422.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    171   3e-47   
ref|XP_003618419.1|  Glucose-6-phosphate isomerase                      170   4e-47   Medicago truncatula
ref|XP_008377333.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    170   4e-47   Malus domestica [apple tree]
gb|AFK39110.1|  unknown                                                 170   4e-47   Medicago truncatula
dbj|BAC77713.1|  cytosolic phosphoglucose isomerase                     170   4e-47   Arabidopsis halleri subsp. gemmifera
sp|Q9FXM4.1|G6PI_ARALP  RecName: Full=Glucose-6-phosphate isomera...    170   5e-47   Arabidopsis lyrata subsp. petraea
gb|KDP38492.1|  hypothetical protein JCGZ_04417                         170   6e-47   Jatropha curcas
ref|XP_009407687.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   7e-47   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC77710.1|  cytosolic phosphoglucose isomerase                     169   7e-47   Arabidopsis halleri subsp. gemmifera
ref|XP_004489355.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   1e-46   
gb|AAC08411.1|  cytosolic phosphoglucose isomerase                      169   1e-46   Leavenworthia crassa
ref|XP_002282774.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   1e-46   Vitis vinifera
ref|XP_007221807.1|  hypothetical protein PRUPE_ppa003512mg             168   2e-46   Prunus persica
ref|XP_007151166.1|  hypothetical protein PHAVU_004G023500g             167   2e-46   Phaseolus vulgaris [French bean]
ref|XP_010519111.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    168   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010106007.1|  Glucose-6-phosphate isomerase, cytosolic 1         168   2e-46   
ref|XP_008220896.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    167   3e-46   Prunus mume [ume]
gb|AAY85660.1|  cytosolic glucose-6-phosphate isomerase                 167   3e-46   Helianthus annuus
ref|XP_007151167.1|  hypothetical protein PHAVU_004G023500g             167   4e-46   Phaseolus vulgaris [French bean]
gb|EPS71211.1|  glucose-6-phosphate isomerase                           167   5e-46   Genlisea aurea
ref|XP_003554193.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    164   6e-45   Glycine max [soybeans]
ref|XP_004152701.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    164   8e-45   Cucumis sativus [cucumbers]
ref|XP_008444704.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    161   8e-44   Cucumis melo [Oriental melon]
ref|XP_004981572.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    160   1e-43   Setaria italica
gb|EEC80343.1|  hypothetical protein OsI_22416                          160   2e-43   Oryza sativa Indica Group [Indian rice]
gb|ADI24331.1|  glucose-6-phosphate isomerase                           158   2e-43   Miscanthus sinensis
gb|AIY55209.1|  cytosolic phosphoglucose isomerase C1                   152   2e-43   Clarkia bottae
sp|P54237.1|G6PI1_CLAMI  RecName: Full=Glucose-6-phosphate isomer...    160   3e-43   Clarkia mildrediae
emb|CAD79579.1|  cytosolic phosphoglucose isomerase                     158   4e-43   Oenothera toumeyi
gb|AIY55230.1|  cytosolic phosphoglucose isomerase C1                   155   4e-43   Clarkia mosquinii
gb|KCW67833.1|  hypothetical protein EUGRSUZ_F01561                     159   5e-43   Eucalyptus grandis [rose gum]
ref|XP_010060937.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    159   5e-43   Eucalyptus grandis [rose gum]
emb|CAD24789.1|  cytosolic phosphoglucose isomerase                     155   8e-43   Clarkia dudleyana
emb|CAD24788.1|  cytosolic phosphoglucose isomerase                     158   1e-42   Clarkia heterandra
dbj|BAA23176.1|  phosphoglucose isomerase                               158   1e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA23179.1|  cytosolic phosphoglucose isomerase                     158   1e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA23181.1|  cytosolic phosphoglucose isomerase                     158   1e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA23185.2|  phosphoglucose isomerase                               158   1e-42   Dioscorea tokoro [shan bei xie]
sp|P54243.1|G6PI_OENME  RecName: Full=Glucose-6-phosphate isomera...    158   1e-42   Oenothera sinuata var. hirsuta
dbj|BAA23182.1|  cytosolic phosphoglucose isomerase                     157   1e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA23177.1|  cytosolic phosphoglucose isomerase                     157   1e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA23180.1|  cytosolic phosphoglucose isomerase                     157   2e-42   Dioscorea tokoro [shan bei xie]
dbj|BAA08149.1|  phosphoglucose isomerase (Pgi-b)                       157   2e-42   Oryza sativa [red rice]
ref|NP_001105368.1|  glucose-6-phosphate isomerase, cytosolic           157   2e-42   Zea mays [maize]
sp|P54242.1|G6PI2_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    157   2e-42   Clarkia xantiana [gusight clarkia]
ref|NP_001057316.1|  Os06g0256500                                       157   3e-42   
sp|P29333.1|G6PI2_CLALE  RecName: Full=Glucose-6-phosphate isomer...    157   3e-42   Clarkia lewisii
emb|CAC86121.1|  cytosolic phosphoglucose isomerase                     156   3e-42   Clarkia modesta
emb|CAD24787.1|  cytosolic phosphoglucose isomerase                     156   3e-42   Clarkia heterandra
gb|AIY55210.1|  cytosolic phosphoglucose isomerase C2                   152   4e-42   Clarkia bottae
sp|P54234.1|G6PI1_CLAAR  RecName: Full=Glucose-6-phosphate isomer...    156   5e-42   Clarkia arcuata
gb|AIY55212.1|  cytosolic phosphoglucose isomerase C1                   155   6e-42   Clarkia dudleyana
sp|P54235.1|G6PI1_CLACO  RecName: Full=Glucose-6-phosphate isomer...    155   8e-42   Clarkia concinna [red ribbons]
gb|AIY55204.1|  cytosolic phosphoglucose isomerase C1                   152   9e-42   Clarkia pulchella [pink-fairies]
emb|CAD24790.1|  cytosolic phosphoglucose isomerase                     153   9e-42   Clarkia dudleyana
gb|AGT38452.1|  phosphoglucose isomerase                                155   1e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CAD24783.1|  cytosolic phosphoglucose isomerase                     154   1e-41   Clarkia lingulata
ref|NP_001051434.1|  Os03g0776000                                       155   1e-41   
sp|P34796.1|G6PI1_CLALE  RecName: Full=Glucose-6-phosphate isomer...    155   1e-41   Clarkia lewisii
gb|EEC76262.1|  hypothetical protein OsI_13718                          155   1e-41   Oryza sativa Indica Group [Indian rice]
dbj|BAA08148.1|  phosphoglucose isomerase (Pgi-a)                       155   1e-41   Oryza sativa [red rice]
sp|P54241.1|G6PI2_CLACO  RecName: Full=Glucose-6-phosphate isomer...    155   1e-41   Clarkia concinna [red ribbons]
ref|XP_003569006.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    155   1e-41   Brachypodium distachyon [annual false brome]
sp|P54236.1|G6PI1_CLAFR  RecName: Full=Glucose-6-phosphate isomer...    155   2e-41   Clarkia franciscana [Presidio clarkia]
gb|AIY55208.1|  cytosolic phosphoglucose isomerase C1                   154   2e-41   Clarkia bottae
gb|EMT10058.1|  Glucose-6-phosphate isomerase, cytosolic                154   2e-41   
gb|ABE41790.1|  glucose-6-phosphate isomerase                           154   2e-41   Triticum aestivum [Canadian hard winter wheat]
emb|CAC86124.1|  cytosolic phosphoglucose isomerase                     152   2e-41   Clarkia unguiculata
gb|ABE41789.1|  glucose-6-phosphate isomerase                           154   2e-41   Hordeum vulgare [barley]
emb|CAC82578.1|  cytosolic phosphoclucose isomerase                     154   2e-41   Clarkia epilobioides
emb|CAC86123.1|  cytosolic phosphoglucose isomerase                     154   2e-41   Clarkia unguiculata
emb|CAB55566.1|  cytosolic phosphoglucose isomerase                     154   3e-41   Clarkia gracilis
sp|P54240.1|G6PI1_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    154   3e-41   Clarkia xantiana [gusight clarkia]
gb|AIY55211.1|  cytosolic phosphoglucose isomerase C1                   153   4e-41   Clarkia imbricata
gb|AED99454.1|  PgiC protein                                            153   5e-41   Festuca ovina
emb|CAC86122.1|  cytosolic phosphoglucose isomerase                     153   5e-41   Clarkia modesta
emb|CAD24791.1|  cytosolic phosphoglucose isomerase                     151   5e-41   Clarkia dudleyana
sp|P54238.1|G6PI1_CLARO  RecName: Full=Glucose-6-phosphate isomer...    153   6e-41   Clarkia rostrata
gb|EMS52088.1|  Glucose-6-phosphate isomerase, cytosolic                153   7e-41   Triticum urartu
gb|AED99455.1|  PgiC2-3 protein                                         152   9e-41   Festuca ovina
gb|AED99453.1|  PgiC protein                                            152   9e-41   Poa palustris
gb|AIY55205.1|  cytosolic phosphoglucose isomerase C2                   149   1e-40   Clarkia pulchella [pink-fairies]
gb|AIY55213.1|  cytosolic phosphoglucose isomerase C2                   151   1e-40   Clarkia dudleyana
ref|XP_006651865.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    154   2e-40   
emb|CAC82579.1|  cytosolic phosphoclucose isomerase                     151   2e-40   Clarkia epilobioides
emb|CAC82580.1|  cytosolic phosphoclucose isomerase                     150   2e-40   Clarkia delicata
sp|P54239.1|G6PI1_CLAWI  RecName: Full=Glucose-6-phosphate isomer...    151   3e-40   Clarkia williamsonii
emb|CAB55567.1|  cytosolic phosphoglucose isomerase                     150   4e-40   Clarkia gracilis
gb|EMS65017.1|  Glucose-6-phosphate isomerase, cytosolic                145   5e-40   Triticum urartu
gb|AED99456.1|  PgiC2-4 protein                                         148   3e-39   Festuca ovina
emb|CAD24784.1|  cytosolic phosphoglucose isomerase                     148   3e-39   Clarkia lingulata
emb|CAD79580.1|  cytosolic phosphoglucose isomerase                     145   2e-38   Oenothera lindheimeri
gb|ABB90111.1|  phosphoglucoisomerase                                   144   6e-38   Festuca ovina
gb|ACY82426.1|  PgiC                                                    135   2e-37   Fuchsia boliviana
gb|ACY82424.1|  PgiC                                                    135   2e-37   Ludwigia uruguayensis
ref|XP_001778143.1|  predicted protein                                  142   4e-37   
gb|ACY82425.1|  PgiC                                                    134   1e-36   Chamaenerion angustifolium [fireweed]
gb|ACY82429.1|  PgiC                                                    133   2e-36   Chylismia arenaria
ref|XP_002975871.1|  hypothetical protein SELMODRAFT_104526             140   3e-36   
gb|ACY82439.1|  PgiC                                                    132   3e-36   Oenothera drummondii
ref|XP_002968611.1|  hypothetical protein SELMODRAFT_89539              139   4e-36   
gb|ACY82432.1|  PgiC                                                    132   6e-36   Oenothera acaulis
gb|ACY82434.1|  PgiC                                                    131   8e-36   Oenothera affinis
gb|ACY82430.1|  PgiC                                                    131   9e-36   Oenothera gaura
gb|ACY82433.1|  PgiC                                                    129   4e-35   Oenothera acutissima
gb|ACY82445.1|  PgiC                                                    129   4e-35   Oenothera humifusa
gb|ACY82461.1|  PgiC                                                    129   5e-35   Oenothera stricta subsp. stricta
gb|ACY82431.1|  PgiC                                                    129   9e-35   Gayophytum eriospermum
ref|XP_001760206.1|  predicted protein                                  135   2e-34   
gb|ACY82446.1|  PgiC                                                    127   3e-34   Oenothera kunthiana
ref|XP_001754629.1|  predicted protein                                  134   4e-34   
gb|KHN34179.1|  Glucose-6-phosphate isomerase, cytosolic 1              133   6e-34   Glycine soja [wild soybean]
gb|ACY82436.1|  PgiC                                                    126   1e-33   Oenothera bahia-blancae
gb|ABK00059.1|  cytosolic glucose-6-phosphate isomerase                 133   1e-33   Marchantia polymorpha
gb|ABK00065.1|  cytosolic glucose-6-phosphate isomerase                 133   2e-33   Marchantia polymorpha
ref|XP_007017512.1|  Sugar isomerase (SIS) family protein isoform 3     131   4e-33   
ref|XP_001782795.1|  predicted protein                                  130   1e-32   
ref|XP_002509192.1|  phosphoglucose isomerase                           129   3e-32   Micromonas commoda
ref|XP_002967787.1|  hypothetical protein SELMODRAFT_409075             130   1e-31   
ref|XP_003082100.1|  cytosolic phosphoglucose isomerase (ISS)           126   4e-31   
emb|CEF99714.1|  Phosphoglucose isomerase, C-terminal                   126   4e-31   Ostreococcus tauri
gb|ABK00069.1|  cytosolic glucose-6-phosphate isomerase                 122   9e-30   Chara vulgaris
ref|XP_009381882.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    122   1e-29   
ref|XP_007509641.1|  cytosolic phosphoglucose isomerase                 122   1e-29   Bathycoccus prasinos
ref|XP_001420367.1|  predicted protein                                  121   2e-29   Ostreococcus lucimarinus CCE9901
gb|KIZ06944.1|  glucose-6-phosphate isomerase                           119   1e-28   Monoraphidium neglectum
gb|EMS63155.1|  Glucose-6-phosphate isomerase, cytosolic                112   2e-28   Triticum urartu
ref|XP_005650466.1|  cytosolic phosphoglucose isomerase                 113   2e-26   Coccomyxa subellipsoidea C-169
ref|XP_003061563.1|  predicted protein                                  113   3e-26   Micromonas pusilla CCMP1545
gb|ACI29026.1|  glucose-6-phosphate isomerase                           113   3e-26   Dunaliella salina
ref|XP_001703279.1|  phosphoglucose isomerase                           113   3e-26   Chlamydomonas reinhardtii
ref|XP_005537531.1|  glucose-6-phosphate isomerase                      112   6e-26   Cyanidioschyzon merolae strain 10D
ref|XP_005851258.1|  hypothetical protein CHLNCDRAFT_138008             111   7e-26   Chlorella variabilis
ref|XP_005537536.1|  glucose-6-phosphate isomerase                      112   1e-25   Cyanidioschyzon merolae strain 10D
emb|CAC85674.1|  cytosolic phosphoglucose isomerase                     103   1e-25   Clarkia similis
ref|XP_011399580.1|  Glucose-6-phosphate isomerase, cytosolic B         109   2e-25   Auxenochlorella protothecoides
emb|CBN74985.1|  conserved unknown protein                              110   3e-25   Ectocarpus siliculosus
emb|CAC84507.1|  cytosolic phosphoglucose isomerase                     102   4e-25   Clarkia delicata
ref|XP_002946940.1|  hypothetical protein VOLCADRAFT_103185             108   1e-24   Volvox carteri f. nagariensis
emb|CAC85676.1|  cytosolic phosphoglucose isomerase                   99.8    2e-24   Clarkia similis
emb|CAC84513.1|  cytosolic phosphoglucose isomerase                   99.4    3e-24   Clarkia delicata
ref|XP_005718631.1|  glucose-6-phosphate isomerase                      106   5e-24   Chondrus crispus [carageen]
gb|ABK00064.1|  cytosolic glucose-6-phosphate isomerase                 106   6e-24   Mesostigma viride
gb|KDO30887.1|  glucose-6-phosphate isomerase                           105   1e-23   Saprolegnia parasitica CBS 223.65
emb|CBK23535.2|  unnamed protein product                                105   1e-23   Blastocystis hominis
gb|EJK76542.1|  hypothetical protein THAOC_01689                        104   1e-23   Thalassiosira oceanica
ref|XP_002289565.1|  predicted protein                                  105   2e-23   Thalassiosira pseudonana CCMP1335
ref|XP_002185275.1|  isomerase glucose-6-phosphate isomerase            105   3e-23   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008611761.1|  glucose-6-phosphate isomerase, cytosolic 2         103   4e-23   Saprolegnia diclina VS20
ref|XP_005845944.1|  hypothetical protein CHLNCDRAFT_135927             103   9e-23   Chlorella variabilis
gb|EWM30292.1|  glucose-6-phosphate isomerase                           102   2e-22   Nannochloropsis gaditana
ref|XP_008242062.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  95.9    3e-22   Prunus mume [ume]
gb|AAP51067.1|  glucose-6-phosphate isomerase                           101   3e-22   Phytophthora infestans [potato late blight]
emb|CAC85686.1|  cytosolic phosphoglucose isomerase                     100   4e-22   Clarkia similis
gb|AAP51075.1|  glucose-6-phosphate isomerase                           100   5e-22   Phytophthora erythroseptica
gb|ETP54025.1|  hypothetical protein F442_01139                         100   5e-22   Phytophthora parasitica P10297
ref|XP_008890866.1|  hypothetical protein PPTG_01022                    100   6e-22   Phytophthora parasitica INRA-310
gb|AAP51068.1|  glucose-6-phosphate isomerase                           100   7e-22   Phytophthora infestans [potato late blight]
gb|AAP51069.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora infestans [potato late blight]
gb|AAP51077.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora erythroseptica
gb|AAP51070.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora infestans [potato late blight]
gb|AAP51080.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora infestans [potato late blight]
gb|AAP51061.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora infestans [potato late blight]
gb|AAP51071.1|  glucose-6-phosphate isomerase                           100   8e-22   Phytophthora infestans [potato late blight]
ref|XP_002908462.1|  glucose-6-phosphate isomerase                      100   9e-22   Phytophthora infestans T30-4
gb|AAP51079.1|  glucose-6-phosphate isomerase                           100   1e-21   Phytophthora infestans [potato late blight]
ref|XP_009523844.1|  glucose-6-phosphate isomerase                      100   1e-21   Phytophthora sojae
gb|AAP51065.1|  glucose-6-phosphate isomerase                           100   1e-21   Phytophthora infestans [potato late blight]
gb|AAP51072.1|  glucose-6-phosphate isomerase                           100   1e-21   Phytophthora infestans [potato late blight]
gb|AAP51074.1|  glucose-6-phosphate isomerase                         99.8    1e-21   Phytophthora cactorum
gb|AAP51073.1|  glucose-6-phosphate isomerase                         99.8    1e-21   Phytophthora cactorum
emb|CAC85683.1|  cytosolic phosphoglucose isomerase                   99.4    1e-21   Clarkia similis
emb|CAC85684.1|  cytosolic phosphoglucose isomerase                   99.4    1e-21   Clarkia similis
ref|XP_005707296.1|  glucose-6-phosphate isomerase                    99.8    2e-21   Galdieria sulphuraria
ref|XP_011397571.1|  Glucose-6-phosphate isomerase, cytosolic         99.8    2e-21   Auxenochlorella protothecoides
emb|CAC84508.1|  cytosolic phosphoglucose isomerase                   99.0    2e-21   Clarkia delicata
ref|WP_035348414.1|  glucose-6-phosphate isomerase                    99.0    3e-21   Edaphobacter aggregans
gb|AAP51063.1|  glucose-6-phosphate isomerase                         98.6    3e-21   Phytophthora mirabilis
gb|ETP26016.1|  hypothetical protein F441_01181                       98.2    4e-21   Phytophthora parasitica CJ01A1
ref|WP_013568288.1|  glucose-6-phosphate isomerase                    98.2    5e-21   Terriglobus saanensis
gb|AAP51060.1|  glucose-6-phosphate isomerase                         98.2    5e-21   Phytophthora infestans [potato late blight]
ref|WP_044238058.1|  glucose-6-phosphate isomerase                    97.8    5e-21   
ref|WP_007915376.1|  glucose-6-phosphate isomerase                    97.8    5e-21   Ktedonobacter racemifer
gb|EDL59173.1|  glucose-6-phosphate isomerase / glucose-6 phospha...  97.8    6e-21   Gimesia maris DSM 8797
ref|WP_022845260.1|  glucose-6-phosphate isomerase                    97.8    7e-21   Acidobacteriaceae bacterium TAA166
gb|AAP51062.1|  glucose-6-phosphate isomerase                         97.8    7e-21   Phytophthora infestans [potato late blight]
ref|XP_009825599.1|  hypothetical protein H257_03289                  97.8    7e-21   Aphanomyces astaci
gb|AAP51066.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
gb|ABH11444.1|  cytosolic glucose-6-phosphate isomerase               97.1    1e-20   Chondrus crispus [carageen]
emb|CAC84511.1|  cytosolic phosphoglucose isomerase                   96.7    1e-20   Clarkia delicata
gb|AAP51076.1|  glucose-6-phosphate isomerase                         97.1    1e-20   Phytophthora erythroseptica
ref|XP_005539460.1|  glucose-6-phosphate isomerase                    97.1    1e-20   Cyanidioschyzon merolae strain 10D
gb|ETK96016.1|  hypothetical protein L915_01139                       96.7    2e-20   Phytophthora parasitica
ref|WP_038170073.1|  glucose-6-phosphate isomerase                    96.7    2e-20   
ref|WP_012119262.1|  glucose-6-phosphate isomerase                    96.3    2e-20   Roseiflexus castenholzii
gb|EUA30096.1|  phosphoglucose isomerase family protein               92.4    3e-20   Mycobacterium xenopi 4042
emb|CAC84514.1|  cytosolic phosphoglucose isomerase                   95.9    3e-20   Clarkia delicata
ref|WP_008691240.1|  glucose-6-phosphate isomerase                    94.4    4e-20   
gb|ACY82427.1|  PgiC                                                  89.0    4e-20   Oenothera berlandieri
gb|EUA50790.1|  glucose-6-phosphate isomerase                         95.5    5e-20   Mycobacterium xenopi 3993
ref|WP_003922817.1|  glucose-6-phosphate isomerase                    95.5    5e-20   Mycobacterium xenopi
emb|CCA13931.1|  unnamed protein product                              95.1    6e-20   
gb|EES52160.1|  Glucose-6-phosphate isomerase                         95.1    6e-20   
ref|WP_035118134.1|  glucose-6-phosphate isomerase                    94.7    7e-20   
gb|ABH11437.1|  cytosolic glucose-6-phosphate isomerase               94.7    8e-20   
ref|WP_035958222.1|  glucose-6-phosphate isomerase                    94.4    1e-19   
ref|WP_036402031.1|  glucose-6-phosphate isomerase                    94.0    1e-19   
ref|WP_022915689.1|  glucose-6-phosphate isomerase                    94.0    1e-19   
ref|WP_020475646.1|  glucose-6-phosphate isomerase                    94.0    1e-19   
ref|WP_013734575.1|  glucose-6-phosphate isomerase                    94.0    2e-19   
ref|WP_011959028.1|  glucose-6-phosphate isomerase                    93.6    2e-19   
ref|XP_008876241.1|  hypothetical protein H310_11362                  93.6    2e-19   
ref|WP_020539958.1|  hypothetical protein                             93.6    2e-19   
ref|WP_027879593.1|  glucose-6-phosphate isomerase                    93.2    2e-19   
ref|WP_002655683.1|  glucose-6-phosphate isomerase                    92.8    3e-19   
gb|ABH11443.1|  cytosolic glucose-6-phosphate isomerase               92.8    5e-19   
ref|WP_036418610.1|  glucose-6-phosphate isomerase                    92.4    5e-19   
ref|WP_024794660.1|  glucose-6-phosphate isomerase                    92.4    5e-19   
emb|CCI49829.1|  unnamed protein product                              92.4    6e-19   
ref|WP_010042300.1|  glucose-6-phosphate isomerase                    92.0    7e-19   
ref|WP_015289437.1|  Putative glucose-6-phosphate isomerase Pgi (...  92.0    7e-19   
ref|WP_028455494.1|  glucose-6-phosphate isomerase                    92.0    7e-19   
ref|WP_034915672.1|  glucose-6-phosphate isomerase                    92.0    7e-19   
ref|WP_005391734.1|  glucose-6-phosphate isomerase                    92.0    8e-19   
ref|WP_025686803.1|  glucose-6-phosphate isomerase                    89.7    8e-19   
ref|WP_036471356.1|  glucose-6-phosphate isomerase                    92.0    8e-19   
ref|WP_034042027.1|  glucose-6-phosphate isomerase                    91.7    9e-19   
ref|WP_005395783.1|  glucose-6-phosphate isomerase                    91.7    9e-19   
ref|WP_025736664.1|  glucose-6-phosphate isomerase                    91.7    1e-18   
ref|WP_023367292.1|  glucose-6-phosphate isomerase                    91.7    1e-18   
ref|WP_013875574.1|  glucose-6-phosphate isomerase                    91.7    1e-18   
ref|WP_031748941.1|  glucose-6-phosphate isomerase                    91.7    1e-18   
ref|WP_036364407.1|  glucose-6-phosphate isomerase                    91.7    1e-18   
ref|WP_020716310.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_012500155.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_041938599.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
gb|AIH61599.1|  glucose-6-phosphate isomerase                         91.3    1e-18   
emb|CAJ58735.1|  glucosephosphate isomerase                           91.3    1e-18   
ref|WP_043856359.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031655396.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_024742665.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_003906471.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_003404830.1|  MULTISPECIES: glucose-6-phosphate isomerase      91.3    1e-18   
ref|WP_031658015.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031697689.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031726298.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031704551.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031648273.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031667829.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031717278.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031750821.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031714136.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031704926.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_044098329.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_031736911.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_019250083.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_015631231.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_015627013.1|  glucose-6-phosphate isomerase                    91.3    1e-18   
ref|WP_015292555.1|  Putative glucose-6-phosphate isomerase Pgi (...  91.3    1e-18   
gb|AFE12233.1|  glucose-6-phosphate isomerase                         91.3    1e-18   
emb|CCQ72446.1|  Glucose-6-phosphate isomerase                        91.3    1e-18   
ref|WP_011892748.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_009103335.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_009975207.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_007153478.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|XP_005713157.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_008674518.1|  Glucose-6-phosphate isomerase                    90.9    2e-18   
gb|KJE22815.1|  glucose-6-phosphate isomerase                         90.9    2e-18   
ref|WP_008913735.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_026389025.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
gb|EMR02392.1|  Glucose-6-phosphate isomerase                         85.5    2e-18   
ref|WP_017869387.1|  MULTISPECIES: glucose-6-phosphate isomerase      90.9    2e-18   
ref|WP_029915590.1|  glucose-6-phosphate isomerase                    90.9    2e-18   
ref|WP_023900183.1|  MULTISPECIES: glucose-6-phosphate isomerase      90.9    2e-18   
ref|WP_016481560.1|  glucose-6-phosphate isomerase                    90.5    2e-18   
ref|WP_044626966.1|  glucose-6-phosphate isomerase                    90.5    2e-18   
ref|WP_043620176.1|  glucose-6-phosphate isomerase                    90.5    2e-18   
ref|WP_020709280.1|  glucose-6-phosphate isomerase                    90.5    2e-18   
gb|ABH11442.1|  cytosolic glucose-6-phosphate isomerase               90.5    2e-18   
ref|WP_018341993.1|  glucose-6-phosphate isomerase                    90.5    3e-18   
ref|XP_002777180.1|  glucose-6-phosphate isomerase, putative          89.7    3e-18   
ref|WP_044096098.1|  glucose-6-phosphate isomerase                    90.5    3e-18   
ref|WP_016456973.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_020510489.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_028314952.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_006422740.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_038532457.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_006542865.1|  glucose-6-phosphate isomerase                    90.1    3e-18   
ref|WP_031650205.1|  glucose-6-phosphate isomerase                    90.1    4e-18   
ref|WP_037041583.1|  glucose-6-phosphate isomerase                    90.1    4e-18   
gb|KIG14473.1|  Glucose-6-phosphate isomerase                         90.1    4e-18   
pdb|2WU8|A  Chain A, Structural Studies Of Phosphoglucose Isomera...  90.1    4e-18   
ref|WP_031650569.1|  glucose-6-phosphate isomerase                    89.7    4e-18   
ref|WP_012610164.1|  glucose-6-phosphate isomerase                    89.7    5e-18   
ref|WP_027137868.1|  glucose-6-phosphate isomerase                    89.7    5e-18   
ref|WP_012948309.1|  glucose-6-phosphate isomerase                    89.4    5e-18   
ref|WP_034269526.1|  glucose-6-phosphate isomerase                    89.4    6e-18   
ref|WP_028879540.1|  glucose-6-phosphate isomerase                    89.4    6e-18   
ref|WP_024637466.1|  glucose-6-phosphate isomerase                    87.8    6e-18   
ref|WP_014435059.1|  glucose-6-phosphate isomerase                    89.4    7e-18   
gb|KDD75199.1|  phosphoglucose isomerase                              89.4    7e-18   
ref|WP_020161008.1|  hypothetical protein                             89.4    7e-18   
ref|WP_011054057.1|  glucose-6-phosphate isomerase                    89.4    7e-18   
ref|WP_014656932.1|  glucose-6-phosphate isomerase                    89.4    7e-18   
emb|CBJ31594.1|  Glucose-6-phosphate isomerase, cytosolic             87.0    7e-18   
ref|XP_002775575.1|  glucose-6-phosphate isomerase, putative          89.0    7e-18   
ref|WP_004925910.1|  glucose-6-phosphate isomerase                    89.0    8e-18   
ref|WP_040132715.1|  glucose-6-phosphate isomerase                    89.0    8e-18   
ref|WP_038430733.1|  glucose-6-phosphate isomerase                    89.0    8e-18   
ref|WP_038430363.1|  glucose-6-phosphate isomerase                    89.0    8e-18   
ref|WP_034897612.1|  glucose-6-phosphate isomerase                    84.3    8e-18   
ref|WP_011723919.1|  glucose-6-phosphate isomerase                    89.0    9e-18   
ref|WP_003872837.1|  glucose-6-phosphate isomerase                    89.0    9e-18   
ref|WP_003770888.1|  glucose-6-phosphate isomerase                    89.0    9e-18   
ref|WP_026849003.1|  glucose-6-phosphate isomerase                    89.0    1e-17   
ref|WP_011141691.1|  glucose-6-phosphate isomerase                    88.6    1e-17   
gb|EXI86393.1|  Glucose-6-phosphate isomerase                         88.6    1e-17   
ref|WP_040096351.1|  glucose-6-phosphate isomerase                    88.6    1e-17   
ref|WP_007777009.1|  MULTISPECIES: glucose-6-phosphate isomerase      88.6    1e-17   
gb|KFB69509.1|  Glucose-6-phosphate isomerase                         85.5    1e-17   
ref|WP_005139706.1|  glucose-6-phosphate isomerase                    88.6    1e-17   
ref|WP_027716608.1|  glucose-6-phosphate isomerase                    88.6    1e-17   
ref|WP_018504044.1|  glucose-6-phosphate isomerase                    88.6    1e-17   
ref|WP_011790382.1|  MULTISPECIES: glucose-6-phosphate isomerase      88.6    1e-17   
ref|WP_007039426.1|  glucose-6-phosphate isomerase                    88.2    1e-17   
ref|WP_015622880.1|  glucose-6-phosphate isomerase                    88.2    1e-17   
ref|WP_010888377.1|  glucose-6-phosphate isomerase                    88.2    1e-17   
ref|WP_042330434.1|  glucose-6-phosphate isomerase                    88.2    1e-17   
ref|WP_035921359.1|  glucose-6-phosphate isomerase                    88.2    1e-17   
ref|WP_006563092.1|  glucose-6-phosphate isomerase                    88.2    2e-17   
gb|EIV95028.1|  glucose-6-phosphate isomerase                         88.2    2e-17   
dbj|GAL62099.1|  glucose-6-phosphate isomerase                        85.9    2e-17   
ref|WP_011918845.1|  glucose-6-phosphate isomerase                    88.2    2e-17   
ref|WP_006368317.1|  glucose-6-phosphate isomerase                    88.2    2e-17   
ref|WP_011711011.1|  glucose-6-phosphate isomerase                    88.2    2e-17   
dbj|GAL79793.1|  glucose-6-phosphate isomerase                        85.9    2e-17   
ref|WP_029336806.1|  glucose-6-phosphate isomerase                    88.2    2e-17   
ref|WP_024927351.1|  MULTISPECIES: glucose-6-phosphate isomerase      88.2    2e-17   
ref|WP_040198901.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_023362734.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_036185768.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_008719086.1|  Glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_007168753.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
dbj|BAQ16794.1|  glucose-6-phosphate isomerase                        87.8    2e-17   
ref|WP_043532318.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_044637397.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_019634642.1|  hypothetical protein                             87.8    2e-17   
ref|WP_036203222.1|  glucose-6-phosphate isomerase                    87.8    2e-17   
ref|WP_010907561.1|  glucose-6-phosphate isomerase                    87.8    3e-17   
ref|WP_037421241.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_003886560.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_037429612.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_040005482.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_041512506.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_032396249.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_014689945.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
gb|ABW16605.1|  Glucose-6-phosphate isomerase                         87.4    3e-17   
ref|WP_027496008.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_032390800.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_032373059.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_032371253.1|  glucose-6-phosphate isomerase                    87.4    3e-17   
ref|WP_032399844.1|  glucose-6-phosphate isomerase                    87.0    3e-17   
ref|WP_032365933.1|  glucose-6-phosphate isomerase                    87.0    3e-17   
ref|WP_032381719.1|  glucose-6-phosphate isomerase                    87.0    3e-17   
ref|WP_032407596.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_032388642.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_032385698.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_035728993.1|  MULTISPECIES: glucose-6-phosphate isomerase      87.0    4e-17   
ref|WP_011434521.1|  MULTISPECIES: glucose-6-phosphate isomerase      87.0    4e-17   
gb|ACV08039.1|  Glucose-6-phosphate isomerase                         87.4    4e-17   
ref|WP_012323917.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_026416622.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_014374959.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_037192202.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
dbj|GAN33030.1|  glucose-6-phosphate isomerase                        87.0    4e-17   
gb|ABH11438.1|  cytosolic glucose-6-phosphate isomerase               87.0    4e-17   
ref|WP_036499748.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|XP_002778568.1|  glucose-6-phosphate isomerase, putative          87.0    4e-17   
ref|WP_034946796.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_041932540.1|  glucose-6-phosphate isomerase                    87.0    4e-17   
ref|WP_009953061.1|  glucose-6-phosphate isomerase                    87.0    5e-17   
ref|WP_012693801.1|  glucose-6-phosphate isomerase                    87.0    5e-17   
ref|XP_002787676.1|  glucose-6-phosphate isomerase, putative          87.0    5e-17   
ref|WP_012793090.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_006080620.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_036454714.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_043568956.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_006084968.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
gb|EWM29429.1|  cytosolic phosphoglucose isomerase                    87.8    5e-17   
ref|WP_015934419.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_028453685.1|  glucose-6-phosphate isomerase                    86.7    5e-17   
ref|WP_026610920.1|  glucose-6-phosphate isomerase                    86.7    6e-17   
emb|CCH52287.1|  Glucose-6-phosphate isomerase                        87.0    6e-17   
ref|WP_011846073.1|  glucose-6-phosphate isomerase                    86.7    6e-17   
gb|ABG57761.1|  glucose-6-phosphate isomerase                         86.7    6e-17   
ref|WP_014381885.1|  MULTISPECIES: glucose-6-phosphate isomerase      86.7    6e-17   
ref|WP_014379276.1|  glucose-6-phosphate isomerase                    86.7    6e-17   
ref|WP_002810426.1|  glucose-6-phosphate isomerase                    86.7    6e-17   
ref|WP_020821709.1|  glucose-6-phosphate isomerase                    86.7    6e-17   
ref|WP_036782455.1|  glucose-6-phosphate isomerase                    86.3    7e-17   
ref|WP_018618222.1|  glucose-6-phosphate isomerase                    86.3    7e-17   
ref|WP_040629848.1|  glucose-6-phosphate isomerase                    86.3    7e-17   
ref|WP_041255191.1|  glucose-6-phosphate isomerase                    86.3    7e-17   
ref|WP_017365829.1|  glucose-6-phosphate isomerase                    86.3    7e-17   
gb|EAR03048.1|  glucose-6-phosphate isomerase                         86.3    7e-17   
ref|WP_026631502.1|  glucose-6-phosphate isomerase                    86.3    8e-17   
ref|WP_026445610.1|  glucose-6-phosphate isomerase                    86.3    8e-17   
ref|WP_041632758.1|  glucose-6-phosphate isomerase                    86.3    8e-17   
ref|WP_011717973.1|  glucose-6-phosphate isomerase                    86.3    9e-17   
ref|WP_015766610.1|  glucose-6-phosphate isomerase                    85.9    9e-17   
ref|WP_043639165.1|  glucose-6-phosphate isomerase                    85.9    9e-17   
ref|WP_006707902.1|  glucose-6-phosphate isomerase                    85.9    9e-17   
ref|WP_043592584.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_041288044.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_008215851.1|  phosphoglucose isomerase                         86.3    1e-16   
ref|WP_036433943.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_018024235.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_020683405.1|  hypothetical protein                             85.9    1e-16   
ref|WP_042085964.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_036425479.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_030168469.1|  glucose-6-phosphate isomerase                    85.9    1e-16   
ref|WP_036418957.1|  glucose-6-phosphate isomerase                    85.9    1e-16   



>ref|XP_008783474.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
 ref|XP_008783475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
Length=567

 Score =   182 bits (462),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TLIC+++PWKDLKGH+ EI  THLR+LM+D +RCKSMMVEFDGILLDYSRQR   +
Sbjct  1    MASTTLICDTEPWKDLKGHVKEIEKTHLRDLMADVERCKSMMVEFDGILLDYSRQRVCQD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KL  LAEAAHLK+KI+RM+ GEHINSTENRSVLH+ALRA  D VI
Sbjct  61   TIEKLFKLAEAAHLKQKIDRMYGGEHINSTENRSVLHIALRAPRDKVI  108



>ref|XP_007017510.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY14735.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
Length=714

 Score =   183 bits (464),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  46   FILK*LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYS  225
            F+L   EMAS+TLIC+++PWKDLK H+++  +THLR+LM+D +RC+SMMVEFDG+LLDYS
Sbjct  140  FLLCSAEMASTTLICDTEPWKDLKAHVEDFKNTHLRDLMNDKERCQSMMVEFDGMLLDYS  199

Query  226  RQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            RQRATLET+ KL  LAEAA LK+ INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  200  RQRATLETMDKLDKLAEAASLKQHINRMYSGEHINSTENRSVLHVALRAPRDAVI  254



>ref|XP_011021922.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Populus 
euphratica]
Length=568

 Score =   181 bits (460),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLICE+QPWKDLK H+++I  THLR L+SD DRCKSM+V+FDGI LDYSRQRAT  
Sbjct  1    MASSTLICETQPWKDLKSHVEDIKKTHLRELLSDTDRCKSMVVDFDGITLDYSRQRATPG  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAE AHLKEKI+RMF+GEHINSTENRSVLHVALRA  DAV+
Sbjct  61   TMDKLYNLAEGAHLKEKIDRMFNGEHINSTENRSVLHVALRAPRDAVM  108



>ref|XP_002312387.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
 gb|EEE89754.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
Length=568

 Score =   181 bits (459),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLICE+QPWKDLK H+++I  THLR L+SD DRCKSM+V+FDGI LDYSRQRAT  
Sbjct  1    MASSTLICETQPWKDLKSHVEDIKKTHLRELLSDTDRCKSMVVDFDGITLDYSRQRATPG  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+  L +LAEAAHLKEKI+RMF+GEHINSTENRSVLHVALRA  DAV+
Sbjct  61   TMDNLYNLAEAAHLKEKIDRMFNGEHINSTENRSVLHVALRAPRDAVM  108



>ref|XP_007017511.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
 gb|EOY14736.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
Length=568

 Score =   180 bits (456),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TLIC+++PWKDLK H+++  +THLR+LM+D +RC+SMMVEFDG+LLDYSRQRATLE
Sbjct  1    MASTTLICDTEPWKDLKAHVEDFKNTHLRDLMNDKERCQSMMVEFDGMLLDYSRQRATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LK+ INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TMDKLDKLAEAASLKQHINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>gb|KDO84533.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=606

 Score =   180 bits (456),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  46   FILK*LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYS  225
            F  + L+MASSTLIC+++PWKDLK H+ EI  THLR+LMSD DRC+SMMVEFDGILLDYS
Sbjct  32   FSFRILQMASSTLICDTEPWKDLKNHVQEIKKTHLRDLMSDTDRCQSMMVEFDGILLDYS  91

Query  226  RQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            RQ ATL+T+ KL  LAEAA L  KINRM++GE INSTENRSVLHVALRA  DA I
Sbjct  92   RQNATLKTMDKLYQLAEAAQLNNKINRMYNGEKINSTENRSVLHVALRAPRDAAI  146



>gb|KDO84532.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=583

 Score =   179 bits (455),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  46   FILK*LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYS  225
            F  + L+MASSTLIC+++PWKDLK H+ EI  THLR+LMSD DRC+SMMVEFDGILLDYS
Sbjct  32   FSFRILQMASSTLICDTEPWKDLKNHVQEIKKTHLRDLMSDTDRCQSMMVEFDGILLDYS  91

Query  226  RQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            RQ ATL+T+ KL  LAEAA L  KINRM++GE INSTENRSVLHVALRA  DA I
Sbjct  92   RQNATLKTMDKLYQLAEAAQLNNKINRMYNGEKINSTENRSVLHVALRAPRDAAI  146



>ref|XP_010254873.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nelumbo 
nucifera]
Length=568

 Score =   179 bits (454),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS TLICE++PW+DLK H+++I  THLR+LMSD++RCKSMM+EFDG+LLDYSRQ AT E
Sbjct  1    MASRTLICETEPWRDLKAHVEDIKKTHLRDLMSDSERCKSMMLEFDGLLLDYSRQCATQE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAAHLK+KIN M+ GEHINSTENRSVLHVALRAS D VI
Sbjct  61   TMEKLFRLAEAAHLKQKINSMYGGEHINSTENRSVLHVALRASKDKVI  108



>ref|XP_010942803.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Elaeis 
guineensis]
Length=567

 Score =   179 bits (454),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TL+C+++PWKDLKGH+ EI  THLR+LM+D +RCKSMMVEFDGILLDYSRQR   +
Sbjct  1    MASTTLVCDTEPWKDLKGHVKEIEKTHLRDLMNDVERCKSMMVEFDGILLDYSRQRVRQD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAAHLK+KI+RM+SGE INSTENRSVLH+ALRA  D VI
Sbjct  61   TVEKLFKLAEAAHLKQKIDRMYSGERINSTENRSVLHIALRAPRDKVI  108



>ref|XP_011083695.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
 ref|XP_011083696.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
Length=568

 Score =   179 bits (454),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LICE++PWKDLK H+D+I  THLR LM D  RC+SMMVEFDGILLDYSRQ ATL+
Sbjct  1    MASSALICETEPWKDLKVHVDDIKKTHLRELMCDTKRCQSMMVEFDGILLDYSRQCATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAAHLKEKINRMF+GE INSTENRSVLHVALRA  D+VI
Sbjct  61   TLNKLKNLAEAAHLKEKINRMFNGERINSTENRSVLHVALRAPRDSVI  108



>ref|XP_004291883.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
 ref|XP_011459557.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   178 bits (452),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI +++PWKDLKGH+ +IN THLR+LM+D +RC++MMVEFDG+LLDYSRQR TL+
Sbjct  1    MASSGLISDTEPWKDLKGHVQDINKTHLRDLMNDVNRCQAMMVEFDGMLLDYSRQRVTLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL+ LAEAA LK+KINRMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TMGKLIKLAEAAGLKDKINRMFAGEHINSTENRSVLHVALRAQRDAVI  108



>ref|XP_010481952.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
 ref|XP_010481958.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
Length=560

 Score =   178 bits (452),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++IN THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDINKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMFSG+HINSTENRSVLH ALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFSGDHINSTENRSVLHAALRAPKDAVI  109



>ref|XP_009114042.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brassica 
rapa]
Length=560

 Score =   178 bits (451),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MAS T LI E+Q WKDLKGH+++IN THLR+LMSDA RC+SMM+EF+G+LLDYSRQRAT+
Sbjct  1    MASPTALISETQAWKDLKGHVEDINKTHLRDLMSDAHRCESMMLEFEGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AAHL EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAHLSEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>gb|EYU45142.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=569

 Score =   178 bits (452),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA S LICE+QPWKDLK H+D+I  THLR LMSD +RC+SMM+EFDG+LLDYSRQRAT +
Sbjct  1    MAPSALICETQPWKDLKAHVDDIKKTHLRELMSDTERCQSMMIEFDGMLLDYSRQRATSD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAAHLKEKIN+MF+GE INSTE+RSVLHVALRA  D+VI
Sbjct  61   TLNKLKNLAEAAHLKEKINKMFNGERINSTEDRSVLHVALRAPRDSVI  108



>ref|XP_009775389.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
 ref|XP_009775390.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
Length=568

 Score =   178 bits (451),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+++PWK+L+ H+++IN THLR+LM+D  RC+SMM+EFDGILLDYSRQRAT  
Sbjct  1    MASSTLICDTEPWKELRAHVEDINKTHLRDLMNDTSRCQSMMMEFDGILLDYSRQRATTG  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL SLAEAA +KEKINRMF+GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TLNKLFSLAEAARVKEKINRMFNGERINSTENRSVLHVALRAPRDAVI  108



>gb|EYU45143.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=568

 Score =   178 bits (451),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA S LICE+QPWKDLK H+D+I  THLR LMSD +RC+SMM+EFDG+LLDYSRQRAT +
Sbjct  1    MAPSALICETQPWKDLKAHVDDIKKTHLRELMSDTERCQSMMIEFDGMLLDYSRQRATSD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAAHLKEKIN+MF+GE INSTE+RSVLHVALRA  D+VI
Sbjct  61   TLNKLKNLAEAAHLKEKINKMFNGERINSTEDRSVLHVALRAPRDSVI  108



>ref|XP_009775388.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Nicotiana sylvestris]
Length=576

 Score =   178 bits (451),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  61   LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRAT  240
            L MASSTLIC+++PWK+L+ H+++IN THLR+LM+D  RC+SMM+EFDGILLDYSRQRAT
Sbjct  7    LIMASSTLICDTEPWKELRAHVEDINKTHLRDLMNDTSRCQSMMMEFDGILLDYSRQRAT  66

Query  241  LETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
              T+ KL SLAEAA +KEKINRMF+GE INSTENRSVLHVALRA  DAVI
Sbjct  67   TGTLNKLFSLAEAARVKEKINRMFNGERINSTENRSVLHVALRAPRDAVI  116



>gb|KJB14511.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=545

 Score =   177 bits (449),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS++LIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSRQ ATLE
Sbjct  1    MASTSLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRQCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>gb|KJB14509.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14510.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14512.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=568

 Score =   177 bits (449),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS++LIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSRQ ATLE
Sbjct  1    MASTSLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRQCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>gb|KJB14513.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=569

 Score =   177 bits (449),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS++LIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSRQ ATLE
Sbjct  1    MASTSLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRQCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>ref|XP_010481956.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X3 
[Camelina sativa]
Length=560

 Score =   177 bits (448),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++IN THLR+LMSDA+RC+SMM+EFDG+ LDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDINKTHLRDLMSDANRCQSMMMEFDGLFLDYSRQRATI  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL LA+AA L EKI+RMFSG+HINSTENRSVLH ALRA  DAVI
Sbjct  61   ETMDKLLKLAKAAQLAEKISRMFSGDHINSTENRSVLHAALRAPKDAVI  109



>emb|CDP07526.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            M SS+LIC+S+ WKDLK H+++I  THLR LM+D +RCKSMMVEFDG LLDYSRQRAT +
Sbjct  1    MGSSSLICDSESWKDLKFHVEDIKKTHLRELMADTERCKSMMVEFDGNLLDYSRQRATHD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KLLSLAEAAH+K+KINRMF+GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TLNKLLSLAEAAHVKDKINRMFNGERINSTENRSVLHVALRAPRDAVI  108



>sp|O82059.2|G6PI_SPIOL RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Spinacia oleracea]
 emb|CAA03983.1| glucose-6-phosphate isomerase [Spinacia oleracea]
Length=566

 Score =   177 bits (448),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA STLIC++  W++LK H+ EI  THLR+LMSDADRCKSMMVEFDG+LLDYSRQ AT +
Sbjct  1    MAPSTLICDTDSWQNLKTHVAEIKKTHLRDLMSDADRCKSMMVEFDGLLLDYSRQNATHD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEA+HLK+KIN+MF+GEHINSTENRSVLHVALRAS DAVI
Sbjct  61   TMSKLFQLAEASHLKDKINQMFNGEHINSTENRSVLHVALRASRDAVI  108



>dbj|BAB17645.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   177 bits (448),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENR+VLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRAVLHVALRAPKDAVI  109



>ref|XP_006473486.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Citrus 
sinensis]
Length=568

 Score =   177 bits (448),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+++PWKDLK H+ EI  THLR+LMSD DRC+SMMVEFDGILLDYSRQ ATL+
Sbjct  1    MASSTLICDTEPWKDLKNHVQEIKKTHLRDLMSDTDRCQSMMVEFDGILLDYSRQNATLK  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA L  KINRM++GE INSTENRSVLHVALRA  DA I
Sbjct  61   TMDKLYQLAEAAQLNNKINRMYNGEKINSTENRSVLHVALRAPRDAAI  108



>emb|CDX95172.1| BnaC09g16980D [Brassica napus]
Length=365

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            M S T LICE+Q WKDLKGH+++IN THLR+LMSDA RC+SMM+EF+G+LLDYSRQRAT+
Sbjct  1    MTSPTALICETQAWKDLKGHVEDINKTHLRDLMSDAHRCESMMLEFEGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DA I
Sbjct  61   ETMDKLLNLAKAAQLSEKISRMFNGEHINSTENRSVLHVALRAPKDAFI  109



>dbj|BAB17636.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (447),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENR+VLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRAVLHVALRAPKDAVI  109



>dbj|BAB17650.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (447),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17649.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (447),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|NP_001265881.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
 gb|ABE03628.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
Length=568

 Score =   176 bits (447),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++Q WKDL+ H++EIN THLR+L++  DRC+SMMVEFDGIL+DYSRQRATL+
Sbjct  1    MASSALISDTQSWKDLRAHVEEINKTHLRDLLNHTDRCQSMMVEFDGILIDYSRQRATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+KKL +LAEAAH+KEKI RMF+GEHINSTENR VLHVALRA  DAVI
Sbjct  61   TLKKLFNLAEAAHVKEKIIRMFNGEHINSTENRPVLHVALRAPRDAVI  108



>dbj|BAB17639.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=559

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17648.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|NP_199088.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|P34795.1|G6PI_ARATH RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis thaliana]
 emb|CAA48940.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAB10630.1| glucose-6-phosphate isomerase, cytosolic [Arabidopsis thaliana]
 dbj|BAB17638.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17641.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17642.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17644.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17647.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17651.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17652.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17653.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 emb|CAD11677.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 gb|AED94855.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17654.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAC11913.1| cytosolic phosphoglucose isomerase [Turritis glabra]
Length=560

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SM++EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMIMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_010313627.1| PREDICTED: glucose-6-phosphate isomerase isoform X1 [Solanum 
lycopersicum]
Length=574

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++Q WKDL+ H++EIN THLR+L++  DRC+SMMVEFDGIL+DYSRQRATL+
Sbjct  1    MASSALISDTQSWKDLRAHVEEINKTHLRDLLNHTDRCQSMMVEFDGILIDYSRQRATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+KKL +LAEAAH+KEKI RMF+GEHINSTENR VLHVALRA  DAVI
Sbjct  61   TLKKLFNLAEAAHVKEKIIRMFNGEHINSTENRPVLHVALRAPRDAVI  108



>ref|XP_002510371.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF52558.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
Length=568

 Score =   176 bits (446),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA S LIC++QPWKDLK H+++I  THLRNL+ D +RCKSM+VEFDGI+LDYSRQ AT++
Sbjct  1    MALSALICDTQPWKDLKAHVEDIKKTHLRNLLGDTERCKSMLVEFDGIMLDYSRQTATID  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAAHLKEKI+RMF+GE INSTENRSVLHVALRA  DA++
Sbjct  61   TLDKLYNLAEAAHLKEKIHRMFNGERINSTENRSVLHVALRAPRDAIV  108



>gb|AAK50107.1|AF372970_1 AT5g42740/MJB21_12 [Arabidopsis thaliana]
 gb|AAM16223.1| AT5g42740/MJB21_12 [Arabidopsis thaliana]
Length=560

 Score =   176 bits (445),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_006403357.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403358.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403359.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44810.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44811.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44812.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
Length=560

 Score =   176 bits (445),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LICE++ WKDLKGH++EI  THLR+L+SDA+RC+ MMVEFDG++LDYSRQRAT+
Sbjct  1    MASSTALICETEAWKDLKGHLEEIKKTHLRDLLSDANRCQQMMVEFDGLMLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLLSLA+AA L EKI RMF GEHIN+TE+RSVLHVALRA  DAVI
Sbjct  61   ETMDKLLSLAKAAQLTEKIRRMFKGEHINTTEDRSVLHVALRAPKDAVI  109



>gb|KJB14514.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=584

 Score =   176 bits (446),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS++LIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSRQ ATLE
Sbjct  1    MASTSLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRQCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>ref|XP_010263691.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010263692.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
Length=568

 Score =   175 bits (444),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LIC++QPWKDLK H+++I  THLR+LM+D++RCKSMM+E DG+LLDYSRQ AT +
Sbjct  1    MASPALICDTQPWKDLKAHVEDIKKTHLRDLMNDSERCKSMMLEIDGLLLDYSRQCATQD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAAHLK+KIN M+SGEHINSTENRSVLHVALRAS D VI
Sbjct  61   TMEKLFRLAEAAHLKQKINSMYSGEHINSTENRSVLHVALRASRDKVI  108



>ref|XP_006434973.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
 gb|ESR48213.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
Length=568

 Score =   175 bits (444),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+++PWKDLK H+ EI  THLR+LMSD DRC+SMMVEFDGILLDYSRQ ATL+
Sbjct  1    MASSTLICDTEPWKDLKNHVQEIKKTHLRDLMSDTDRCQSMMVEFDGILLDYSRQNATLK  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA L  KIN+M++GE INSTENRSVLHVALRA  DA I
Sbjct  61   TMDKLYQLAEAAQLNNKINQMYNGEKINSTENRSVLHVALRAPRDAAI  108



>ref|XP_009365601.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
 ref|XP_009365602.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
Length=568

 Score =   175 bits (444),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+++IN THLR+L++D  R ++MMVEFDG+LLDYSRQRAT+E
Sbjct  1    MASSVLISDTQPWKDLKAHVEDINKTHLRDLLNDVKRSQAMMVEFDGLLLDYSRQRATVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KLL LAE A LKEKINRMF+GE INSTENR+VLHVALRAS DAVI
Sbjct  61   TLQKLLKLAEGASLKEKINRMFAGERINSTENRAVLHVALRASRDAVI  108



>gb|KHG04167.1| Glucose-6-phosphate isomerase, cytosolic [Gossypium arboreum]
Length=542

 Score =   174 bits (442),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TLIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSR  ATLE
Sbjct  1    MASTTLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRHCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TMDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>emb|CDY64430.1| BnaA09g16190D [Brassica napus]
Length=568

 Score =   175 bits (443),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MAS T LI E+Q WKDLKGH+++IN THLR+LMSDA RC+SMM+EF+G+LLDYSRQRAT+
Sbjct  1    MASPTALISETQAWKDLKGHVEDINKTHLRDLMSDAHRCESMMLEFEGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLPEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_006281946.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
 gb|EOA14844.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
Length=560

 Score =   174 bits (442),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  70   ASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLET  249
            +SS LIC+++ WK LKGH+++IN THLR LMSDA+RC+ MM+EFDGILLDYSRQRAT+ET
Sbjct  3    SSSALICDTEAWKALKGHVEDINKTHLRELMSDANRCQYMMMEFDGILLDYSRQRATVET  62

Query  250  IKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            + KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  63   MDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17635.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17640.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   174 bits (442),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASS-TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASS  LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSPALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17643.1| cytosolic phosphoglucose isonerase [Arabidopsis thaliana]
Length=560

 Score =   174 bits (442),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASS-TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASS  LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSPALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHVALRAPEDAVI  109



>ref|XP_010481955.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
 ref|XP_010481957.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
Length=560

 Score =   174 bits (442),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  70   ASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLET  249
            +S+TLIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+ LDYSRQRAT+ET
Sbjct  3    SSTTLICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLFLDYSRQRATIET  62

Query  250  IKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            + KLL LA+AA L EKI+RMFSG+HINSTENRSVLH ALRA  DAVI
Sbjct  63   MDKLLKLAKAAQLAEKISRMFSGDHINSTENRSVLHAALRAPKDAVI  109



>gb|KHN22258.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   174 bits (441),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+D++   HLR+L+SD  RC+SM+VEFD ILLDY+RQ+AT E
Sbjct  1    MASSALISDTQPWKDLKAHVDDVKKAHLRDLLSDDKRCQSMLVEFDDILLDYARQQATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KL  LAEAA LKEKINRM+SGEHINSTENRSVLHVALRAS DAVI
Sbjct  61   TIQKLFELAEAASLKEKINRMYSGEHINSTENRSVLHVALRASRDAVI  108



>ref|XP_010677508.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=568

 Score =   174 bits (442),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA STLIC++  W++LK +++EI  THLR+LMSDA+RCKSMMVEFDG+LLDYSRQ ATL+
Sbjct  1    MAPSTLICDTDAWQNLKMNVEEIKKTHLRDLMSDAERCKSMMVEFDGLLLDYSRQNATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ +L  LAEAAHLK+KI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TMNRLYQLAEAAHLKDKISRMFNGEHINSTENRSVLHVALRAPRDAVI  108



>ref|XP_010442128.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   174 bits (441),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT 
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATE  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMFSG+HINSTENRSVLH ALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFSGDHINSTENRSVLHAALRAPKDAVI  109



>dbj|BAB17646.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   174 bits (441),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASS-TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASS  LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSPALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLH+ALRA  DAVI
Sbjct  61   ETMDKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHIALRAPKDAVI  109



>gb|KHG04166.1| Glucose-6-phosphate isomerase, cytosolic [Gossypium arboreum]
Length=560

 Score =   174 bits (441),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TLIC++QPWKDLK H ++I  THLR+LM+D +RC+SMMVEFDG+ LDYSR  ATLE
Sbjct  1    MASTTLICDTQPWKDLKAHTEDIKKTHLRDLMNDKERCESMMVEFDGMFLDYSRHCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LK++INRM+SGEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TMDKLYKLAEAASLKQQINRMYSGEHINSTENRSVLHVALRAPRDAVI  108



>sp|Q9FXM5.2|G6PI_ARAHG RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis halleri 
subsp. gemmifera]
Length=560

 Score =   174 bits (440),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST L C+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRA +
Sbjct  1    MASSTALFCDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRAPV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17655.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=552

 Score =   173 bits (439),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST L C+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRA +
Sbjct  1    MASSTALFCDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRAPV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_009598843.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
 ref|XP_009598848.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
Length=568

 Score =   173 bits (439),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+S+PWK+L+ H+++I  THLR+LM+D  RC SMM+EFDGILLDYSRQRAT  
Sbjct  1    MASSTLICDSEPWKELRVHVEDIKKTHLRDLMNDTSRCHSMMMEFDGILLDYSRQRATTG  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAA +KEKINRMF+GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TLNKLFNLAEAARVKEKINRMFNGERINSTENRSVLHVALRAPRDAVI  108



>gb|AII20189.1| glucose-6-phosphate isomerase [Nicotiana tabacum]
Length=568

 Score =   173 bits (438),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+S+PWK+L+ H+++I  THLR+LM+D  RC SMM+EFDGILLDYSRQRAT  
Sbjct  1    MASSTLICDSEPWKELRVHVEDIKKTHLRDLMNDTSRCHSMMMEFDGILLDYSRQRATTG  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAA +KEKINRMF+GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TLNKLFNLAEAARVKEKINRMFNGERINSTENRSVLHVALRAPRDAVI  108



>dbj|BAC11915.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77718.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   172 bits (437),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAC77717.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   172 bits (437),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAC77708.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77711.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77712.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   172 bits (437),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_010494215.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494216.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494217.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494218.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   172 bits (437),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT 
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATE  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+G+HINSTENRSVLH ALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGDHINSTENRSVLHAALRAPKDAVI  109



>dbj|BAC11914.1| cytosolic phosphoglucose isomerase [Crucihimalaya himalaica]
Length=560

 Score =   172 bits (436),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LIC+++ WKDLKGH+++I  THLR+LMSDA+RC+SMMVEFDG+LLDYSRQ AT+
Sbjct  1    MASSTALICDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMVEFDGLLLDYSRQCATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET  KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVA RA  DAVI
Sbjct  61   ETTDKLLNLAKAAQLSEKISRMFNGEHINSTENRSVLHVAPRAPKDAVI  109



>dbj|BAC77716.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77721.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   172 bits (436),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_009364475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
 ref|XP_009364484.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
Length=568

 Score =   172 bits (436),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+++I  THLRNL++D  R ++M VEFDG+LLDYSRQ AT+E
Sbjct  1    MASSVLISDAQPWKDLKAHVEDIKKTHLRNLLNDVKRSQAMTVEFDGLLLDYSRQCATVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KLL LAEAA LKEKINRMF GEHINSTENRSVLHVALRAS DA I
Sbjct  61   TLQKLLKLAEAASLKEKINRMFGGEHINSTENRSVLHVALRASRDAAI  108



>ref|NP_001275223.1| glucose-6-phosphate isomerase [Solanum tuberosum]
 gb|AAU00726.1| glucose-6-phosphate isomerase [Solanum tuberosum]
Length=568

 Score =   172 bits (436),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI +++ WKDL+ H++EIN THLR+LM++ +RC+SMMVEFDGIL+DYSRQRAT +
Sbjct  1    MASSALISDTESWKDLRAHVEEINKTHLRDLMNNTNRCQSMMVEFDGILIDYSRQRATFD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL SLAEAA +KEKI RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TLNKLFSLAEAARVKEKIIRMFNGEHINSTENRSVLHVALRAPRDAVI  108



>gb|KHN45846.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   172 bits (435),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++Q WKDLK H+++IN THLR+L+SD  RC+SM+VEFD ILLDYSRQ+AT E
Sbjct  1    MASSALISDTQQWKDLKAHVEDINKTHLRDLLSDDKRCQSMLVEFDDILLDYSRQQATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KL  LAEAA LKEKI RM+SGEHINSTENRSVLHVALRAS DAVI
Sbjct  61   TIQKLFELAEAASLKEKIIRMYSGEHINSTENRSVLHVALRASRDAVI  108



>dbj|BAC77714.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   172 bits (435),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I   HLR+LM+DA+RC+SMM+EFDG+LLDYSRQRATL
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKIHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATL  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAB17637.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   171 bits (434),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 76/106 (72%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  73   SSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETI  252
            S  LIC+++ WKDLKGH+++I  THLR+LMSD +RC+SMM+EFDG+LLDYSRQRAT+ET+
Sbjct  4    SPALICDTEAWKDLKGHVEDIKKTHLRDLMSDVNRCQSMMMEFDGLLLDYSRQRATVETM  63

Query  253  KKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             KLL+LA+A+ L EKI+RMF+GEHINSTENRSVLH+ALRA  DAVI
Sbjct  64   DKLLNLAKASQLTEKISRMFNGEHINSTENRSVLHIALRAPKDAVI  109



>ref|XP_002865489.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41748.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score =   171 bits (434),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST L  +++ WKDLKGH+++I  THLR+LMSDA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALTSDTEAWKDLKGHVEDIKKTHLRDLMSDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|NP_001242028.1| uncharacterized protein LOC100807719 [Glycine max]
 gb|ACU20878.1| unknown [Glycine max]
Length=568

 Score =   171 bits (434),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++Q WKDLK H+++IN THLR+L+SD  RC+SM+VEFD ILLDYSRQ+AT E
Sbjct  1    MASSALISDTQQWKDLKAHVEDINKTHLRDLLSDDKRCQSMLVEFDDILLDYSRQQATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KL  LAEAA LKEKI RM+SGEHINSTENRSVLHVALRAS DAVI
Sbjct  61   TIQKLFELAEAASLKEKIIRMYSGEHINSTENRSVLHVALRASRDAVI  108



>ref|XP_006582469.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase, 
cytosolic 2-like [Glycine max]
Length=462

 Score =   170 bits (430),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+D++   HLR+L+SD  RC+SM+VEFD ILLDY+RQ+AT E
Sbjct  1    MASSALISDTQPWKDLKAHVDDVKKAHLRDLLSDDKRCQSMLVEFDDILLDYARQQATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KL  LAEAA LKEKINRM+SGEHINSTENRSVLHVAL AS D VI
Sbjct  61   TIQKLFELAEAASLKEKINRMYSGEHINSTENRSVLHVALHASRDVVI  108



>dbj|BAC77715.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   171 bits (433),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+ A L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKVAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAC77709.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   171 bits (433),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASS-TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASS  LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSPALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>dbj|BAC77720.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   171 bits (432),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+L++DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLVTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_007136588.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
 gb|ESW08582.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
Length=568

 Score =   171 bits (432),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            M+S  LI E+QPWKDLK H+++I  THLR+L++D  RC+SM++EFD ILLDYSRQ+AT E
Sbjct  1    MSSFFLISETQPWKDLKAHVEDIKKTHLRDLLTDDKRCQSMLIEFDDILLDYSRQQATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI++LL LAEAA LKE INRM+SGEHINSTENRSVLHVALRAS DAVI
Sbjct  61   TIQRLLKLAEAASLKENINRMYSGEHINSTENRSVLHVALRASRDAVI  108



>ref|XP_006837344.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
 gb|ERN00198.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
Length=568

 Score =   171 bits (432),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA  TLI ++QPWKDLK H+++IN THLR+LM+D++RCKSMM+EFDGILLDYSRQR + E
Sbjct  1    MAPPTLISDTQPWKDLKVHVEDINKTHLRDLMNDSERCKSMMMEFDGILLDYSRQRISQE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAAHL++KIN M++GEHINSTE+R VLHVALRA  D+VI
Sbjct  61   TLDKLFKLAEAAHLRQKINNMYNGEHINSTEDRPVLHVALRAPRDSVI  108



>dbj|BAC77719.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   170 bits (431),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASSTL-ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST  I +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTASISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_008377422.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Malus 
domestica]
Length=568

 Score =   171 bits (432),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+++IN THLR+L++D  R  +MMVEFDG+LLDYSRQ AT+E
Sbjct  1    MASSVLISDTQPWKDLKAHVEDINKTHLRDLLNDVKRSXAMMVEFDGLLLDYSRQCATVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KLL LAEAA LKEKINRMF+GE INSTENR+VLHVALRA  DAVI
Sbjct  61   TLQKLLKLAEAASLKEKINRMFAGERINSTENRAVLHVALRAXRDAVI  108



>ref|XP_003618419.1| Glucose-6-phosphate isomerase [Medicago truncatula]
 gb|AES74637.1| glucose-6-phosphate isomerase [Medicago truncatula]
Length=568

 Score =   170 bits (431),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLI ++QPWKDLK H+++I  THLR+L+S+ +R KSM VEFDGILLDYSRQ+ATLE
Sbjct  1    MASSTLISDTQPWKDLKDHVEDIKKTHLRDLLSNEERSKSMTVEFDGILLDYSRQQATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAEAA LK+KIN+M++GEHINSTENR+VLHVALRA  DAVI
Sbjct  61   TTEKLFKLAEAASLKQKINQMYNGEHINSTENRAVLHVALRAPRDAVI  108



>ref|XP_008377333.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
 ref|XP_008377335.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
Length=568

 Score =   170 bits (431),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++QPWKDLK H+++I  THLRNL++D  R ++M VEFDG+LLDYSRQ AT+E
Sbjct  1    MASSVLISDTQPWKDLKAHVEDIKKTHLRNLLNDVKRSQAMTVEFDGLLLDYSRQCATVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KLL LAEAA LKEKINRMF GEHINSTENRSVLHVALRA  DA I
Sbjct  61   TLQKLLKLAEAASLKEKINRMFGGEHINSTENRSVLHVALRAPRDAAI  108



>gb|AFK39110.1| unknown [Medicago truncatula]
Length=568

 Score =   170 bits (431),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLI ++QPWKDLK H+++I  THLR+L+S+ +R KSM VEFDGILLDYSRQ+ATLE
Sbjct  1    MASSTLISDTQPWKDLKDHVEDIKKTHLRDLLSNEERSKSMTVEFDGILLDYSRQQATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAEAA LK+KIN+M++GEHINSTENR+VLHVALRA  DAVI
Sbjct  61   TTEKLFKLAEAASLKQKINQMYNGEHINSTENRAVLHVALRAPRDAVI  108



>dbj|BAC77713.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   170 bits (430),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASSTL-ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST  I + + WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTASISDPEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>sp|Q9FXM4.1|G6PI_ARALP RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis lyrata 
subsp. petraea]
 dbj|BAB17656.1| cytosolic phosphoglucose isomerase [Arabidopsis lyrata subsp. 
petraea]
Length=560

 Score =   170 bits (430),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST LI +++ WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRA +
Sbjct  1    MASSTALISDTEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRAPV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>gb|KDP38492.1| hypothetical protein JCGZ_04417 [Jatropha curcas]
Length=568

 Score =   170 bits (430),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+ LIC++ PWK LK H+++I  THLR+LMSD++RCKSM+VEFDGI++D+SRQ+AT++
Sbjct  1    MASAALICDTHPWKTLKAHVEDIKKTHLRDLMSDSERCKSMVVEFDGIIVDFSRQQATVD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL +LAEAAHLKEKI+ MF+GE IN+TENRSVLHVALRA  DAVI
Sbjct  61   TVDKLYNLAEAAHLKEKIHHMFNGERINTTENRSVLHVALRAPRDAVI  108



>ref|XP_009407687.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407688.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   169 bits (429),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+ LIC+++PWKDLK HI+ I  THLR+LM+D DRC+SMMVEFDGI+LDYSRQRA L+
Sbjct  1    MASTALICDTEPWKDLKEHINVIEKTHLRDLMNDVDRCQSMMVEFDGIILDYSRQRARLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAEAA L++KI+ M++GEHINSTENRSVLH+ALRA  D VI
Sbjct  61   TTEKLFKLAEAADLRKKIDSMYNGEHINSTENRSVLHIALRAPRDKVI  108



>dbj|BAC77710.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   169 bits (429),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASSTL-ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MASST  I + + WKDLKGH+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MASSTASISDPEAWKDLKGHVEDIKKTHLRDLMTDANRCQSMMMEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL+LA+AA L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETVDKLLNLAKAAQLTEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_004489355.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489356.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004489357.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X3 [Cicer arietinum]
Length=568

 Score =   169 bits (428),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLI ++QPWK+LK H+++I + HLR+L+SD +R KSMMVEFDGILLDYSRQ+ATLE
Sbjct  1    MASSTLISDTQPWKELKAHVEDIKANHLRDLLSDDERSKSMMVEFDGILLDYSRQQATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAE A LK+KIN+M+ GEHINSTENR+VLHVALRA  DAVI
Sbjct  61   TREKLFQLAEVASLKQKINQMYKGEHINSTENRAVLHVALRAPRDAVI  108



>gb|AAC08411.1| cytosolic phosphoglucose isomerase [Leavenworthia crassa]
Length=560

 Score =   169 bits (427),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   MASST-LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            M SST LIC+++ WKDLK H+++I  THLR+LM+DA+RC+SMM+EFDG+LLDYSRQRAT+
Sbjct  1    MTSSTALICDTEAWKDLKKHVEDIKKTHLRDLMNDANRCESMMLEFDGLLLDYSRQRATV  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET+ KLL LA+ A L EKI+RMF+GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   ETMNKLLKLAKDAQLPEKISRMFNGEHINSTENRSVLHVALRAPKDAVI  109



>ref|XP_002282774.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 ref|XP_010664679.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI19685.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   169 bits (427),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC+++PWK+L+ H+++I  THLR+LMSD  RC+SMMVEFDG+LLDYSRQ ATLE
Sbjct  1    MASSTLICDTEPWKNLRAHVEDIKKTHLRDLMSDTKRCQSMMVEFDGLLLDYSRQCATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEA +LK+KI RM++GE INSTENR VLHVALRA  D+VI
Sbjct  61   TMDKLFKLAEAENLKQKIGRMYNGERINSTENRPVLHVALRAPRDSVI  108



>ref|XP_007221807.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|EMJ23006.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|AGH25539.1| phosphoglucose isomerase [Prunus persica]
Length=568

 Score =   168 bits (426),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI +++PWKDLK H+ +IN THLR+LM+D  R + M  EFDGILLDYSRQRAT E
Sbjct  1    MASSVLISDTEPWKDLKAHVADINKTHLRDLMNDVKRSQLMTDEFDGILLDYSRQRATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKINRMF GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TLEKLFKLAEAASLKEKINRMFGGEHINSTENRSVLHVALRAPRDAVI  108



>ref|XP_007151166.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23160.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=519

 Score =   167 bits (424),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC++QPWK+L+ H +++  +HLR+L+SD +R +SM+VEFDGILLDYSRQ ATLE
Sbjct  1    MASSTLICDTQPWKELEAHAEDVKKSHLRDLLSDDERSRSMVVEFDGILLDYSRQLATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAE A +KEKINRM++GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TKEKLFKLAEVASVKEKINRMYNGEHINSTENRSVLHVALRAPRDAVI  108



>ref|XP_010519111.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Tarenaya hassleriana]
 ref|XP_010519112.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Tarenaya hassleriana]
Length=561

 Score =   168 bits (425),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +1

Query  67   MASS-TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            MAS   LI E+  WKDLKGH++EI  THLR+LM+DADRC+SMMVEFDG+LLDYSRQ+   
Sbjct  1    MASQPALISETDAWKDLKGHVEEIRMTHLRDLMADADRCRSMMVEFDGLLLDYSRQQGNT  60

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAV  387
            ETI KL +LAEAA LKEKINRMF+G+HINSTE+RSVLHVALRA  DAV
Sbjct  61   ETIHKLFNLAEAAKLKEKINRMFNGDHINSTEDRSVLHVALRAPKDAV  108



>ref|XP_010106007.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
 gb|EXC07277.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
Length=547

 Score =   168 bits (425),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI ++  WKDLK  + EI + HLR+LMSDA RC+SM+VEFDG+LLDYSRQ AT+E
Sbjct  1    MASSALISDTDAWKDLKARVQEIKAIHLRDLMSDAQRCQSMIVEFDGLLLDYSRQNATVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA+LKEKINRMF+GEHINSTENRSVLHVALRA   AVI
Sbjct  61   TIGKLFKLAEAANLKEKINRMFNGEHINSTENRSVLHVALRAPRGAVI  108



>ref|XP_008220896.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic, partial 
[Prunus mume]
Length=556

 Score =   167 bits (424),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LI +++PWKDLK H+ +IN THLR+LM+D  R + M  EFDGILLDYSRQRAT E
Sbjct  1    MASSVLISDTEPWKDLKAHVADINKTHLRDLMNDIKRSQLMTNEFDGILLDYSRQRATPE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKINRMF GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TLEKLFKLAEAASLKEKINRMFGGEHINSTENRSVLHVALRAPRDAVI  108



>gb|AAY85660.1| cytosolic glucose-6-phosphate isomerase [Helianthus annuus]
Length=566

 Score =   167 bits (424),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   STLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIK  255
            +TLI ++  WKDLK H+ EI+ THLR+LM+D DRCKSMM+EFDGI  DYSRQRAT+ T+ 
Sbjct  2    ATLISDTASWKDLKAHVGEIDKTHLRDLMTDTDRCKSMMLEFDGIFFDYSRQRATVNTVS  61

Query  256  KLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            KL  LAE AHLK+KIN MF+GEHINSTENRSVLHVALRAS DA I
Sbjct  62   KLFKLAEEAHLKQKINSMFNGEHINSTENRSVLHVALRASKDATI  106



>ref|XP_007151167.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23161.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=568

 Score =   167 bits (424),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC++QPWK+L+ H +++  +HLR+L+SD +R +SM+VEFDGILLDYSRQ ATLE
Sbjct  1    MASSTLICDTQPWKELEAHAEDVKKSHLRDLLSDDERSRSMVVEFDGILLDYSRQLATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAE A +KEKINRM++GEHINSTENRSVLHVALRA  DAVI
Sbjct  61   TKEKLFKLAEVASVKEKINRMYNGEHINSTENRSVLHVALRAPRDAVI  108



>gb|EPS71211.1| glucose-6-phosphate isomerase [Genlisea aurea]
Length=569

 Score =   167 bits (423),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+TLICE++PWKDL+ H+D++  THLR L+ D  R +SM VEFD ILLDYSRQRATL+
Sbjct  1    MASTTLICETEPWKDLRAHVDDLKRTHLRELLKDDKRSESMTVEFDKILLDYSRQRATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL +LAEAAHLKEKI+RMF+GE IN+TENRSVLHVALRA  D+VI
Sbjct  61   TLEKLNNLAEAAHLKEKIDRMFNGERINTTENRSVLHVALRAPRDSVI  108



>ref|XP_003554193.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Glycine 
max]
Length=568

 Score =   164 bits (415),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC++Q WK+LK H +++  THLR+L+SD +R +SM+VEFDGILLDYSRQ+ATLE
Sbjct  1    MASSTLICDTQQWKELKAHAEDVEKTHLRDLLSDDERSQSMVVEFDGILLDYSRQQATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAE A LK+KIN+M++GE+INSTENRSVLHVALRA  DAVI
Sbjct  61   TREKLFKLAEVASLKQKINQMYNGEYINSTENRSVLHVALRAPRDAVI  108



>ref|XP_004152701.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 ref|XP_004160034.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 gb|KGN62593.1| hypothetical protein Csa_2G361580 [Cucumis sativus]
Length=566

 Score =   164 bits (414),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   STLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIK  255
            ++LI ++  WK+LK H+++IN THLR+LMSDA RC S+MVE+DGILLDYSRQRAT +TI 
Sbjct  2    ASLISDTDAWKNLKAHVEDINKTHLRDLMSDAARCNSLMVEYDGILLDYSRQRATSDTIG  61

Query  256  KLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            KL  LAEAA+LKEKINRM++GEHINSTENR+VLHVALRA  DA I
Sbjct  62   KLFKLAEAANLKEKINRMYNGEHINSTENRAVLHVALRAPRDATI  106



>ref|XP_008444704.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444705.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444706.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
Length=566

 Score =   161 bits (407),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 73/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   STLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIK  255
            ++LI ++  WK+LK H+++IN THLR+LMSDA RC S+MVE+DGILLDYSRQR   +TI 
Sbjct  2    ASLISDTDAWKNLKAHVEDINKTHLRDLMSDAARCNSLMVEYDGILLDYSRQRVNSDTIG  61

Query  256  KLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            KL  LAEAA+LKEKINRM++GEHINSTENR+VLHVALRA+ DA I
Sbjct  62   KLFKLAEAANLKEKINRMYNGEHINSTENRAVLHVALRAARDATI  106



>ref|XP_004981572.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Setaria 
italica]
Length=567

 Score =   160 bits (406),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LIC+++ WK L+ H+  I  THLR+LM+DADRCK+M  E++GI LDYSRQ+AT E
Sbjct  1    MASPALICDTEQWKALQAHVGAIQKTHLRDLMADADRCKAMTAEYEGIFLDYSRQQATSE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI+KLL LAEAA LKEKI +MF GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TIEKLLKLAEAAKLKEKIEKMFKGEKINSTENRSVLHVALRAPRDAVI  108



>gb|EEC80343.1| hypothetical protein OsI_22416 [Oryza sativa Indica Group]
Length=682

 Score =   160 bits (406),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   RSSLFSDIFILK*LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEF  201
            + S+F   F++    MASS LIC+++ WK L+ H+  I  THLRNLM DA+RCK+M  E+
Sbjct  37   KYSIFQSFFMVA--VMASSALICDTEQWKGLQAHVGAIQKTHLRNLMDDAERCKAMTAEY  94

Query  202  DGILLDYSRQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXD  381
            +GI LDYSRQRAT ET++KL  LAEAA LKEKI +MFSG+ INSTENRSVLHVALRA  D
Sbjct  95   EGIFLDYSRQRATGETMEKLFKLAEAAKLKEKIEKMFSGDKINSTENRSVLHVALRAPRD  154

Query  382  AVI  390
             VI
Sbjct  155  EVI  157



>gb|ADI24331.1| glucose-6-phosphate isomerase [Miscanthus sinensis]
Length=427

 Score =   158 bits (399),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LIC+++ WK L+ H+  I  THLR+LM+DADRCK+M  E++GI LDYSRQ+AT E
Sbjct  1    MASPALICDTEQWKALQAHVGAIQKTHLRDLMADADRCKAMTAEYEGIFLDYSRQQATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KLL LAE A LKEKI +MF GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLLKLAEVAKLKEKIEKMFKGEKINSTENRSVLHVALRAPRDAVI  108



>gb|AIY55209.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia bottae]
Length=177

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I +THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKTTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+ M++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDSMYNGDHINSTENRSVLHVALRAPRNSAI  108



>sp|P54237.1|G6PI1_CLAMI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia mildrediae]
 emb|CAA61569.1| glucose-6-phosphate isomerase [Clarkia mildrediae]
Length=568

 Score =   160 bits (404),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A  +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQAIPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TIKKL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  D+ I
Sbjct  61   TIKKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRDSAI  108



>emb|CAD79579.1| cytosolic phosphoglucose isomerase, partial [Oenothera toumeyi]
Length=501

 Score =   158 bits (400),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM DA+RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHVEGIKRTHLRELMGDAERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSTI  108



>gb|AIY55230.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia mosquinii]
Length=330

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS TLI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A  +
Sbjct  1    MASPTLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQAIPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|KCW67833.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=566

 Score =   159 bits (402),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E+QPW DLKGH+++I  THLR LM+DA+RC+SMMVEFD ILLDYSRQRATL+
Sbjct  1    MASPALISETQPWNDLKGHVEDIKRTHLRELMADAERCRSMMVEFDNILLDYSRQRATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KLL+LAEAA LK+KI+RM++GE INSTENR+VLHVALRA  DAVI
Sbjct  61   TIDKLLALAEAASLKQKIDRMYNGERINSTENRTVLHVALRAPRDAVI  108



>ref|XP_010060937.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 ref|XP_010060938.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 gb|KCW67834.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
 gb|KCW67835.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=568

 Score =   159 bits (401),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E+QPW DLKGH+++I  THLR LM+DA+RC+SMMVEFD ILLDYSRQRATL+
Sbjct  1    MASPALISETQPWNDLKGHVEDIKRTHLRELMADAERCRSMMVEFDNILLDYSRQRATLD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KLL+LAEAA LK+KI+RM++GE INSTENR+VLHVALRA  DAVI
Sbjct  61   TIDKLLALAEAASLKQKIDRMYNGERINSTENRTVLHVALRAPRDAVI  108



>emb|CAD24789.1| cytosolic phosphoglucose isomerase, partial [Clarkia dudleyana]
Length=380

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I +THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKTTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>emb|CAD24788.1| cytosolic phosphoglucose isomerase, partial [Clarkia heterandra]
Length=559

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ TLI E++ WKDLK H+D I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPTLISETEAWKDLKAHLDGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+R+++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLAEAAHLKQKIDRVYNGDHINSTENRSVLHVALRAPRNSAI  108



>dbj|BAA23176.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA23179.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23184.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA23181.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23183.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA23185.2| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>sp|P54243.1|G6PI_OENME RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Oenothera sinuata 
var. hirsuta]
 emb|CAA61577.1| glucose-6-phosphate isomerase [Oenothera sinuata var. hirsuta]
Length=568

 Score =   158 bits (399),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H+++I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHVEDIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>dbj|BAA23182.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   157 bits (398),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA23177.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23178.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   157 bits (398),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA23180.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   157 bits (398),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+STLICE+  WKDL  H++EI  THLR+LM D+DRCKSM+ EFDGI+LDYSRQR    
Sbjct  1    MATSTLICETPQWKDLNDHVEEIKKTHLRDLMQDSDRCKSMITEFDGIILDYSRQRVLPA  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAE A LK+KI+RM++GE IN TENRSVLH+ALRA+ D  I
Sbjct  61   TVEKLFQLAEVACLKQKIDRMYNGEKINCTENRSVLHIALRAARDKAI  108



>dbj|BAA08149.1| phosphoglucose isomerase (Pgi-b) [Oryza sativa]
Length=568

 Score =   157 bits (397),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+  I  THLR+LM DA+RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGAIQKTHLRDLMDDAERCKAMTAEYEGIFLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MFSG+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFSGDKINSTENRSVLHVALRAPRDEVI  108



>ref|NP_001105368.1| glucose-6-phosphate isomerase, cytosolic [Zea mays]
 sp|P49105.1|G6PI_MAIZE RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Zea mays]
 gb|AAA82734.1| glucose-6 phosphate isomerase [Zea mays]
 gb|ACF87923.1| unknown [Zea mays]
 gb|ACG35658.1| glucose-6-phosphate isomerase, cytosolic B [Zea mays]
 gb|ACN30887.1| unknown [Zea mays]
Length=567

 Score =   157 bits (397),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS+ LIC ++ WK L+ H+  I  THLR+LM+DADRCK+M  E++GI LDYSRQ+AT E
Sbjct  1    MASAALICGTEQWKALQAHVGAIQKTHLRDLMADADRCKAMTAEYEGIFLDYSRQQATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KLL LA+AA LKEKI +MF GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TMEKLLKLADAAKLKEKIEKMFKGEKINSTENRSVLHVALRAPRDAVI  108



>sp|P54242.1|G6PI2_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56694.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61567.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=569

 Score =   157 bits (397),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ +LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPSLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLAEAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>ref|NP_001057316.1| Os06g0256500 [Oryza sativa Japonica Group]
 sp|P42863.2|G6PIB_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic B; Short=GPI-B; 
AltName: Full=Phosphoglucose isomerase B; Short=PGI-B; 
AltName: Full=Phosphohexose isomerase B; Short=PHI-B [Oryza 
sativa Japonica Group]
 dbj|BAD46305.1| glucose-6-phosphate isomerase b [Oryza sativa Japonica Group]
 dbj|BAF19230.1| Os06g0256500 [Oryza sativa Japonica Group]
 dbj|BAG90817.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65472.1| hypothetical protein OsJ_20863 [Oryza sativa Japonica Group]
 gb|AGT38453.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   157 bits (396),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+  I  THLR+LM DA+RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGAIQKTHLRDLMDDAERCKAMTAEYEGIFLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MFSG+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFSGDKINSTENRSVLHVALRAPRDEVI  108



>sp|P29333.1|G6PI2_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2A; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA45616.1| glucose-6-phosphate isomerase [Clarkia lewisii]
 emb|CAA61565.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   157 bits (396),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLAEAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>emb|CAC86121.1| cytosolic phosphoglucose isomerase, partial [Clarkia modesta]
Length=501

 Score =   156 bits (394),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H+++I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEDIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HIN+TENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSAI  108



>emb|CAD24787.1| cytosolic phosphoglucose isomerase, partial [Clarkia heterandra]
Length=499

 Score =   156 bits (394),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|AIY55210.1| cytosolic phosphoglucose isomerase C2, partial [Clarkia bottae]
Length=330

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+S+LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATSSLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAE AHLK+KI++M++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLAEEAHLKQKIDQMYNGDHINSTENRSVLHVALRAPRNSAI  108



>sp|P54234.1|G6PI1_CLAAR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia arcuata]
 emb|CAA61575.1| glucose-6-phosphate isomerase [Clarkia arcuata]
Length=568

 Score =   156 bits (394),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASSD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|AIY55212.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia dudleyana]
Length=499

 Score =   155 bits (392),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I +THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKTTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T  KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TFSKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>sp|P54235.1|G6PI1_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61570.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   155 bits (393),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKSHLEGIKKTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+ AHLK+KI+RM++G+HINSTENRSVLHVALRAS ++ I
Sbjct  61   TISKLYKLADEAHLKQKIDRMYNGDHINSTENRSVLHVALRASRNSAI  108



>gb|AIY55204.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia pulchella]
Length=330

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKKTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+ M++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDGMYNGDHINSTENRSVLHVALRAPRNSAI  108



>emb|CAD24790.1| cytosolic phosphoglucose isomerase, partial [Clarkia dudleyana]
Length=380

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ +LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A  +
Sbjct  1    MATPSLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQAAPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA   + I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRSSAI  108



>gb|AGT38452.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   155 bits (392),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+ EI  THLR+LM D +RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGEIQKTHLRHLMHDVERCKAMTAEYEGIYLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MF G+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVI  108



>emb|CAD24783.1| cytosolic phosphoglucose isomerase, partial [Clarkia lingulata]
Length=499

 Score =   154 bits (390),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HIN+TENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSAI  108



>ref|NP_001051434.1| Os03g0776000 [Oryza sativa Japonica Group]
 sp|P42862.2|G6PIA_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic A; Short=GPI-A; 
AltName: Full=Phosphoglucose isomerase A; Short=PGI-A; 
AltName: Full=Phosphohexose isomerase A; Short=PHI-A [Oryza 
sativa Japonica Group]
 gb|AAN65024.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa Japonica Group]
 gb|ABF99131.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99132.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13348.1| Os03g0776000 [Oryza sativa Japonica Group]
 gb|EEE60024.1| hypothetical protein OsJ_12779 [Oryza sativa Japonica Group]
Length=567

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+ EI  THLR+LM D +RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGEIQKTHLRHLMHDVERCKAMTAEYEGIYLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MF G+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVI  108



>sp|P34796.1|G6PI1_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1A; Short=GPI; 
AltName: Full=PGI2; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA50402.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
 emb|CAA61564.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HIN+TENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSAI  108



>gb|EEC76262.1| hypothetical protein OsI_13718 [Oryza sativa Indica Group]
Length=567

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+ EI  THLR+LM D +RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGEIQKTHLRHLMHDVERCKAMTAEYEGIYLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MF G+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVI  108



>dbj|BAA08148.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa]
Length=567

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ WK L+ H+ EI  THLR+LM D +RCK+M  E++GI LDYSRQRAT E
Sbjct  1    MASSALICDTEQWKGLQAHVGEIQKTHLRHLMHDVERCKAMTAEYEGIYLDYSRQRATGE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LAEAA LKEKI +MF G+ INSTENRSVLHVALRA  D VI
Sbjct  61   TMEKLFKLAEAAKLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVI  108



>sp|P54241.1|G6PI2_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61571.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ +LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPSLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLFKLADAAHLKRKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>ref|XP_003569006.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brachypodium 
distachyon]
Length=567

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LIC+++ WK L+ H+  I  THLR+LM+DA RCK+M  EF+GI LDYSRQ+ T+E
Sbjct  1    MASPALICDTEQWKALQAHVGAIQKTHLRDLMTDAGRCKAMTAEFEGIFLDYSRQQGTVE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI +MF GE IN+TENRSVLHVALRA  DAVI
Sbjct  61   TMDKLFKLAEAAKLKEKIEKMFKGEKINTTENRSVLHVALRAPRDAVI  108



>sp|P54236.1|G6PI1_CLAFR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia franciscana]
 emb|CAA61576.1| glucose-6-phosphate isomerase [Clarkia franciscana]
Length=568

 Score =   155 bits (391),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I +THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKTTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HIN TENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINITENRSVLHVALRAPRNSAI  108



>gb|AIY55208.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia bottae]
Length=499

 Score =   154 bits (389),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I +THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKTTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+ M++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDSMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|EMT10058.1| Glucose-6-phosphate isomerase, cytosolic [Aegilops tauschii]
Length=567

 Score =   154 bits (390),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDYSRQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMTDADRCKAMTAEFEGVYLDYSRQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LKEKI++MF GE IN+TENRSVLHVALRA  DAVI
Sbjct  61   TIDKLFKLAEAAKLKEKIDKMFKGEKINTTENRSVLHVALRAPRDAVI  108



>gb|ABE41790.1| glucose-6-phosphate isomerase [Triticum aestivum]
Length=567

 Score =   154 bits (390),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDYSRQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMTDADRCKAMTAEFEGVFLDYSRQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI++MF GE IN+TENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAEAAKLKEKIDKMFKGEKINTTENRSVLHVALRAPRDAVI  108



>emb|CAC86124.1| cytosolic phosphoglucose isomerase, partial [Clarkia unguiculata]
Length=380

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ +LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPSLISETETWKDLKAHLEGIKKTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+ AHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADEAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|ABE41789.1| glucose-6-phosphate isomerase [Hordeum vulgare]
 dbj|BAJ88324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=567

 Score =   154 bits (390),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDY+RQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGVFLDYARQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI++MF GE INSTENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAEAAKLKEKIDKMFKGEKINSTENRSVLHVALRAPRDAVI  108



>emb|CAC82578.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   154 bits (390),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HIN+TENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSSI  108



>emb|CAC86123.1| cytosolic phosphoglucose isomerase, partial [Clarkia unguiculata]
Length=501

 Score =   154 bits (388),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AA+LK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAYLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>emb|CAB55566.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=568

 Score =   154 bits (389),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL +LA+AAHLK+KI+RM++G+HIN TENRSVLHVALRA  ++ I
Sbjct  61   TINKLYNLADAAHLKQKIDRMYNGDHINITENRSVLHVALRAPRNSAI  108



>sp|P54240.1|G6PI1_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56693.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61566.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=568

 Score =   154 bits (388),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I   HLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMIHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|AIY55211.1| cytosolic phosphoglucose isomerase C1, partial [Clarkia imbricata]
Length=499

 Score =   153 bits (386),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMM+EFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMLEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  +  I
Sbjct  61   TISKLYRLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNLAI  108



>gb|AED99454.1| PgiC protein [Festuca ovina]
Length=567

 Score =   153 bits (387),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+GI LDYSRQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGIYLDYSRQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAA LKEKI +MF+G  INSTENRSVLHVALRA  DAVI
Sbjct  61   TIDKLFKLAEAAKLKEKIEKMFNGNKINSTENRSVLHVALRAPRDAVI  108



>emb|CAC86122.1| cytosolic phosphoglucose isomerase [Clarkia modesta]
Length=569

 Score =   153 bits (387),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+ +LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPSLISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G++INSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDNINSTENRSVLHVALRAPRNSAI  108



>emb|CAD24791.1| cytosolic phosphoglucose isomerase, partial [Clarkia dudleyana]
Length=380

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR  M D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRESMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>sp|P54238.1|G6PI1_CLARO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia rostrata]
 emb|CAA61572.1| glucose-6-phosphate isomerase [Clarkia rostrata]
Length=570

 Score =   153 bits (386),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+ AHLK+KI+RM++G+HIN+TENRSVLHVALRA  ++ I
Sbjct  61   TISKLYKLADEAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSAI  108



>gb|EMS52088.1| Glucose-6-phosphate isomerase, cytosolic [Triticum urartu]
Length=567

 Score =   153 bits (386),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDYSRQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMTDADRCKAMTAEFEGVFLDYSRQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAE A LKEKI++MF GE IN+TENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAETAKLKEKIDKMFKGEKINTTENRSVLHVALRAPRDAVI  108



>gb|AED99455.1| PgiC2-3 protein [Festuca ovina]
Length=567

 Score =   152 bits (385),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDY+RQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGVFLDYARQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI +MF+G+ INSTENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAEAAKLKEKIEKMFNGDKINSTENRSVLHVALRAPRDAVI  108



>gb|AED99453.1| PgiC protein [Poa palustris]
Length=567

 Score =   152 bits (385),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDY+RQ+AT E
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGVFLDYARQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI +MF+G+ INSTENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAEAAKLKEKIEKMFNGDKINSTENRSVLHVALRAPRDAVI  108



>gb|AIY55205.1| cytosolic phosphoglucose isomerase C2, partial [Clarkia pulchella]
Length=330

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR+LM D++RC+SMMVEFD + LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRDLMGDSERCRSMMVEFDKLFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+ IN+TENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDRINTTENRSVLHVALRAPRNSAI  108



>gb|AIY55213.1| cytosolic phosphoglucose isomerase C2, partial [Clarkia dudleyana]
Length=499

 Score =   151 bits (382),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR  M D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRESMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+RM++G+HINSTENRSVLHVALRA   + I
Sbjct  61   TINKLYKLADAAHLKQKIDRMYNGDHINSTENRSVLHVALRAPRSSAI  108



>ref|XP_006651865.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic B-like [Oryza 
brachyantha]
Length=907

 Score =   154 bits (389),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASS LIC+++ W+ L+ H+  I  THLR+LM DA+RC +M  E++GI LDYSRQRAT+E
Sbjct  341  MASSALICDTEQWRGLQAHVGAIQKTHLRDLMHDAERCTAMTAEYEGIFLDYSRQRATVE  400

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA+LKEKI +MF G+ INSTENRSVLHVALRA  D VI
Sbjct  401  TMDKLFKLAEAANLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVI  448



>emb|CAC82579.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   151 bits (382),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR LM D +R +SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRELMGDTERSQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+RM +G+HINSTENRSVLHVALRA  ++VI
Sbjct  61   TINKLYKLAEAAHLKQKIDRMNNGDHINSTENRSVLHVALRAPRNSVI  108



>emb|CAC82580.1| cytosolic phosphoclucose isomerase, partial [Clarkia delicata]
Length=476

 Score =   150 bits (380),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR LM D +R +SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRELMGDTERSQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+RM +G+HINSTENRSVLHVALRA  ++VI
Sbjct  61   TINKLYKLAEAAHLKQKIDRMNNGDHINSTENRSVLHVALRAPRNSVI  108



>sp|P54239.1|G6PI1_CLAWI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia williamsonii]
 emb|CAA61574.1| glucose-6-phosphate isomerase [Clarkia williamsonii]
Length=568

 Score =   151 bits (381),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMM+EFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMLEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHLK+KI+ M++G+HINSTENRSVLHVALRA  +  I
Sbjct  61   TISKLYRLADAAHLKQKIDHMYNGDHINSTENRSVLHVALRAPRNLAI  108



>emb|CAB55567.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=569

 Score =   150 bits (380),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            M++  LI E++ WKDLK H+++I  THLR LM D +RC+SMMVEFD I L+YSRQ+A+ +
Sbjct  1    MSTPALISETEAWKDLKAHLEDIKRTHLRELMGDTERCQSMMVEFDNIFLNYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LA+AAHL +KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   TINKLYKLADAAHLNQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  108



>gb|EMS65017.1| Glucose-6-phosphate isomerase, cytosolic [Triticum urartu]
Length=249

 Score =   145 bits (365),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS   I ++  WK L+ H+  I+ THLR+LM+D DRCK+M  EF+G+ LDYSRQ AT E
Sbjct  1    MASPAHISDTDQWKALQAHVGAIHKTHLRDLMTDVDRCKAMTAEFEGVFLDYSRQHATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL +LAE A LKEKI++MF GE IN+ ENRSVLHVALRA  DAVI
Sbjct  61   TIDKLFNLAEGAKLKEKIDKMFKGEKINTIENRSVLHVALRAPRDAVI  108



>gb|AED99456.1| PgiC2-4 protein [Festuca ovina]
Length=561

 Score =   148 bits (374),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+  DY+RQ+AT +
Sbjct  1    MASPALISDTDQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGVFPDYARQQATTD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+ KL  LAEAA LKEKI +MF+G+ INSTENRSVLHVALRA  DAVI
Sbjct  61   TVDKLFKLAEAAKLKEKIEKMFNGDKINSTENRSVLHVALRAPRDAVI  108



>emb|CAD24784.1| cytosolic phosphoglucose isomerase, partial [Clarkia lingulata]
Length=499

 Score =   148 bits (373),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI +++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISDTEAWKDLKAHLEGIKHTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            TI KL  LAEAAHLK+KI+ M++G+HINSTE+RSVLHV LRA  ++ I
Sbjct  61   TINKLYKLAEAAHLKQKIDSMYNGDHINSTEHRSVLHVTLRAPRNSAI  108



>emb|CAD79580.1| cytosolic phosphoglucose isomerase, partial [Oenothera lindheimeri]
Length=491

 Score =   145 bits (367),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  103  WKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAA  282
            WKDLK H++ +  THLR LM D++RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AA
Sbjct  1    WKDLKAHVEGVKRTHLRELMGDSERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAA  60

Query  283  HLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            HLK+KI+RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  61   HLKQKIDRMYNGDHINSTENRSVLHVALRAPRNSAI  96



>gb|ABB90111.1| phosphoglucoisomerase [Festuca ovina]
Length=552

 Score =   144 bits (364),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  94   SQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLA  273
            ++ WK L+ H+  I+ THLR+LM+DADRCK+M  EF+G+ LDY+RQ+AT ET+ KL  LA
Sbjct  1    TEQWKALQAHVGAIHKTHLRDLMADADRCKAMTAEFEGVFLDYARQQATTETVDKLFKLA  60

Query  274  EAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            EAA LKEKI +MF+G+ INSTENRSVLHVALRA  DAVI
Sbjct  61   EAAKLKEKIEKMFNGDKINSTENRSVLHVALRAPRDAVI  99



>gb|ACY82426.1| PgiC, partial [Fuchsia boliviana]
Length=153

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  +HLR LM D +RC+S+M+EFD I LDYSRQ+A+L+TI KL  LA+AAHLK+KI
Sbjct  2    HLEGIKRSHLRELMGDTERCQSLMIEFDNIFLDYSRQQASLDTISKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM+SG+HINSTENRSVLHVALRA  DAVI
Sbjct  62   DRMYSGDHINSTENRSVLHVALRAPRDAVI  91



>gb|ACY82424.1| PgiC, partial [Ludwigia uruguayensis]
Length=153

 Score =   135 bits (340),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H+++I  THLR LMSD DRC+SM VEFD I LDYSRQ+A+L+TI KL  LA  A LKEKI
Sbjct  2    HVEDIRKTHLRELMSDTDRCQSMTVEFDNIFLDYSRQQASLDTIDKLHKLAGEACLKEKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            NRMF G+HINSTENRSVLHVALRA  DAVI
Sbjct  62   NRMFDGDHINSTENRSVLHVALRAPRDAVI  91



>ref|XP_001778143.1| predicted protein [Physcomitrella patens]
 gb|EDQ57033.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   142 bits (359),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   EMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            E  S   I +S  WK L+ H+ EI  THLR LM D  RCKSM+ E DGI++DYSRQRATL
Sbjct  20   EHVSRKAISDSLAWKQLQQHMSEIKKTHLRELMKDEQRCKSMIKEVDGIVVDYSRQRATL  79

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ET++KLLSLAE A L EKIN M+SG+HIN+TE+R+VLHVALRA  DA I
Sbjct  80   ETVEKLLSLAEEAKLSEKINAMWSGKHINATEDRAVLHVALRAPRDAEI  128



>gb|ACY82425.1| PgiC, partial [Chamerion angustifolium]
Length=153

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM D +RCK+MMVEFD I LDYSRQ+A+ +TIKKL  LA+AAHLK+KI
Sbjct  2    HLEGIKKTHLRELMGDTERCKAMMVEFDNIFLDYSRQQASPDTIKKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82429.1| PgiC, partial [Chylismia arenaria]
Length=153

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I STHLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HLEGIKSTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>ref|XP_002975871.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
 gb|EFJ22776.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
Length=562

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA++ LI ES+ W DLK H+ EIN THLR L++D  RC+ M+ E DGIL+D+SRQRAT +
Sbjct  1    MAATGLISESEAWIDLKDHVAEINKTHLRELLTDTSRCEGMIKEHDGILIDFSRQRATQK  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            T++KL SL++ A L+EKI +MF GEHINSTE+R+VLHVALRA
Sbjct  61   TMEKLFSLSKVAKLEEKIKKMFIGEHINSTEDRAVLHVALRA  102



>gb|ACY82439.1| PgiC, partial [Oenothera drummondii]
 gb|ACY82442.1| PgiC, partial [Oenothera grandis]
 gb|ACY82447.1| PgiC, partial [Oenothera laciniata]
Length=153

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H+++I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEDIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>ref|XP_002968611.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
 gb|EFJ30865.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
Length=564

 Score =   139 bits (351),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA++ LI ES+ W DLK H+ EIN THLR L++D  RC+ M+ E DGIL+D+SRQRAT +
Sbjct  1    MAATGLISESEAWIDLKDHVAEINKTHLRELLTDTSRCEGMIKEHDGILIDFSRQRATQK  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            T++KL SL++ A L+EKI +MF GEHINSTE+R+VLHVALRA
Sbjct  61   TMEKLFSLSKEAKLEEKIKKMFIGEHINSTEDRAVLHVALRA  102



>gb|ACY82432.1| PgiC, partial [Oenothera acaulis]
Length=153

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82434.1| PgiC, partial [Oenothera affinis]
 gb|ACY82435.1| PgiC, partial [Oenothera argillicola]
 gb|ACY82437.1| PgiC, partial [Oenothera biennis]
 gb|ACY82438.1| PgiC, partial [Oenothera clelandii]
 gb|ACY82440.1| PgiC, partial [Oenothera elata subsp. hookeri]
 gb|ACY82441.1| PgiC, partial [Oenothera glazioviana]
 gb|ACY82443.1| PgiC, partial [Oenothera grandiflora]
 gb|ACY82444.1| PgiC, partial [Oenothera heterophylla]
 gb|ACY82448.1| PgiC, partial [Oenothera longissima]
 gb|ACY82449.1| PgiC, partial [Oenothera longituba]
 gb|ACY82450.1| PgiC, partial [Oenothera mendocinensis]
 gb|ACY82451.1| PgiC, partial [Oenothera nana]
 gb|ACY82452.1| PgiC, partial [Oenothera nutans]
 gb|ACY82453.1| PgiC, partial [Oenothera oakesiana]
 gb|ACY82455.1| PgiC, partial [Oenothera picensis subsp. picensis]
 gb|ACY82456.1| PgiC, partial [Oenothera elongata]
 gb|ACY82457.1| PgiC, partial [Oenothera ravenii subsp. chilensis]
 gb|ACY82458.1| PgiC, partial [Oenothera recurva]
 gb|ACY82459.1| PgiC, partial [Oenothera rhombipetala]
 gb|ACY82460.1| PgiC, partial [Oenothera sandiana]
 gb|ACY82462.1| PgiC, partial [Oenothera tarijensis]
 gb|ACY82463.1| PgiC, partial [Oenothera versicolor]
 gb|ACY82464.1| PgiC, partial [Oenothera villaricae]
 gb|ACY82465.1| PgiC, partial [Oenothera villosa subsp. villosa]
Length=153

 Score =   131 bits (330),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82430.1| PgiC, partial [Oenothera gaura]
Length=153

 Score =   131 bits (330),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ +  THLR LM D++RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEGVKRTHLRELMGDSERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82433.1| PgiC, partial [Oenothera acutissima]
Length=153

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALR   ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRVPRNSAI  91



>gb|ACY82445.1| PgiC, partial [Oenothera humifusa]
Length=153

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+ + +TI KL  LA+AAHLK+KI
Sbjct  2    HVEXIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQXSPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82461.1| PgiC, partial [Oenothera stricta subsp. stricta]
Length=153

 Score =   129 bits (325),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++    THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HVEGXKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ACY82431.1| PgiC, partial [Gayophytum eriospermum]
Length=153

 Score =   129 bits (323),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  THLR LM + +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI
Sbjct  2    HLEGIKKTHLRELMGNTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ +
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAV  91



>ref|XP_001760206.1| predicted protein [Physcomitrella patens]
 gb|EDQ74962.1| predicted protein [Physcomitrella patens]
Length=571

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA  T I +S  WK L+GH+++IN THLR+L+ D  RC+ M+ E DGI+ DYSRQRAT E
Sbjct  1    MAKGT-IADSAAWKKLQGHVEDINKTHLRDLLKDEKRCQGMIKEVDGIVFDYSRQRATAE  59

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++ LLSLA+AA L EKI  M+SG+ IN TE+R+VLHVALRA  DA I
Sbjct  60   TVEGLLSLAQAAKLSEKIEAMWSGQRINETEDRAVLHVALRAPRDAEI  107



>gb|ACY82446.1| PgiC, partial [Oenothera kunthiana]
Length=153

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++ I  +HLR LM D +RC+SMMVE D I LDYSRQ+AT +TI KL  LA+AAHLK+KI
Sbjct  2    HLEGIKRSHLRELMGDTERCQSMMVEXDNIFLDYSRQQATPDTINKLYKLADAAHLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>ref|XP_001754629.1| predicted protein [Physcomitrella patens]
 gb|EDQ80599.1| predicted protein, partial [Physcomitrella patens]
Length=575

 Score =   134 bits (337),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  76   STLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIK  255
            S LI  +  W+DL+ H+DEI   HL++LM D +RCKSM+ EF+GI+LDYSRQRAT  T +
Sbjct  1    SGLISNTDAWRDLQDHVDEIFGMHLKDLMQDRERCKSMIKEFNGIVLDYSRQRATQCTFQ  60

Query  256  KLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            KLL+LA+ A++KEKI  MFSG HIN TENR VLH+ALRA
Sbjct  61   KLLALAKEANVKEKIEAMFSGVHINKTENRPVLHIALRA  99



>gb|KHN34179.1| Glucose-6-phosphate isomerase, cytosolic 1 [Glycine soja]
Length=552

 Score =   133 bits (335),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 16/108 (15%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MASSTLIC++Q WK+LK H +++  THLR+L+SD +R +SM+VEFDGILLDYSRQ+ATLE
Sbjct  1    MASSTLICDTQQWKELKAHAEDVEKTHLRDLLSDDERSQSMVVEFDGILLDYSRQQATLE  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T +KL  LAE                INSTENRSVLHVALRA  DAVI
Sbjct  61   TREKLFKLAE----------------INSTENRSVLHVALRAPRDAVI  92



>gb|ACY82436.1| PgiC, partial [Oenothera bahia-blancae]
 gb|ACY82454.1| PgiC, partial [Oenothera parodiana]
Length=153

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  HIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKI  300
            H++    THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +TI KL  LA+AA LK+KI
Sbjct  2    HVEGXKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPDTINKLYKLADAAXLKQKI  61

Query  301  NRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +RM++G+HINSTENRSVLHVALRA  ++ I
Sbjct  62   DRMYNGDHINSTENRSVLHVALRAPRNSAI  91



>gb|ABK00059.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=614

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I ES  W DLK H+  I  THLRNLM D +RC+ ++ E+DGI++D SRQR   +T+ KLL
Sbjct  45   ISESAAWADLKQHVKTIEGTHLRNLMQDNNRCEELIKEYDGIVVDLSRQRVIHDTVDKLL  104

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +LAE A LKEKI++MF G HIN TENRSVLH ALRA  D VI
Sbjct  105  NLAEEAKLKEKIDQMFDGVHINETENRSVLHAALRAPRDEVI  146



>gb|ABK00065.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=653

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I ES  W DLK H+  I  THLRNLM D +RC+ ++ E+DGI++D SRQR   +T+ KLL
Sbjct  84   ISESAAWADLKQHVKTIEGTHLRNLMQDNNRCEELIKEYDGIVVDLSRQRVIHDTVDKLL  143

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +LAE A LKEKI++MF G HIN TENRSVLH ALRA  D VI
Sbjct  144  NLAEEAKLKEKIDQMFDGVHINETENRSVLHAALRAPRDEVI  185



>ref|XP_007017512.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
 gb|EOY14737.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
Length=537

 Score =   131 bits (329),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  MSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTE  339
            M+D +RC+SMMVEFDG+LLDYSRQRATLET+ KL  LAEAA LK+ INRM+SGEHINSTE
Sbjct  1    MNDKERCQSMMVEFDGMLLDYSRQRATLETMDKLDKLAEAASLKQHINRMYSGEHINSTE  60

Query  340  NRSVLHVALRASXDAVI  390
            NRSVLHVALRA  DAVI
Sbjct  61   NRSVLHVALRAPRDAVI  77



>ref|XP_001782795.1| predicted protein [Physcomitrella patens]
 gb|EDQ52372.1| predicted protein [Physcomitrella patens]
Length=577

 Score =   130 bits (327),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  61   LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRAT  240
            LE  S   I E+  WK L  H+ EI  THLR LM D  RC+SM+ E DGI++DYSRQR T
Sbjct  17   LEHVSGLAISETAAWKQLHQHVGEIKKTHLRELMKDEQRCQSMIKEVDGIVVDYSRQRVT  76

Query  241  LETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
              T++KLLSLA  A L EKI+ M+SG+HINSTE+R+VLH ALRA  +A I
Sbjct  77   TGTMEKLLSLANEAKLSEKIDAMWSGKHINSTEDRAVLHCALRAPREAEI  126



>ref|XP_002509192.1| phosphoglucose isomerase [Micromonas sp. RCC299]
 gb|ACO70450.1| phosphoglucose isomerase [Micromonas sp. RCC299]
Length=598

 Score =   129 bits (324),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  73   SSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETI  252
            +  LI  +  WKDL  H +EI+ THLR+L+ D  RC+++ VE++G+  DY+RQR T ET+
Sbjct  15   APALISTTDAWKDLAAHKEEIDKTHLRDLIEDQKRCEALTVEYNGVYCDYARQRVTEETM  74

Query  253  KKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             KL  LA+ A+LK KIN MFSGEHINSTE+R+VLHVA RA  + VI
Sbjct  75   TKLYELADEANLKGKINAMFSGEHINSTEDRAVLHVATRAPRNKVI  120



>ref|XP_002967787.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
 gb|EFJ31134.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
Length=1477

 Score =   130 bits (326),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I +++ W++LK H+ EI+  HL++L+ D  RC+SMM E+DGI LD+SRQRAT +T +KL 
Sbjct  893  IVDTKAWQELKSHVGEISKLHLKDLLGDKARCESMMKEYDGIALDFSRQRATQDTFQKLF  952

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             LA+   LK+KI+RMF G+HINSTE+R VLHVALRA  +A+I
Sbjct  953  QLAKEMKLKDKIDRMFGGDHINSTEDRPVLHVALRAPREALI  994



>ref|XP_003082100.1| cytosolic phosphoglucose isomerase (ISS) [Ostreococcus tauri]
Length=590

 Score =   126 bits (316),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            M +  LI  ++ W+ L+ H++ I+ THLR+L+ D  RC ++ +E+DG+  D++RQR T E
Sbjct  5    MEAKALISSTEEWRALRSHVEAIDKTHLRDLIRDEARCDALALEYDGLYCDFARQRVTTE  64

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LA AA ++EK+N MF+GE INSTENR+VLHVA RA  D VI
Sbjct  65   TMEKLYDLARAAGVREKVNAMFNGEAINSTENRAVLHVATRAPKDKVI  112



>emb|CEF99714.1| Phosphoglucose isomerase, C-terminal [Ostreococcus tauri]
Length=628

 Score =   126 bits (317),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            M +  LI  ++ W+ L+ H++ I+ THLR+L+ D  RC ++ +E+DG+  D++RQR T E
Sbjct  43   MEAKALISSTEEWRALRSHVEAIDKTHLRDLIRDEARCDALALEYDGLYCDFARQRVTTE  102

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T++KL  LA AA ++EK+N MF+GE INSTENR+VLHVA RA  D VI
Sbjct  103  TMEKLYDLARAAGVREKVNAMFNGEAINSTENRAVLHVATRAPKDKVI  150



>gb|ABK00069.1| cytosolic glucose-6-phosphate isomerase [Chara vulgaris]
Length=561

 Score =   122 bits (305),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +1

Query  73   SSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETI  252
            +S+LI +S  WK L+ HI  IN  HLR+L++D  R  S++ E +G +LD SRQR T ET+
Sbjct  2    ASSLISDSAAWKALEDHIPAINQAHLRDLLADEGRSASLIKELNGTVLDLSRQRVTKETM  61

Query  253  KKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
              LL+LA+ A++KEKI +MF+GE IN TENR+VLHVALRA  D VI
Sbjct  62   DLLLNLAKEANVKEKITKMFAGERINKTENRAVLHVALRAPKDEVI  107



>ref|XP_009381882.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   122 bits (307),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 83/122 (68%), Gaps = 15/122 (12%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQ-----  231
            MAS+ LIC+S+PWKDLK H++ I   HLR+LM+D +RC+ MMV +D     Y  Q     
Sbjct  1    MASAALICDSEPWKDLKEHVNAIEKKHLRDLMNDVERCQLMMV-YDISFGIYRCQYRDRW  59

Query  232  --------RATLETIKKLLSLAE-AAHLKEKINRMFSGEHINSTENRSVLHVALRASXDA  384
                    R  L+TI KLL LAE AA L++KI+ M++G+HINSTENRSVLH+ALRA  D 
Sbjct  60   DTFGLFTARVRLDTIGKLLKLAEVAAQLRQKIDMMYNGDHINSTENRSVLHIALRAPRDK  119

Query  385  VI  390
            VI
Sbjct  120  VI  121



>ref|XP_007509641.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
 emb|CCO19444.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
Length=635

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  79   TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKK  258
            +LI  +  W  LK H+ +I  THLR+L+ D +RC+++ +E DG+ +DY+RQR T ET++K
Sbjct  54   SLISSTSEWNSLKEHVKDIEKTHLRDLLKDYNRCENLTLEHDGVYVDYARQRVTEETMEK  113

Query  259  LLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            L +LA A+ +KEKIN MFSGE +NSTENR+VLHVA RA    VI
Sbjct  114  LYALARASGVKEKINAMFSGEAMNSTENRAVLHVATRAPRSKVI  157



>ref|XP_001420367.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98660.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=590

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +1

Query  76   STLICESQPWKDLKGHI-DEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETI  252
            + LI  +  W+ LK H  +EI+ THLR+L++DA RC+ +++E DG+  D++RQR T +T+
Sbjct  7    TALISTTAEWRALKEHFANEIDKTHLRDLIADAKRCEELVIESDGVYCDFARQRVTHDTM  66

Query  253  KKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             KL  LA AA +KEKIN MF+GE INSTENR+VLHVA RA  D VI
Sbjct  67   TKLYDLARAAGVKEKINAMFNGEAINSTENRAVLHVATRAPKDKVI  112



>gb|KIZ06944.1| glucose-6-phosphate isomerase [Monoraphidium neglectum]
Length=580

 Score =   119 bits (298),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS   I +S  WK L+ H+ ++  THL++L+ D  RC++++ E  G+ +D+SRQR T E
Sbjct  1    MAS---ISDSPAWKALQEHVADVEQTHLKDLLRDQQRCEALIKEEGGLYIDFSRQRMTQE  57

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+K LL LAEA+ LK K   MFSGEHINSTE+R+VLHVA RA  D VI
Sbjct  58   TVKLLLDLAEASDLKAKTQAMFSGEHINSTEDRAVLHVATRARRDQVI  105



>gb|EMS63155.1| Glucose-6-phosphate isomerase, cytosolic [Triticum urartu]
Length=127

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI ++  WK L+ H+  I+ THLR+LM+D DRCK+M  EF+G+ LDYSRQ+AT E
Sbjct  1    MASPVLISDTDQWKALQAHVGAIHKTHLRDLMTDTDRCKAMTAEFEGVFLDYSRQQATTE  60

Query  247  TIKKLLSLAEAAHLKEKINRMF----SGEHINST  336
            TI KL  LAEAA LKEKI+++F    +G  I +T
Sbjct  61   TIDKLFKLAEAAKLKEKIDKLFKTFRTGSWIGAT  94



>ref|XP_005650466.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25922.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
Length=594

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  64   EMASSTL-ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRAT  240
            E+ +++L I ++  WK L+ H+ EI  THLR+L+ D  R  ++  EF+ I+ D+SRQR T
Sbjct  6    ELETASLQISQTPEWKALEDHVTEIEKTHLRDLLRDGHRSDTLFHEFNKIIADFSRQRVT  65

Query  241  LETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
             +T++ L +LAE A L+EKIN MF+GEHIN+TE+R+VLHVALR+
Sbjct  66   SKTLELLTNLAERAKLREKINAMFAGEHINTTEDRAVLHVALRS  109



>ref|XP_003061563.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54193.1| predicted protein [Micromonas pusilla CCMP1545]
Length=625

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEI-NSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKK  258
            LI  +  W  LK H +EI + THLR L++D +R +++  E++G+  D++RQR   ET++K
Sbjct  19   LISTTPEWDALKRHKEEIIDGTHLRELLNDEERNEALTAEYNGVYCDFARQRVVPETMEK  78

Query  259  LLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            L  LA AA LK+KIN MF GEHINSTE+R+VLHVA RA  D VI
Sbjct  79   LYDLANAAGLKDKINAMFEGEHINSTEDRAVLHVATRAPRDKVI  122



>gb|ACI29026.1| glucose-6-phosphate isomerase [Dunaliella salina]
Length=659

 Score =   113 bits (283),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I +++ WK L+ H+ EIN+THLR+L+ D  RC +++ E +GI  D SRQR T +T + L+
Sbjct  91   ISDTEEWKALQEHVKEINTTHLRDLLRDEGRCMNLIKESEGIYCDLSRQRITNKTSELLM  150

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             LA  A+LK+KI  MFSGEHINSTE+R+ LHVA RA  D  I
Sbjct  151  KLANKANLKDKIEAMFSGEHINSTEDRAALHVATRARRDQSI  192



>ref|XP_001703279.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
 gb|EDP05961.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
Length=646

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            L+ E   W+ LK H++EI  THLR+L+ D  RC S++ E +GI  D++RQR T +T++ L
Sbjct  74   LVSELPAWQALKEHVNEIEKTHLRDLLHDEARCMSLIKECEGIYGDFTRQRVTQKTLELL  133

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
              LAE ++L+ KIN MF+GEHINSTE+R+VLH+A RA  +  I
Sbjct  134  FELAEQSNLRGKINAMFNGEHINSTEDRAVLHIATRAHRNQKI  176



>ref|XP_005537531.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81495.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
Length=648

 Score =   112 bits (280),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            LI E+  W+ L  H  EI+  HLR LM D DR +S+  E+DGI LDYSRQR T +TI+ L
Sbjct  73   LISETAEWRRLVEHASEIDRLHLRELMQDVDRVRSLRAEYDGIYLDYSRQRVTKDTIELL  132

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDA  384
             +LA  A L +KI  M SG HIN TE R+VLH ALRA  +A
Sbjct  133  FALARRARLVDKIRAMQSGAHINVTERRAVLHTALRAERNA  173



>ref|XP_005851258.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
 gb|EFN59156.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
Length=521

 Score =   111 bits (277),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+S+LI +S+ W+ L+ H+  I  T LR L+ D  R ++M+ E  G+ LD+SRQ AT +
Sbjct  1    MAASSLISDSKEWRALQDHVGAIKQTQLRELLEDDARTEAMVREAGGVYLDFSRQNATPD  60

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            T+K LL LA AA +  KI  MF G HINSTE R+VLH ALRA   AV+
Sbjct  61   TLKLLLELAGAAGVGPKIQAMFGGAHINSTEGRAVLHTALRAPRGAVV  108



>ref|XP_005537536.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81500.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
Length=773

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            LI E+  W+ L  H  EI+  HLR LM D DR +S+  E+DGI LDYSRQR T +TI+ L
Sbjct  198  LISETAEWRRLVEHASEIDRLHLRELMQDVDRVRSLRAEYDGIYLDYSRQRVTKDTIELL  257

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDA  384
             +LA  A L +KI  M SG HIN TE R+VLH ALRA  +A
Sbjct  258  FALARRARLVDKIRAMQSGAHINVTERRAVLHTALRAERNA  298



>emb|CAC85674.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85675.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=74

 Score =   103 bits (256),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H+++I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEDIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHL  288
            TI KL  LA+AAHL
Sbjct  61   TISKLYKLADAAHL  74



>ref|XP_011399580.1| Glucose-6-phosphate isomerase, cytosolic B [Auxenochlorella protothecoides]
 gb|KFM26642.1| Glucose-6-phosphate isomerase, cytosolic B [Auxenochlorella protothecoides]
Length=531

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +1

Query  70   ASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLET  249
            A STLI  S  WK L+ H   +   HL++L+SD  R  ++  E +G+ LD +RQ AT ET
Sbjct  26   APSTLISSSPEWKALEAHAVAVQKLHLKDLLSDDARTTALTREAEGLYLDLARQNATPET  85

Query  250  IKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            ++ LL+LAE A +K KI+ MF+G+HIN+TE+R+VLHVALRA  + VI
Sbjct  86   LQLLLALAEKAGVKTKIDAMFAGQHINTTEDRAVLHVALRAKRNQVI  132



>emb|CBN74985.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   110 bits (274),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I E+  W  LK H   +   HLR++M D DRC ++  E DGILLDYSRQR T ET+  L 
Sbjct  3    IHETAAWAALKEHAASLQGAHLRDMMRDEDRCAALTAERDGILLDYSRQRVTNETMDMLF  62

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            +LAEAA L  K   MF+GE IN+TE R+V+H ALRA  +A +
Sbjct  63   NLAEAADLAGKRAAMFTGEKINNTEGRAVMHAALRAPREATM  104



>emb|CAC84507.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
 emb|CAC84510.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
 emb|CAC85672.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85673.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=74

 Score =   102 bits (253),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MAS  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MASPALISETEAWKDLKAHLEGIKMTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHL  288
            TI KL  LA+AAHL
Sbjct  61   TISKLYKLADAAHL  74



>ref|XP_002946940.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
 gb|EFJ52166.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
Length=584

 Score =   108 bits (270),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +1

Query  79   TLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKK  258
            +L+ E   W+ LK H+ +I  THLR+L+ D  RC +++ E +GI  D++RQR T  T++ 
Sbjct  11   SLVNELPAWQALKEHVGDIEKTHLRDLLHDEARCMALIKESEGIYCDFTRQRVTQRTLEL  70

Query  259  LLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            L  LAE + L+ KIN MF+GEHINSTE+R+VLHVA RA  +  I
Sbjct  71   LYELAEQSDLRGKINAMFNGEHINSTEDRAVLHVATRAHRNQKI  114



>emb|CAC85676.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85677.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=74

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR LM D +R +SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRELMGDTERSQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHL  288
            TI KL  LAEAAHL
Sbjct  61   TINKLYKLAEAAHL  74



>emb|CAC84513.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=74

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            MA+  LI E++ WKDLK H++ I  THLR LM D +RC+SMMVEFD I LDYSRQ+A+ +
Sbjct  1    MATPALISETEAWKDLKAHLEGIKRTHLRELMGDTERCQSMMVEFDNIFLDYSRQQASPD  60

Query  247  TIKKLLSLAEAAHL  288
            TI KL  LA+ AHL
Sbjct  61   TINKLYKLADEAHL  74



>ref|XP_005718631.1| glucose-6-phosphate isomerase, partial [Chondrus crispus]
 emb|CDF38726.1| glucose-6-phosphate isomerase, partial [Chondrus crispus]
Length=583

 Score =   106 bits (265),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 53/102 (52%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  70   ASSTLICESQPWKDLKGHIDE-INSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLE  246
            A+  L+     W  L+ H +  I++THLR+LM D DR  ++  E+DGI+LDYSRQR T E
Sbjct  14   AAPPLVSARPEWDALRRHKEAVIDATHLRDLMQDDDRVLALATEYDGIILDYSRQRVTKE  73

Query  247  TIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            TI  LL LA+A  LK++I++M SG+ IN+TE R+VLH ALRA
Sbjct  74   TIDLLLKLADAIGLKDRIHQMVSGDKINTTEGRAVLHTALRA  115



>gb|ABK00064.1| cytosolic glucose-6-phosphate isomerase [Mesostigma viride]
Length=580

 Score =   106 bits (265),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  112  LKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLAEAAHLK  291
            L+ H+ ++  THLR+L+ D  R  S  VE +G  +DY+RQR T ET+ KL++LA+AA++K
Sbjct  1    LQSHLADVEKTHLRDLLRDEQRSSSCEVEHNGFFVDYARQRVTAETMNKLMALAKAANMK  60

Query  292  EKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
            EKI  MF+G+ IN TENR+VLHVA RA    VI
Sbjct  61   EKIQAMFAGDRINVTENRAVLHVATRAPKGEVI  93



>gb|KDO30887.1| glucose-6-phosphate isomerase [Saprolegnia parasitica CBS 223.65]
Length=555

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  W  L  H D I +THLR L+ D  R  +++ E +GI LDYSRQ ATLET+  L
Sbjct  1    MINDTPQWTRLAAHADAIKATHLRTLLKDEGRNAALLAEHNGITLDYSRQNATLETMDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAEAA L++K++ + SGEH+N TE+R+V+H+ALR+
Sbjct  61   FDLAEAAQLRQKLSAIASGEHVNKTEDRAVMHMALRS  97



>emb|CBK23535.2| unnamed protein product [Blastocystis hominis]
Length=567

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = +1

Query  61   LEMASSTLICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRAT  240
            ++  ++  I E+  W+ LK  + E+   HLR+L+ D +R     VEFDGI LDYSRQ+ T
Sbjct  5    VQAMTTQHIWETAEWETLKQDVPEVTKLHLRDLLQDPERFSQFSVEFDGITLDYSRQKLT  64

Query  241  LETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXD  381
             +  + LL LAE A +KEK+N M +G+ IN TENR+VLH ALRA+ D
Sbjct  65   PKVKEDLLKLAERAQVKEKLNAMMTGKKINITENRAVLHSALRANKD  111



>gb|EJK76542.1| hypothetical protein THAOC_01689 [Thalassiosira oceanica]
Length=476

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDE-INSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKK  258
            L+  +  WK L+ H  E I+ THLR+L+ D +RC SM    DG+  DYSRQ+AT ET+  
Sbjct  143  LVSTTAEWKRLQRHASETISQTHLRDLLKDEERCDSMFATHDGVYYDYSRQQATSETMDL  202

Query  259  LLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXD  381
            L +LAE   L  +I++MFSGE IN TE+R+VLH ALRA  D
Sbjct  203  LFNLAEKQELTSRIDQMFSGEKINFTEDRAVLHTALRAPRD  243



>ref|XP_002289565.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93102.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=779

 Score =   105 bits (262),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +1

Query  67   MASSTLICESQPWKDLKGHIDEI-NSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATL  243
            ++   L+  +  W+ L+ H  +I  STHLR+L+ D  RC +M  E DG+ LDYSRQ+ATL
Sbjct  162  LSKPPLVSSTSEWRRLQRHASQILKSTHLRDLLQDPTRCDAMWAEHDGVYLDYSRQQATL  221

Query  244  ETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAV  387
            ET++ L  LAE   L ++I+ M +GE IN TE+R+VLH ALRAS + V
Sbjct  222  ETMELLFDLAEKQELTKRIDAMVNGEKINFTEDRAVLHTALRASREDV  269



>ref|XP_002185275.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC43144.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=786

 Score =   105 bits (261),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            L+     WK L+ H + I +THL++L+ D +RC  M    DG+ LDYSRQR TLET+K L
Sbjct  188  LVSTCSEWKRLEKHAEYIGTTHLKDLLQDRERCDEMYATHDGVYLDYSRQRVTLETMKFL  247

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
             +LAE  +LK +I++M  G+ IN TE+R+VLH ALRA
Sbjct  248  YALAEKQNLKGQIDKMVKGDKINFTEDRAVLHTALRA  284



>ref|XP_008611761.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
 gb|EQC34889.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
Length=555

 Score =   103 bits (258),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  W  L  H D I +THLR L+ D  R  +++ E +GI LDYSRQ ATLET+  L
Sbjct  1    MINDTPQWTRLTAHADAIKATHLRTLLKDEARNAALVAEHNGITLDYSRQNATLETMDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAEAA L++K+  + SGEH+N TE+R+V+H+ALR+
Sbjct  61   FDLAEAAQLRQKLAAIASGEHVNKTEDRAVMHMALRS  97



>ref|XP_005845944.1| hypothetical protein CHLNCDRAFT_135927 [Chlorella variabilis]
 gb|EFN53842.1| hypothetical protein CHLNCDRAFT_135927 [Chlorella variabilis]
Length=648

 Score =   103 bits (257),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   ICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLL  264
            I  S  W  L+ H  E+ S HLR+L+ D +R  S++ E +G+ +D+SRQ  T  T++ LL
Sbjct  72   IAYSPEWMALREHTKEVESLHLRDLLVDEERTDSLVREHNGLYVDFSRQNVTETTMQLLL  131

Query  265  SLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRASXD  381
            +LAE A L+ K+N MF+GEHIN+TE+RSVLH ALR   D
Sbjct  132  NLAERAKLRTKMNAMFAGEHINNTEDRSVLHTALRMPRD  170



>gb|EWM30292.1| glucose-6-phosphate isomerase [Nannochloropsis gaditana]
Length=563

 Score =   102 bits (253),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  94   SQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKLLSLA  273
            S  WK L  H + +  THLR+L+ DA R  ++ ++ +GIL D+SRQ   +ET+  L+ LA
Sbjct  7    STAWKTLAAHAERMKRTHLRDLLGDAARNSALSIKANGILFDFSRQNVNIETMDFLMDLA  66

Query  274  EAAHLKEKINRMFSGEHINSTENRSVLHVALRASXDAVI  390
             AA L+EK   MFSGE IN TE R+VLHVALRA   A I
Sbjct  67   GAAMLEEKRAAMFSGEKINVTEGRAVLHVALRAERSATI  105



>ref|XP_008242062.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Prunus 
mume]
Length=126

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = +1

Query  133  INSTHLRNLMSDADRCKSMMV---EFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKIN  303
            INST    L++     K+ +    EFDGILLDYSRQ AT ET++  +    AA L EKIN
Sbjct  8    INST----LVASPGSPKTNITLNSEFDGILLDYSRQHATPETLE--IGKGGAASLNEKIN  61

Query  304  RMFSGEHINSTENRSVLHVALRASXDAVI  390
            RMF GEHINSTENRSVLHVAL A  DAVI
Sbjct  62   RMFGGEHINSTENRSVLHVALHAPRDAVI  90



>gb|AAP51067.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   101 bits (251),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            L LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   LELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>emb|CAC85686.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  193  VEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            VEFD I LDYSRQ+A+ +TI KL  LAEAAHLK+KI+RM +G+HINSTENRSVLHVALRA
Sbjct  1    VEFDNIFLDYSRQQASPDTINKLYKLAEAAHLKQKIDRMNNGDHINSTENRSVLHVALRA  60

Query  373  SXDAVI  390
              ++VI
Sbjct  61   PRNSVI  66



>gb|AAP51075.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score =   100 bits (250),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDSL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|ETP54025.1| hypothetical protein F442_01139 [Phytophthora parasitica P10297]
Length=556

 Score =   100 bits (250),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLADNARNTAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>ref|XP_008890866.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETI56214.1| hypothetical protein F443_01209 [Phytophthora parasitica P1569]
 gb|ETL49396.1| hypothetical protein L916_01121 [Phytophthora parasitica]
 gb|ETM02446.1| hypothetical protein L917_01091 [Phytophthora parasitica]
 gb|ETM55689.1| hypothetical protein L914_01128 [Phytophthora parasitica]
 gb|ETN24837.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETO84955.1| hypothetical protein F444_01204 [Phytophthora parasitica P1976]
Length=556

 Score =   100 bits (249),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLADDARNTAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51068.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (249),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51069.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (249),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNTTEDRAVMHMALRA  97



>gb|AAP51077.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51070.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51080.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51061.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51071.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>ref|XP_002908462.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
 gb|AAM28239.1| glucose 6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51064.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51078.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|EEY61545.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
Length=556

 Score =   100 bits (248),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51079.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>ref|XP_009523844.1| glucose-6-phosphate isomerase [Phytophthora sojae]
 gb|EGZ21127.1| glucose-6-phosphate isomerase [Phytophthora sojae]
Length=556

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI +THLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MISDTPAWKALAEHAAEIKATHLRELLADDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETADLKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51065.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51072.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51074.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>gb|AAP51073.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +1

Query  82   LICESQPWKDLKGHIDEINSTHLRNLMSDADRCKSMMVEFDGILLDYSRQRATLETIKKL  261
            +I ++  WK L  H  EI STHLR L++D  R  +M  E  GI LD+SRQ AT +T+  L
Sbjct  1    MINDTPAWKALAEHAAEIKSTHLRELLNDDARNAAMRTEQQGIYLDFSRQNATSKTLDLL  60

Query  262  LSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
              LAE A LK+K+  + SGEH+N+TE+R+V+H+ALRA
Sbjct  61   FELAETAELKKKLQAIASGEHVNATEDRAVMHMALRA  97



>emb|CAC85683.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  193  VEFDGILLDYSRQRATLETIKKLLSLAEAAHLKEKINRMFSGEHINSTENRSVLHVALRA  372
            VEFD I LDYSRQ+A+ +TI KL  LA+AAHLK+KI+RM++G+HIN+TENRSVLHVALRA
Sbjct  1    VEFDNIFLDYSRQQASPDTISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRA  60

Query  373  SXDAVI  390
              ++ I
Sbjct  61   PRNSAI  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561277149640