BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF005E13

Length=411
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDY35861.1|  BnaC09g37930D                                          229   7e-74   Brassica napus [oilseed rape]
gb|KJB83376.1|  hypothetical protein B456_013G244600                    233   1e-73   Gossypium raimondii
gb|KJB83377.1|  hypothetical protein B456_013G244600                    233   6e-73   Gossypium raimondii
gb|EYU39262.1|  hypothetical protein MIMGU_mgv1a0159351mg               225   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    234   3e-72   Tarenaya hassleriana [spider flower]
gb|AAT68202.1|  alpha 1 tubulin                                         224   3e-72   Cynodon dactylon
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    233   8e-72   Tarenaya hassleriana [spider flower]
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              233   9e-72   Phoenix dactylifera
ref|XP_002532068.1|  tubulin alpha chain, putative                      233   1e-71   Ricinus communis
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              233   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        232   1e-71   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   233   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              232   2e-71   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      232   2e-71   Medicago truncatula
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   232   2e-71   Sesamum indicum [beniseed]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    232   2e-71   Gossypium raimondii
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              232   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             232   2e-71   Gossypium arboreum [tree cotton]
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        231   2e-71   Prunus mume [ume]
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   232   3e-71   Tarenaya hassleriana [spider flower]
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                234   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              231   4e-71   Cucumis sativus [cucumbers]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        231   5e-71   Cucumis melo [Oriental melon]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              231   5e-71   Brassica rapa
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   231   6e-71   Brassica rapa
ref|NP_197478.1|  tubulin alpha-3                                       231   6e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EPS70933.1|  tubulin alpha-6 chain                                   225   6e-71   Genlisea aurea
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             231   6e-71   Capsella rubella
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              231   6e-71   Brassica rapa
emb|CDY42294.1|  BnaC02g09000D                                          231   6e-71   Brassica napus [oilseed rape]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             231   6e-71   Capsella rubella
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              231   6e-71   Brassica rapa
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              231   7e-71   Camelina sativa [gold-of-pleasure]
emb|CDY44941.1|  BnaA02g04460D                                          231   7e-71   Brassica napus [oilseed rape]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         231   8e-71   Jatropha curcas
emb|CBI16534.3|  unnamed protein product                                229   8e-71   Vitis vinifera
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   231   9e-71   Elaeis guineensis
emb|CDX88875.1|  BnaA03g07740D                                          231   9e-71   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              230   1e-70   Brassica rapa
gb|AGD80034.1|  alpha-tubulin 1                                         230   1e-70   Hevea brasiliensis [jebe]
emb|CAD26886.1|  alpha-tubulin                                          230   1e-70   Miscanthus sinensis
emb|CAD24766.1|  alpha-tubulin                                          230   1e-70   Miscanthus sinensis
ref|NP_001105588.1|  tubulin alpha-6 chain                              230   1e-70   Zea mays [maize]
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              230   1e-70   Sesamum indicum [beniseed]
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    229   1e-70   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              230   1e-70   Morus notabilis
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             230   1e-70   Phaseolus vulgaris [French bean]
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   230   1e-70   Nelumbo nucifera [Indian lotus]
emb|CDP14299.1|  unnamed protein product                                230   2e-70   Coffea canephora [robusta coffee]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    230   2e-70   Eleusine indica [crabgrass]
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              229   2e-70   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              229   2e-70   Cucumis sativus [cucumbers]
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    229   2e-70   
gb|ACN40824.1|  unknown                                                 229   2e-70   Picea sitchensis
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        229   2e-70   Prunus mume [ume]
gb|AGV54500.1|  tubulin A                                               229   2e-70   Phaseolus vulgaris [French bean]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             229   3e-70   Prunus persica
gb|ACU18775.1|  unknown                                                 221   3e-70   Glycine max [soybeans]
gb|ABE66388.1|  alpha-tubulin                                           221   3e-70   Striga asiatica [witchweed]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              229   3e-70   Sesamum indicum [beniseed]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              229   3e-70   Oryza brachyantha
ref|XP_001786415.1|  predicted protein                                  218   4e-70   
emb|CAB77671.1|  alpha-tubulin                                          229   4e-70   Miscanthus sinensis f. glaber
gb|AHZ58482.1|  alpha-tubulin                                           223   4e-70   Syntrichia caninervis
gb|KHN47983.1|  Tubulin alpha-3 chain                                   228   4e-70   Glycine soja [wild soybean]
gb|AGG37284.1|  alpha-tubulin 2                                         229   5e-70   Salix arbutifolia
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            219   5e-70   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     229   5e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              228   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                228   5e-70   Erythranthe guttata [common monkey flower]
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   228   5e-70   Vitis vinifera
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              228   6e-70   Elaeis guineensis
dbj|BAJ06363.1|  alpha-tubulin                                          228   6e-70   Alopecurus aequalis
gb|ABF13307.1|  alpha-tubulin                                           218   7e-70   Phaseolus vulgaris [French bean]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         228   7e-70   Jatropha curcas
gb|AAN33000.1|  alpha-tubulin 4                                         224   9e-70   Gossypium hirsutum [American cotton]
ref|NP_001060075.1|  Os07g0574800                                       228   9e-70   
emb|CAD26891.1|  alpha-tubulin                                          228   1e-69   Miscanthus floridulus
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    228   1e-69   
ref|NP_001237301.1|  tubulin A                                          228   1e-69   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   228   1e-69   Eucalyptus grandis [rose gum]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                228   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              228   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               219   1e-69   Erythranthe guttata [common monkey flower]
gb|ABD92942.1|  alpha tubulin-1D                                        227   1e-69   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92943.1|  alpha tubulin-1B                                        227   1e-69   Triticum aestivum [Canadian hard winter wheat]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   227   1e-69   Gossypium arboreum [tree cotton]
gb|KJB44614.1|  hypothetical protein B456_007G261000                    227   2e-69   Gossypium raimondii
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     228   2e-69   Eucalyptus grandis [rose gum]
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        226   2e-69   Fragaria vesca subsp. vesca
gb|AAO63773.2|  alpha-tubulin 2                                         227   2e-69   Populus tremuloides
emb|CAD24765.1|  alpha-tubulin                                          227   2e-69   Miscanthus sinensis
ref|NP_001275086.1|  uncharacterized LOC102577521                       227   2e-69   Solanum tuberosum [potatoes]
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              227   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          227   2e-69   Amborella trichopoda
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              227   2e-69   Setaria italica
ref|XP_007014666.1|  Tubulin alpha-5                                    226   3e-69   Theobroma cacao [chocolate]
gb|AIC33057.1|  tubulin alpha-1 chain                                   226   3e-69   Panax ginseng [Asiatic ginseng]
ref|NP_001275472.1|  alpha-tubulin-like protein                         220   3e-69   Solanum tuberosum [potatoes]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    226   3e-69   Gossypium raimondii
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   226   3e-69   
gb|AGY80453.1|  tubulin                                                 226   3e-69   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   226   4e-69   Pyrus x bretschneideri [bai li]
gb|ACU24494.1|  unknown                                                 218   4e-69   Glycine max [soybeans]
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             226   4e-69   Gossypium arboreum [tree cotton]
dbj|BAM28754.1|  tubulin                                                224   4e-69   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               226   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              226   4e-69   Nelumbo nucifera [Indian lotus]
emb|CAB77672.1|  alpha-tubulin                                          226   4e-69   Miscanthus transmorrisonensis
dbj|BAJ06365.1|  alpha-tubulin                                          226   4e-69   Alopecurus aequalis
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   226   5e-69   Brachypodium distachyon [annual false brome]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             226   5e-69   Prunus persica
emb|CAD24768.1|  alpha-tubulin                                          226   5e-69   Miscanthus floridulus
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               226   6e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    225   6e-69   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   226   6e-69   Phoenix dactylifera
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   226   7e-69   Populus euphratica
emb|CDP17586.1|  unnamed protein product                                226   7e-69   Coffea canephora [robusta coffee]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   226   7e-69   Malus domestica [apple tree]
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              226   7e-69   Tarenaya hassleriana [spider flower]
gb|KHN06388.1|  Tubulin alpha-3 chain                                   225   7e-69   Glycine soja [wild soybean]
emb|CAD26887.1|  alpha-tubulin                                          226   7e-69   Miscanthus sinensis
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             225   7e-69   Phaseolus vulgaris [French bean]
emb|CBI19330.3|  unnamed protein product                                224   7e-69   Vitis vinifera
emb|CAD26893.1|  alpha-tubulin                                          225   8e-69   Miscanthus floridulus
dbj|BAJ86161.1|  predicted protein                                      225   8e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD92939.1|  alpha tubulin-5D                                        225   9e-69   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92940.1|  alpha tubulin-5A                                        225   9e-69   Triticum aestivum [Canadian hard winter wheat]
gb|ABV55994.1|  alpha-tubulin 6                                         225   9e-69   Populus tremuloides
ref|NP_001242878.1|  uncharacterized protein LOC100806907               225   9e-69   Glycine max [soybeans]
gb|ACN40426.1|  unknown                                                 221   9e-69   Picea sitchensis
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             225   1e-68   Hordeum vulgare [barley]
emb|CBI29424.3|  unnamed protein product                                220   1e-68   Vitis vinifera
gb|ABO47741.1|  alpha-tubulin                                           225   1e-68   Gossypium hirsutum [American cotton]
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        225   1e-68   Fragaria vesca subsp. vesca
gb|ABO47735.1|  alpha-tubulin                                           225   1e-68   Gossypium hirsutum [American cotton]
gb|AFW89176.1|  hypothetical protein ZEAMMB73_322393                    225   1e-68   
ref|XP_001782790.1|  predicted protein                                  225   1e-68   
gb|AGG37290.1|  alpha-tubulin 8                                         225   1e-68   Salix arbutifolia
gb|AGG37286.1|  alpha-tubulin 4                                         225   1e-68   Salix arbutifolia
ref|XP_001777081.1|  predicted protein                                  225   1e-68   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   225   1e-68   Malus domestica [apple tree]
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              225   1e-68   Prunus mume [ume]
ref|XP_003624633.1|  Alpha-tubulin                                      225   1e-68   Medicago truncatula
ref|NP_001105324.1|  tubulin alpha-5 chain                              225   1e-68   Zea mays [maize]
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     221   2e-68   
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                224   2e-68   Avena sativa [cultivated oat]
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  221   2e-68   Citrus sinensis [apfelsine]
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        223   2e-68   
emb|CAD26889.1|  alpha-tubulin                                          224   3e-68   Miscanthus transmorrisonensis
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              224   3e-68   Malus domestica [apple tree]
ref|XP_002763662.3|  PREDICTED: tubulin alpha chain-like                216   3e-68   
gb|AAX21196.1|  putative alpha-tubulin                                  216   3e-68   Solanum betaceum [tamarillo]
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              224   3e-68   Populus euphratica
gb|ABO47738.1|  alpha-tubulin                                           224   3e-68   Gossypium hirsutum [American cotton]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              224   3e-68   Populus euphratica
ref|XP_005466564.1|  PREDICTED: tubulin alpha chain-like                214   3e-68   
emb|CAD26890.1|  alpha-tubulin                                          224   3e-68   Miscanthus sinensis subsp. condensatus
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        223   3e-68   
emb|CAD26892.1|  alpha-tubulin                                          224   3e-68   Miscanthus floridulus
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   224   4e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             223   4e-68   Citrus clementina [clementine]
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     223   4e-68   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              225   4e-68   
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...    214   4e-68   Amphimedon queenslandica
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   221   5e-68   Citrus sinensis [apfelsine]
gb|ADW66593.1|  alpha tubulin                                           221   5e-68   Hirschfeldia incana [buchanweed]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             223   5e-68   Citrus clementina [clementine]
ref|XP_002609253.1|  hypothetical protein BRAFLDRAFT_86837              213   5e-68   Branchiostoma floridae
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          223   5e-68   
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              223   6e-68   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    223   6e-68   Brassica rapa
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              223   7e-68   Glycine max [soybeans]
ref|XP_001427644.1|  hypothetical protein                               215   7e-68   Paramecium tetraurelia strain d4-2
ref|XP_002525416.1|  tubulin alpha chain, putative                      223   7e-68   Ricinus communis
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   223   7e-68   Vitis vinifera
ref|XP_010104543.1|  Tubulin alpha chain                                223   8e-68   
emb|CBI22190.3|  unnamed protein product                                221   8e-68   Vitis vinifera
ref|XP_002675196.1|  alpha-tubulin                                      223   8e-68   Naegleria gruberi strain NEG-M
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    223   9e-68   Gossypium hirsutum [American cotton]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     223   9e-68   Sesamum indicum [beniseed]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        223   9e-68   Glycine max [soybeans]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    223   9e-68   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    223   1e-67   Gossypium hirsutum [American cotton]
gb|ABO47739.1|  alpha-tubulin                                           223   1e-67   Gossypium hirsutum [American cotton]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     223   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    223   1e-67   
gb|AAO23139.1|  alpha tubulin                                           223   1e-67   Populus tremuloides
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    222   1e-67   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        222   1e-67   Cucumis melo [Oriental melon]
gb|AEG74028.1|  alpha-tubulin                                           222   1e-67   Apopellia endiviifolia (species B)
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    221   1e-67   
gb|AAI59362.1|  Unknown (protein for MGC:185872)                        213   1e-67   Xenopus tropicalis [western clawed frog]
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      222   1e-67   Phaseolus vulgaris [French bean]
ref|XP_003979912.1|  PREDICTED: tubulin alpha-1D chain-like             212   1e-67   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             222   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_005932718.1|  PREDICTED: tubulin alpha chain-like                213   1e-67   
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     222   1e-67   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         222   1e-67   Jatropha curcas
gb|KIY93466.1|  Tubulin alpha-1 chain                                   214   1e-67   Monoraphidium neglectum
ref|XP_010096739.1|  Tubulin alpha chain                                222   1e-67   
emb|CDY25017.1|  BnaC02g39910D                                          221   2e-67   Brassica napus [oilseed rape]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          222   2e-67   
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              222   2e-67   Eucalyptus grandis [rose gum]
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   222   2e-67   Populus euphratica
gb|KJB58757.1|  hypothetical protein B456_009G224800                    221   2e-67   Gossypium raimondii
gb|EPZ32931.1|  Tubulin domain-containing protein                       212   2e-67   Rozella allomycis CSF55
gb|AGG37288.1|  alpha-tubulin 6                                         222   2e-67   Salix arbutifolia
emb|CBH08957.1|  alpha tubulin, (fragment)                              213   2e-67   Trypanosoma brucei gambiense DAL972
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                222   2e-67   Fragaria vesca subsp. vesca
ref|XP_003793694.1|  PREDICTED: tubulin alpha chain-like                212   2e-67   Otolemur garnettii
emb|CBI25125.3|  unnamed protein product                                219   2e-67   Vitis vinifera
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        222   2e-67   Brassica rapa
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                222   2e-67   Phoenix dactylifera
gb|ABO47736.1|  alpha-tubulin                                           222   2e-67   Gossypium hirsutum [American cotton]
ref|XP_005466520.1|  PREDICTED: tubulin alpha chain-like                212   2e-67   
gb|ABB16994.1|  unknown                                                 222   2e-67   Solanum tuberosum [potatoes]
gb|KHG18997.1|  Tubulin alpha chain                                     222   2e-67   Gossypium arboreum [tree cotton]
tpg|DAA51110.1|  TPA: alpha-tubulin                                     215   2e-67   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   222   2e-67   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          222   2e-67   Citrus sinensis [apfelsine]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    222   2e-67   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             222   2e-67   Citrus clementina [clementine]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              222   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             222   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        222   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     221   2e-67   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                221   2e-67   Cucumis sativus [cucumbers]
gb|AIX10773.1|  alpha tubulin                                           221   2e-67   Panax notoginseng [san-qi]
gb|EKF30131.1|  epsilon tubulin, putative                               214   3e-67   Trypanosoma cruzi marinkellei
emb|CDY66630.1|  BnaCnng51680D                                          221   3e-67   Brassica napus [oilseed rape]
emb|CAD24767.1|  alpha-tubulin                                          221   3e-67   Miscanthus floridulus
emb|CCC46467.1|  putative alpha tubulin, fragment                       216   3e-67   Trypanosoma vivax Y486
emb|CDY29334.1|  BnaA05g16010D                                          221   3e-67   Brassica napus [oilseed rape]
gb|ABK92552.1|  unknown                                                 221   3e-67   Populus trichocarpa [western balsam poplar]
emb|CAB66336.1|  alpha-tubulin                                          221   3e-67   Betula pendula [white birch]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             221   3e-67   Phaseolus vulgaris [French bean]
gb|KHN46768.1|  Tubulin alpha-3 chain                                   221   3e-67   Glycine soja [wild soybean]
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   221   3e-67   Brachypodium distachyon [annual false brome]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             221   3e-67   Citrus clementina [clementine]
ref|XP_002510010.1|  tubulin alpha chain, putative                      221   3e-67   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           221   3e-67   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         221   3e-67   Pseudotsuga menziesii var. menziesii
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    221   3e-67   
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              221   3e-67   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      221   3e-67   Phaseolus vulgaris [French bean]
gb|AGG37287.1|  alpha-tubulin 5                                         221   3e-67   Salix arbutifolia
emb|CAD26888.1|  alpha-tubulin                                          221   3e-67   Miscanthus transmorrisonensis
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    221   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_002522104.1|  tubulin alpha chain, putative                      221   3e-67   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              221   3e-67   Theobroma cacao [chocolate]
gb|ABE01246.1|  alpha tubulin                                           221   3e-67   Camellia sinensis [black tea]
gb|ABO47740.1|  alpha-tubulin                                           221   3e-67   Gossypium hirsutum [American cotton]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                221   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                221   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          221   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                221   3e-67   Pyrus x bretschneideri [bai li]
gb|AID52921.1|  tubulin alpha chain                                     221   3e-67   Carthamus tinctorius
ref|NP_171974.1|  tubulin alpha-4 chain                                 221   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   221   3e-67   Populus euphratica
ref|XP_002587654.1|  hypothetical protein BRAFLDRAFT_96496              211   3e-67   Branchiostoma floridae
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             221   4e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     221   4e-67   Eucalyptus grandis [rose gum]
gb|AGG37285.1|  alpha-tubulin 3                                         221   4e-67   Salix arbutifolia
ref|XP_007042689.1|  Tubulin alpha-2 chain                              221   4e-67   Theobroma cacao [chocolate]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             221   4e-67   Capsella rubella
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             221   4e-67   Selaginella moellendorffii
dbj|BAC24800.1|  alpha tubulin                                          221   4e-67   Physcomitrella patens
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             221   4e-67   Prunus persica
ref|NP_849388.1|  tubulin alpha-6 chain                                 220   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          221   4e-67   Sorghum bicolor [broomcorn]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         221   4e-67   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           221   4e-67   Betula pendula [white birch]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          221   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                221   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   221   4e-67   Fragaria vesca subsp. vesca
ref|XP_001315391.1|  alpha-tubulin 1                                    215   4e-67   Trichomonas vaginalis G3
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              221   4e-67   Nicotiana tomentosiformis
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                221   4e-67   Elaeis guineensis
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                221   4e-67   
ref|XP_007663362.1|  PREDICTED: tubulin alpha chain-like                211   4e-67   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    221   4e-67   
gb|ERE81184.1|  tubulin alpha-1C chain                                  213   5e-67   
gb|ABO47737.1|  alpha-tubulin                                           221   5e-67   
ref|XP_006649647.1|  PREDICTED: tubulin alpha-2 chain-like              221   5e-67   
gb|AAW30622.1|  unknown                                                 213   5e-67   
dbj|BAJ07366.1|  alpha-tubulin                                          212   5e-67   
gb|KHG20487.1|  Tubulin alpha chain                                     221   5e-67   
gb|AAM73791.1|  alpha-tubulin                                           211   5e-67   
gb|KJB29387.1|  hypothetical protein B456_005G097800                    221   5e-67   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        221   5e-67   
ref|WP_039310890.1|  hypothetical protein                               221   5e-67   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              221   5e-67   
ref|XP_010093625.1|  Tubulin alpha chain                                221   5e-67   
dbj|BAJ98211.1|  predicted protein                                      221   5e-67   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                221   5e-67   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              221   5e-67   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                221   6e-67   
gb|AGG37283.1|  alpha-tubulin 1                                         221   6e-67   
ref|XP_007068754.1|  PREDICTED: tubulin alpha-1D chain-like             214   6e-67   
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                220   6e-67   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               221   6e-67   
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     213   6e-67   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             221   6e-67   
gb|ABD92930.1|  alpha tubulin-2A                                        221   6e-67   
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     221   6e-67   
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     221   6e-67   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                221   6e-67   
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             215   6e-67   
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          220   6e-67   
gb|AAB08791.1|  alpha tubulin                                           221   6e-67   
gb|AHJ80818.1|  Tua1                                                    216   6e-67   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             214   6e-67   
gb|AAW30623.1|  unknown                                                 213   6e-67   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           221   6e-67   
gb|ABR67425.1|  alpha-tubulin 4                                         221   7e-67   
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like                213   7e-67   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              220   7e-67   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         220   7e-67   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                220   7e-67   
dbj|BAP59012.1|  alpha tubulin                                          220   7e-67   
emb|CAJ26346.1|  alpha-tubulin                                          212   7e-67   
gb|AGM32279.1|  alpha tubulin                                           216   7e-67   
gb|AAO73546.1|  alpha-tubulin                                           220   8e-67   
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              216   8e-67   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                220   8e-67   
emb|CDP02221.1|  unnamed protein product                                220   8e-67   
gb|AAG49533.3|  alpha tubulin                                           215   8e-67   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              220   8e-67   
gb|ABQ59634.1|  alpha-tubulin 5                                         220   8e-67   
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     219   9e-67   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             220   9e-67   
gb|ACN40181.1|  unknown                                                 220   9e-67   
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     220   9e-67   
ref|XP_003804211.2|  PREDICTED: tubulin alpha-3E chain                  211   9e-67   
gb|KGL81705.1|  Tubulin alpha-1C chain                                  214   9e-67   
gb|ABV55999.1|  alpha-tubulin 7                                         220   9e-67   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     220   9e-67   
ref|XP_006264718.1|  PREDICTED: tubulin alpha chain-like                211   9e-67   
ref|XP_739480.1|  hypothetical protein                                  211   9e-67   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             220   9e-67   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       215   9e-67   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              220   1e-66   
ref|XP_005851144.1|  alpha-tubulin                                      220   1e-66   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   220   1e-66   
ref|XP_002110664.1|  alpha tubulin                                      214   1e-66   
gb|ABO47742.1|  alpha-tubulin                                           220   1e-66   
ref|XP_006264720.1|  PREDICTED: tubulin alpha-1C chain                  211   1e-66   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  213   1e-66   
gb|EMT20847.1|  Tubulin alpha-2 chain                                   220   1e-66   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             220   1e-66   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              220   1e-66   
ref|XP_005906298.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    212   1e-66   
ref|XP_004617224.1|  PREDICTED: tubulin alpha-1D chain-like             212   1e-66   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          220   1e-66   
emb|CAD32379.1|  tubulin alpha                                          209   1e-66   
ref|XP_674476.1|  hypothetical protein                                  212   1e-66   
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             213   1e-66   
gb|AGE09583.1|  TUA1-like protein                                       219   1e-66   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   220   1e-66   
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like              211   1e-66   
emb|CDP00974.1|  unnamed protein product                                220   1e-66   
gb|ABS57456.1|  alpha-tubulin                                           213   1e-66   
ref|XP_002508010.1|  alpha tubulin 2                                    219   1e-66   
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     219   1e-66   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     220   1e-66   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             220   1e-66   
ref|XP_673091.1|  hypothetical protein                                  214   1e-66   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  214   1e-66   
dbj|BAE01779.1|  unnamed protein product                                214   1e-66   
gb|EKF98903.1|  epsilon tubulin, putative                               214   1e-66   
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        220   1e-66   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    219   1e-66   
gb|AGG37289.1|  alpha-tubulin 7                                         219   1e-66   
sp|O22348.1|TBA2_ELEIN  RecName: Full=Tubulin alpha-2 chain; AltN...    219   1e-66   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                219   1e-66   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-66   
gb|AII97815.1|  BLTX443                                                 214   2e-66   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                219   2e-66   
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    219   2e-66   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-66   
emb|CCC46464.1|  putative alpha tubulin                                 216   2e-66   
gb|AIX10966.1|  tubulin                                                 219   2e-66   
ref|NP_001289660.1|  tubulin alpha chain-like                           219   2e-66   
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 219   2e-66   
gb|ESL08706.1|  alpha tubulin                                           216   2e-66   
sp|P50258.1|TBAD_PHYPO  RecName: Full=Tubulin alpha-1A chain            219   2e-66   
gb|AIJ27191.1|  alpha-tubulin 1a                                        214   2e-66   
gb|ABK92520.1|  unknown                                                 219   2e-66   
gb|AAM73790.1|  alpha-tubulin                                           209   2e-66   
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  213   2e-66   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     219   2e-66   
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             212   2e-66   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     219   2e-66   
ref|XP_001764722.1|  predicted protein                                  219   2e-66   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             219   2e-66   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     219   2e-66   
ref|NP_001049400.1|  Os03g0219300                                       219   2e-66   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             213   2e-66   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   219   2e-66   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                219   2e-66   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   219   2e-66   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              219   2e-66   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        219   2e-66   
gb|ABQ59633.1|  alpha-tubulin 3                                         219   2e-66   
ref|XP_010726225.1|  PREDICTED: tubulin alpha chain-like                211   2e-66   
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          219   2e-66   
gb|ABB02631.1|  unknown                                                 219   2e-66   
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     219   2e-66   
ref|NP_193232.1|  tubulin alpha-6 chain                                 219   2e-66   
ref|XP_002783368.1|  alpha tubulin, putative                            210   2e-66   
ref|XP_005651460.1|  tubulin alpha chain                                219   2e-66   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             219   2e-66   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-66   
emb|CAD13176.1|  alpha-tubulin                                          219   2e-66   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    215   2e-66   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              219   2e-66   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-66   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                219   3e-66   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     219   3e-66   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              219   3e-66   
ref|NP_001291325.1|  tubulin alpha chain-like                           219   3e-66   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             219   3e-66   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     219   3e-66   
gb|ACH68563.1|  alpha-tubulin                                           219   3e-66   
ref|XP_005643073.1|  tubulin alpha chain                                219   3e-66   
gb|ABP65320.1|  alpha tubulin                                           219   3e-66   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             213   3e-66   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     219   3e-66   
gb|AII25880.1|  alpha tubulin 1a                                        213   3e-66   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          219   3e-66   
gb|KHN01709.1|  Tubulin alpha chain                                     219   3e-66   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                219   3e-66   
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    218   3e-66   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                219   3e-66   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    219   3e-66   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             214   3e-66   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     219   3e-66   
ref|XP_005107363.1|  PREDICTED: tubulin alpha-3 chain-like              208   3e-66   
emb|CDO97305.1|  unnamed protein product                                219   3e-66   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   219   3e-66   
gb|AAC97930.1|  alpha tubulin                                           210   3e-66   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             219   4e-66   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 218   4e-66   
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             214   4e-66   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             218   4e-66   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    218   4e-66   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     218   4e-66   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             218   4e-66   
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     218   4e-66   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                218   5e-66   
emb|CCD12221.1|  unnamed protein product                                216   5e-66   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                218   5e-66   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  213   5e-66   
ref|NP_001067613.1|  Os11g0247300                                       218   5e-66   
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    218   5e-66   
gb|AAK83154.1|AF327846_1  alpha-tubulin 1                               211   5e-66   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   218   5e-66   
ref|XP_002766433.1|  tubulin alpha chain, putative                      209   6e-66   
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              218   6e-66   
gb|ABO33166.1|  alpha tubulin a2                                        212   6e-66   
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        218   6e-66   
ref|XP_002517492.1|  tubulin alpha chain, putative                      218   6e-66   
gb|EPY40566.1|  tubulin alpha                                           215   6e-66   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              214   6e-66   
gb|ABU93323.1|  tubulin alpha subunit                                   218   6e-66   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             218   6e-66   
gb|ACU19580.1|  unknown                                                 218   6e-66   
ref|XP_004085980.2|  PREDICTED: tubulin alpha-1D chain-like             208   6e-66   
gb|EFO61055.1|  Alpha-tubulin                                           209   6e-66   
ref|XP_007528601.1|  PREDICTED: tubulin alpha chain-like                211   7e-66   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     218   7e-66   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    218   7e-66   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    218   7e-66   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                218   7e-66   
gb|KEH43997.1|  tubulin beta-1 chain                                    218   7e-66   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                218   7e-66   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             211   7e-66   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  218   7e-66   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    217   7e-66   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             218   7e-66   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           218   8e-66   
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 214   8e-66   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             218   8e-66   
gb|ESA03173.1|  hypothetical protein GLOINDRAFT_67395                   218   8e-66   
gb|EKC22339.1|  Tubulin alpha chain                                     213   8e-66   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              218   9e-66   
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              218   9e-66   
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             213   9e-66   
gb|ACI15922.1|  alpha-tubulin                                           218   9e-66   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             218   9e-66   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             218   9e-66   
gb|AIA82437.1|  alpha-tubulin-like protein 06                           215   9e-66   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      218   9e-66   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                218   9e-66   
gb|KFM01620.1|  Tubulin alpha-1C chain                                  213   9e-66   
gb|EPY32753.1|  tubulin alpha                                           212   9e-66   
gb|ABU93324.1|  tubulin alpha subunit                                   218   1e-65   
gb|ABU93321.1|  tubulin alpha subunit                                   218   1e-65   
gb|AIK29207.1|  putative alpha-tubulin                                  212   1e-65   



>emb|CDY35861.1| BnaC09g37930D [Brassica napus]
Length=173

 Score =   229 bits (585),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KJB83376.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=271

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KJB83377.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=346

 Score =   233 bits (594),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|EYU39262.1| hypothetical protein MIMGU_mgv1a0159351mg, partial [Erythranthe 
guttata]
Length=134

 Score =   225 bits (573),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+ G+ +D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010535935.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AAT68202.1| alpha 1 tubulin [Cynodon dactylon]
Length=141

 Score =   224 bits (572),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG+A+D+FNTFF+ETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTTVGVAHDAFNTFFTETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHY VGK++VDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYNVGKEVVDLCLDR  121



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVGIA+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DE+R+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEIRAGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+ +D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A DSFNTFFSETGSG HVP
Sbjct  4    IISLHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAATDSFNTFFSETGSGNHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGKDIVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLDR  121



>ref|XP_008449886.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Cucumis melo]
Length=435

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVASDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVACDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+AND+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_008240534.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Prunus mume]
Length=424

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG HVP
Sbjct  4    IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGNHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSET +GKHVP
Sbjct  95   IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETSAGKHVP  154

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTVVDEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGKDIVDLCLDR
Sbjct  155  RAIFLDLEPTVVDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLDR  212



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|EPS70933.1| tubulin alpha-6 chain, partial [Genlisea aurea]
Length=269

 Score =   225 bits (574),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG+MPSDTSVG A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGLMPSDTSVGAAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVGK+IVD CLDR
Sbjct  64   RAIFVDLEPTVIDEVRSGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLDR  121



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009126388.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CBI16534.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+ +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG  NDSFNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGTENDSFNTFFSETRAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTVVDEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG+DI+DLCLDR
Sbjct  64   RAVFVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLDR  121



>ref|XP_006584595.1| PREDICTED: uncharacterized protein LOC100806907 isoform X1 [Glycine 
max]
Length=423

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+++D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVSHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI PDGMMPSD SVGIANDSFNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIHPDGMMPSDKSVGIANDSFNTFFSETSAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A++VDLEPTVVDEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG+DI+DLCLDR
Sbjct  64   RAIYVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLDR  121



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_004170946.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Cucumis 
sativus]
Length=447

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTSVG+ +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AV VDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVIVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG HVP
Sbjct  4    IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGNHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVG A+D+FNTFFSETGSG HVP
Sbjct  4    IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGNHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD + GIA+DSFNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGYMPSDKTAGIADDSFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTVVDEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGKDI+DLCLDR
Sbjct  64   RAIFLDLEPTVVDEVRNGAYRQLFHPEQLISGKEDAANNFARGHYTVGKDIIDLCLDR  121



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_001786415.1| predicted protein [Physcomitrella patens]
 gb|EDQ48774.1| predicted protein, partial [Physcomitrella patens]
Length=127

 Score =   218 bits (556),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD SVG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAB77671.1| alpha-tubulin [Miscanthus sinensis f. glaber]
Length=450

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVADDAFNTFFSETGSGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   223 bits (568),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD S G  +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   219 bits (558),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAQDAFNTFFSETSAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGVMPSDNSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG+ +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVRSGAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score =   218 bits (555),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYT+GK++VDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEVVDLCLDR  121



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   228 bits (581),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS+G  +DSFNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSIGTEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+F+TFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD++ G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD++ G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGM+PSD +VG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+ G+ +D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD+SVG+A D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGMACDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGNACWELYCLEHGIQPDGMMP DTSVG  +D+FNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVRSGA+R LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGNACWELYCLEHGIQPDGMMP DTSVG  +D+FNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVRSGA+R LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGM+PSD +VG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_011461685.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G+  D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG+MPSD SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIRPDGVMPSDASVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+A+D+FNTFFSETGSGKHVP 
Sbjct  5    ISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKE+AA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKENAANNFARGHYTVGKEIVDLCLDR  121



>ref|NP_001275086.1| uncharacterized LOC102577521 [Solanum tuberosum]
 gb|ABC01891.1| tubulin alpha-5 chain-like protein [Solanum tuberosum]
Length=449

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G A+D+FNTFFSETG+GKHVP
Sbjct  4    IISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD+SVG+A D+FNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGVATDAFNTFFSETSAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD S+G+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNSIGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+ DG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEADGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH I PDGMMPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIHPDGMMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD +VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DE+R+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEIRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|NP_001275472.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABA46784.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=237

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG  +D+FNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDTSVG   DSFNTFFSETGSG HVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTSVGSETDSFNTFFSETGSGSHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVD CLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLDR  121



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   218 bits (554),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IV+LCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLDR  121



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDT+VG  +D+FNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>dbj|BAM28754.1| tubulin [Brassica rapa subsp. chinensis]
Length=377

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVG +CWELYCLEHGIQPDGMMPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGFSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDL LDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLGLDR  121



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEH IQPDGMMPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGTGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLE TV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLESTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAB77672.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>dbj|BAJ06365.1| alpha-tubulin [Alopecurus aequalis]
Length=449

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDTSVGVAKDAFNTFFSETGTGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLIS KEDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVRTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLDR  121



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSD++VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDSTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG+  D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG  PSDTSVG+A+D+FNTFFSETGSGKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIEPDGTTPSDTSVGVAHDAFNTFFSETGSGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G  +DSFNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_006488931.1| PREDICTED: tubulin alpha-1 chain-like isoform X2 [Citrus sinensis]
Length=428

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSD ++G+A+D+FNTFFSET +G+HVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGRHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSD SVG A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGGAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI  DGMMPSDT+VGIA+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHADGMMPSDTTVGIAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+F+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG   D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSGRDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG+A DSFNTFFSET SGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTTVGVATDSFNTFFSETSSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVG+ IVD+CLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGRGIVDICLDR  121



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD++ G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLIS KEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISDKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDT+VGIA+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTTVGIAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSGAYR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   224 bits (571),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>dbj|BAJ86161.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLIS  EDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLDR  121



>gb|ABD92939.1| alpha tubulin-5D [Triticum aestivum]
 gb|ABD92941.1| alpha tubulin-5B [Triticum aestivum]
Length=449

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLIS  EDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLDR  121



>gb|ABD92940.1| alpha tubulin-5A [Triticum aestivum]
Length=449

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLIS  EDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLDR  121



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CW LYCLEHGIQPDGMMPSD+S G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWGLYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   221 bits (564),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI  DG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGINQDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G+  D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AFW89176.1| hypothetical protein ZEAMMB73_322393 [Zea mays]
Length=448

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVGIA D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGIARDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEV++GAYR LFHPEQLIS KEDAA NFARGHYTVG++++DLCLDR
Sbjct  64   RALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVIDLCLDR  121



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G  +DSFNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTSVG A+D+FNTFFSET SGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSVGAAHDAFNTFFSETSSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQL+SGKEDAA NFARGHYTVGK+IVDLC+DR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVDR  121



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGGGHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG+  D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDT+ G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTTPGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGI+ DG MPSD+SVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQ DG MPSDT+VG+A+D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCL R
Sbjct  64   RAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLGR  121



>gb|KDO55010.1| hypothetical protein CISIN_1g0157541mg, partial [Citrus sinensis]
Length=353

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG  +D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGACHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEP+V+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD26889.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=438

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQ GNACWELYCLEHGI+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQGGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQP+G MPSDTSVG   DSFNTFFSETGSG HVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPNGTMPSDTSVGSETDSFNTFFSETGSGSHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DE+R+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_002763662.3| PREDICTED: tubulin alpha chain-like, partial [Callithrix jacchus]
Length=178

 Score =   216 bits (549),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVH+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  52   ISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  111

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTVVDEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+IVDL LDR
Sbjct  112  AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDR  168



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MP D +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTS G A+D+FNTFFSET SGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQL+SGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCLDR  121



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGN+CWELYCLEH I PDG MPSDTS+G+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSMGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTS+G+ +DSFNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGVEHDSFNTFFSETRAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSG YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_005466564.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   214 bits (545),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVH+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVRSG YR LFHPEQLI+GKEDAA N+ARGHYT+GK+I+DL LDR
Sbjct  65   AVFVDLEPTVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDR  121



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCL HGI+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLGHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSDTSVG+A+D+F+TFFSETGSGKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGK DAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKADAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD +VG+ +D+FNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNTVGVGHDAFNTFFSETSAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDGMMPSD ++G+A+D+FNTFFSET +G+HVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGRHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETGSGKHVP 
Sbjct  55   ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGSGKHVPR  114

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  115  AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  171



>ref|XP_003392163.2| PREDICTED: tubulin alpha chain, testis-specific-like, partial 
[Amphimedon queenslandica]
Length=163

 Score =   214 bits (546),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTVVDEVR+G YR LFHPEQLI+GKEDAA N+ARGHYTVGKD+VDL LDR
Sbjct  65   AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKDLVDLVLDR  121



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  3    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  62

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  63   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  119



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG  +D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGACHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEP+V+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_002609253.1| hypothetical protein BRAFLDRAFT_86837 [Branchiostoma floridae]
 gb|EEN65263.1| hypothetical protein BRAFLDRAFT_86837, partial [Branchiostoma 
floridae]
Length=125

 Score =   213 bits (542),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTVVDEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+IVDL LDR
Sbjct  65   AVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDR  121



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQ+GN+CWELYCLEHGIQPDG+MPSDTS G+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQLGNSCWELYCLEHGIQPDGLMPSDTSPGVARDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LC+DR
Sbjct  64   RALFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCIDR  121



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|XP_001427644.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60246.1| unnamed protein product [Paramecium tetraurelia]
Length=189

 Score =   215 bits (547),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+H+GQ GIQVGNACWEL+CLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GKHVP
Sbjct  4    VISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVF+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWELYCLEHGIQPDG+M SDTS+G  +DSFNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMSSDTSIGSEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDR  121



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   221 bits (563),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002675196.1| alpha-tubulin [Naegleria gruberi]
 ref|XP_002677003.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 ref|XP_002680089.1| alpha-tubulin [Naegleria gruberi]
 sp|P11237.1|TBA1_NAEGR RecName: Full=Tubulin alpha-1/2/3 chain [Naegleria gruberi]
 emb|CAA31074.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31075.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31076.1| unnamed protein product [Naegleria gruberi]
 gb|EFC42452.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44259.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 gb|EFC47345.1| alpha-tubulin [Naegleria gruberi]
Length=453

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAG+QVGNACWELYCLEHGIQPDG+MPSD ++G+ +D+FNTFFSETG+GKHVP
Sbjct  4    VISIHIGQAGVQVGNACWELYCLEHGIQPDGLMPSDKTIGVEDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVF+DLEPTVVDEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+IVDLCLDR
Sbjct  64   RAVFLDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLDR  121



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETGSGKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEH IQPDGMMPSDTS G A+D+FNTFFSET SGKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQL+SGKEDAA NFARGHYTVGK+IVDLC+DR
Sbjct  64   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVDR  121



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSDT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGNACWELYCLEHGIQPDG M SDTSV + +D+FNTFFSETG+GKHVP
Sbjct  4    IISIHIGQAGIQVGNACWELYCLEHGIQPDGRMSSDTSVVVGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AAI59362.1| Unknown (protein for MGC:185872) [Xenopus (Silurana) tropicalis]
Length=145

 Score =   213 bits (541),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLI+GKEDAA N++RGHYT+GK+I+DL LDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYSRGHYTIGKEIIDLVLDR  121



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI  DG MPSDT+VGIA+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGINTDGTMPSDTTVGIAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSGAYR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|XP_003979912.1| PREDICTED: tubulin alpha-1D chain-like, partial [Takifugu rubripes]
Length=121

 Score =   212 bits (539),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAG+Q+GNACWELYCLEHGIQPDG+MPSD +VG  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGVQIGNACWELYCLEHGIQPDGLMPSDKTVGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLI+GKEDAA N+ARGHYTVGK+++D+ LDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDVVLDR  121



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_005932718.1| PREDICTED: tubulin alpha chain-like [Haplochromis burtoni]
Length=142

 Score =   213 bits (541),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+I+DL LDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDR  121



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD SVG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GKHVP
Sbjct  4    VISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
              +F+DLEPTVVDEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDL LDR
Sbjct  64   RCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALDR  121



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD ++G  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWELYCLEH I PDG MPSDTSVG+A+D+FNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTVGREIVNLCLDR  121



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSDTSVG+ +DSFNTFFSETG GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGLGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQL+SGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RAIFVDLEPSVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGREIVELCLDR  121



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|EPZ32931.1| Tubulin domain-containing protein [Rozella allomycis CSF55]
Length=144

 Score =   212 bits (540),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             VFVDLEPTVVDEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+IVDL LDR
Sbjct  65   TVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDR  121



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHG+QPDG MP DTSVG+ +DSFNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGMQPDGTMPGDTSVGMEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>emb|CBH08957.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=175

 Score =   213 bits (543),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            I +HIGQAG QVGNACWEL+CLEHGIQPDG MPSD ++G+ +D+FNTFFSETG+GKHVP 
Sbjct  5    ICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTVVDEVR+G YR LFHPEQLISGKEDAA N+ARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDR  121



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_003793694.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=142

 Score =   212 bits (540),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+I+DL LDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDR  121



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD + G  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_005466520.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   212 bits (539),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+H+GQAG+Q+GNACWELYCLEHGIQPDG MPSD ++G  +DSFNTFFSETG+GKHVP 
Sbjct  5    ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLI+GKEDAA N+ARGHYT+GK+I+DL LDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDR  121



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IISVHIGQAGIQVGN+CWELYCLEHGIQPDGMMPSDTS G A+D+FNTFFSETG+GK VP
Sbjct  22   IISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGKRVP  81

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLD  406
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLD
Sbjct  82   RAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  138



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQ DG MP D ++G  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MP DT+VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            +IS+HIGQAGIQVGN+CWEL+CLEHGIQ DGMMPSDTS+G  +DSFNTFFSETGSGKHVP
Sbjct  4    VISIHIGQAGIQVGNSCWELFCLEHGIQQDGMMPSDTSIGAEHDSFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             AVF+DLEPTV+DE+R+G YR LFHPEQL++GKEDAA NFARGHYTVGKD++DLCLDR
Sbjct  64   RAVFIDLEPTVIDEIRTGPYRQLFHPEQLLTGKEDAANNFARGHYTVGKDMIDLCLDR  121



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            ISVHIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MP D +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVRSGAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|EKF30131.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=212

 Score =   214 bits (545),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            I +HIGQAG QVGNACWEL+CLEHGIQPDG MPSD ++G+ +D+FNTFFSETG+GKHVP 
Sbjct  5    ICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTVVDE+R+G YR LFHPEQLISGKEDAA N+ARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVVDEIRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDR  121



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLE+GI+PDG MPSDTSVG  +D+FNTFFSETGSG+HVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEYGIEPDGTMPSDTSVGADDDAFNTFFSETGSGQHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVR+G+YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>emb|CCC46467.1| putative alpha tubulin, fragment, partial [Trypanosoma vivax 
Y486]
Length=263

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            I +HIGQAG QVGNACWEL+CLEHGIQPDG MPSD ++G+ +D+FNTFFSETG+GKHVP 
Sbjct  5    ICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVF+DLEPTVVDEVR+G YR LFHPEQLISGKEDAA N+ARGHYT+GK+IVDLCLDR
Sbjct  65   AVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDR  121



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGI+PDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+GAYR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            A+FVDLEPTV+DEVRSG YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI PDG MPSDTSVGIA+D+FNTFFSETG GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGIAHDAFNTFFSETGFGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>ref|XP_003558477.1| PREDICTED: tubulin alpha-2 chain [Brachypodium distachyon]
Length=449

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEV++G YR LFHPEQLIS  EDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVKTGLYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLDR  121



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_004985171.1| PREDICTED: tubulin alpha-2 chain-like [Setaria italica]
Length=448

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDTSVG+A D+FNTFFSET +GKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVARDAFNTFFSETSAGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEV++G YR LFHPEQLIS KEDAA NFARGHYTVG+++VDLCLDR
Sbjct  64   RALFVDLEPTVIDEVKTGTYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLDR  121



>gb|AGV54497.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=449

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQVGN+CWELYCLEHGI  DG MPSDT+VGIA+D+FNTFFSETGSGKHVP
Sbjct  4    IISIHIGQAGIQVGNSCWELYCLEHGINTDGTMPSDTTVGIAHDAFNTFFSETGSGKHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEP+V+DEVRSGAYR LFHPEQLISGKEDAA NFARGHYTVG++IV+LCLDR
Sbjct  64   RALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDR  121



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  56   IISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVP  235
            IIS+HIGQAGIQ GNACWELYCLEH I+PDG MPSDTSVG A+D+FNTFFSETGSG+HVP
Sbjct  4    IISIHIGQAGIQGGNACWELYCLEHSIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQHVP  63

Query  236  XAVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
             A+FVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYTVGK+IVDLCLDR
Sbjct  64   RAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDR  121



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  59   ISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGIANDSFNTFFSETGSGKHVPX  238
            IS+HIGQAGIQVGNACWELYCLEHGIQPDG MPSD +VG  +D+FNTFFSETG+GKHVP 
Sbjct  5    ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPR  64

Query  239  AVFVDLEPTVVDEVRSGAYRXLFHPEQLISGKEDAAXNFARGHYTVGKDIVDLCLDR  409
            AVFVDLEPTV+DEVR+G YR LFHPEQLISGKEDAA NFARGHYT+GK+IVDLCLDR
Sbjct  65   AVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564491502050