BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF005C21

Length=388
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...  73.6    1e-12   Nicotiana sylvestris
gb|KDO46793.1|  hypothetical protein CISIN_1g012238mg                 70.9    7e-12   Citrus sinensis [apfelsine]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg           70.9    1e-11   Citrus clementina [clementine]
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...  70.9    1e-11   Nicotiana tomentosiformis
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                 70.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...  68.6    8e-11   Populus euphratica
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...  67.8    2e-10   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein      67.4    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein      66.6    3e-10   
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like   64.7    1e-09   Solanum tuberosum [potatoes]
ref|XP_010089944.1|  Aspartate aminotransferase                       64.7    2e-09   
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...  64.7    2e-09   Solanum lycopersicum
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...  63.5    4e-09   Populus euphratica
ref|XP_008378725.1|  PREDICTED: aspartate aminotransferase P2, mi...  60.1    6e-09   Malus domestica [apple tree]
gb|KJB55006.1|  hypothetical protein B456_009G060500                  62.4    1e-08   Gossypium raimondii
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...  62.4    1e-08   Gossypium arboreum [tree cotton]
gb|KJB55010.1|  hypothetical protein B456_009G060500                  61.2    2e-08   Gossypium raimondii
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...  61.6    2e-08   Fragaria vesca subsp. vesca
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...  60.8    4e-08   Lupinus angustifolius
gb|AFP86894.1|  aspartate aminotransferase                            60.1    5e-08   Ilex paraguariensis [Brazilian-tea]
ref|XP_007011759.1|  Aspartate aminotransferase                       60.5    5e-08   
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                60.1    6e-08   Canavalia lineata
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg           60.1    6e-08   Prunus persica
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...  60.1    7e-08   Cucumis sativus [cucumbers]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...  60.1    7e-08   Cucumis melo [Oriental melon]
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...  59.7    8e-08   Malus domestica [apple tree]
emb|CAA04697.1|  aspartate aminotransferase 2                         59.7    1e-07   Canavalia lineata
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...  58.9    2e-07   Prunus mume [ume]
gb|KDP33541.1|  hypothetical protein JCGZ_07112                       58.5    2e-07   Jatropha curcas
gb|KJB55007.1|  hypothetical protein B456_009G060500                  58.5    2e-07   Gossypium raimondii
ref|XP_002515455.1|  aspartate aminotransferase, putative             57.8    3e-07   Ricinus communis
gb|KHG09550.1|  Aspartate aminotransferase, chloroplastic -like p...  57.0    5e-07   Gossypium arboreum [tree cotton]
emb|CAN76227.1|  hypothetical protein VITISV_000267                   57.4    5e-07   Vitis vinifera
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...  57.4    5e-07   Vitis vinifera
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...  57.4    5e-07   Eucalyptus grandis [rose gum]
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...  57.4    5e-07   
emb|CAN64661.1|  hypothetical protein VITISV_034785                   57.0    6e-07   Vitis vinifera
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...  57.0    7e-07   Elaeis guineensis
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...  56.6    9e-07   Cicer arietinum [garbanzo]
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...  56.6    9e-07   Nelumbo nucifera [Indian lotus]
gb|KJB55009.1|  hypothetical protein B456_009G060500                  56.6    1e-06   Gossypium raimondii
ref|XP_006495466.1|  PREDICTED: aspartate aminotransferase, chlor...  53.5    1e-06   Citrus sinensis [apfelsine]
gb|KJB65891.1|  hypothetical protein B456_010G117400                  55.1    3e-06   Gossypium raimondii
gb|KJB65890.1|  hypothetical protein B456_010G117400                  55.1    3e-06   Gossypium raimondii
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...  55.1    3e-06   Cucumis melo [Oriental melon]
gb|ABN48559.1|  chloroplast aspartate aminotransferase                52.0    4e-06   Brassica juncea [brown mustard]
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                   54.7    5e-06   Eucalyptus grandis [rose gum]
emb|CDP18792.1|  unnamed protein product                              54.7    5e-06   Coffea canephora [robusta coffee]
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...  53.9    8e-06   
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                 53.5    8e-06   Citrus sinensis [apfelsine]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...  53.5    9e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001048397.1|  Os02g0797500                                     53.1    1e-05   
gb|AAB46611.1|  aspartate aminotransferase                            53.1    1e-05   Medicago sativa [alfalfa]
gb|KEH39860.1|  aspartate aminotransferase                            53.1    1e-05   Medicago truncatula
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...  53.1    1e-05   Brachypodium distachyon [annual false brome]
prf||1908424A  Asp aminotransferase                                   53.1    1e-05
prf||2009357A  Asp aminotransferase                                   53.1    1e-05
dbj|BAA08106.1|  plastidic aspartate aminotransferase                 52.8    2e-05   Panicum miliaceum [broom millet]
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...  52.8    2e-05   Phoenix dactylifera
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...  52.8    2e-05   Tarenaya hassleriana [spider flower]
gb|AAC12674.1|  aspartate aminotransferase                            52.8    2e-05   Lotus corniculatus
gb|ACR34530.1|  unknown                                               52.4    2e-05   Zea mays [maize]
ref|NP_001149005.1|  aspartate aminotransferase                       52.4    2e-05   
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...  52.4    2e-05   Setaria italica
dbj|BAJ96638.1|  predicted protein                                    51.6    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92741.1|  predicted protein                                    51.6    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580        51.6    5e-05   Amborella trichopoda
emb|CDX72339.1|  BnaC07g43610D                                        51.2    5e-05   
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...  51.2    5e-05   Brassica rapa
emb|CDY13467.1|  BnaA03g51850D                                        51.2    5e-05   Brassica napus [oilseed rape]
gb|AAO23563.1|  aspartate aminotransferase                            50.8    7e-05   Oryza sativa [red rice]
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...  50.8    8e-05   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                        50.8    8e-05   
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...  50.8    8e-05   Camelina sativa [gold-of-pleasure]
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                  50.4    1e-04   Phaseolus vulgaris [French bean]
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg           49.7    2e-04   
ref|NP_001031767.1|  aspartate aminotransferase                       49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ACU24502.1|  unknown                                               49.7    2e-04   Glycine max [soybeans]
gb|AAM67272.1|  aspartate aminotransferase                            49.3    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                          49.3    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg           49.3    2e-04   Capsella rubella
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537           49.3    2e-04   
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg           49.3    2e-04   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...  49.3    2e-04   Glycine max [soybeans]
emb|CAA56932.1|  aspartate aminotransferase                           49.3    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...  49.3    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...  49.3    2e-04   Camelina sativa [gold-of-pleasure]
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                  49.3    2e-04   Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                       49.3    2e-04   
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...  49.3    2e-04   Glycine max [soybeans]
gb|ACN40845.1|  unknown                                               49.3    3e-04   Picea sitchensis
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial          49.3    3e-04   Glycine soja [wild soybean]
gb|ABK24563.1|  unknown                                               48.9    3e-04   Picea sitchensis
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...  48.9    3e-04   
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...  48.5    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...  48.5    4e-04   
gb|ABR16448.1|  unknown                                               48.1    5e-04   Picea sitchensis



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  332
            M ST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M   VNVS
Sbjct  1    MVSTMFSLASATPSASFSLQDNLKSKLKLGTTSQSAFFGKDFVKAKSNGRTTMTVAVNVS  60

Query  333  RFEGISMAPPDPILGVSE  386
            RFEGI+MAPPDPILGVSE
Sbjct  61   RFEGITMAPPDPILGVSE  78



>gb|KDO46793.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=363

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  341
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  342  GISMAPPDPILGVSE  386
            G++MAPPDPILGVSE
Sbjct  61   GVTMAPPDPILGVSE  75



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  341
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  342  GISMAPPDPILGVSE  386
            G++MAPPDPILGVSE
Sbjct  61   GVTMAPPDPILGVSE  75



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  332
            MAST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M  +VNVS
Sbjct  1    MASTMFSLASAAPSASFSLQDNLKSKLKLGTTSQSAFFGKDFAKAKSNGRTTMAVSVNVS  60

Query  333  RFEGISMAPPDPILGVSE  386
            RFEGI+MAPPDPILGVSE
Sbjct  61   RFEGITMAPPDPILGVSE  78



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  341
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  342  GISMAPPDPILGVSE  386
            G++MAPPDPILGVSE
Sbjct  61   GVTMAPPDPILGVSE  75



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFG-------NATKSHGRMRMVAT  320
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF        N  KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKTRLGSGSVSTLFNKEKGNPSNKKKSFGRISMTVA  60

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VNVSRFEGI+MAPPDPILGVSE
Sbjct  61   VNVSRFEGIAMAPPDPILGVSE  82



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +3

Query  150  SPITMASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVA  317
            S   MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+GR  M  
Sbjct  4    SSFAMASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGRTTMAV  62

Query  318  TVNVSRFEGISMAPPDPILGVSE  386
             VNVSRFEGI+MAPPDPILGVSE
Sbjct  63   AVNVSRFEGITMAPPDPILGVSE  85



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 58/82 (71%), Gaps = 7/82 (9%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GNAT---KSHGRMRMVAT  320
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF    GN +   KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKMRLGSSSVSTLFNKEKGNPSIKKKSFGRISMTVA  60

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VNVSRFEGI+MAPPDPILGVSE
Sbjct  61   VNVSRFEGIAMAPPDPILGVSE  82



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  320
            MAST+ +LAS +PS SLS+Q+ LK K +L      TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASTTPSASLSMQEILKGKARLGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VNVSRFEGI+MAPPDPILGVSE
Sbjct  61   VNVSRFEGIAMAPPDPILGVSE  82



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVATVNV  329
            MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+G+  M   VNV
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGQTTMAVAVNV  59

Query  330  SRFEGISMAPPDPILGVSE  386
            SRFEGI+MAPPDPILGVSE
Sbjct  60   SRFEGITMAPPDPILGVSE  78



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 7/62 (11%)
 Frame = +3

Query  219  QDKLKAKPKLREYG------QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGV  380
            Q+ LK K KLR  G      +   F N  KS GR+ MVA VN SRF+GI+MAPPDPILGV
Sbjct  22   QESLKGKLKLRSSGLSFTKEKINPFANG-KSFGRVSMVAAVNASRFDGIAMAPPDPILGV  80

Query  381  SE  386
            SE
Sbjct  81   SE  82



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  332
            MAST+F+LAS +PS S+SLQD LK K K+    Q    G      KS+GR  M   VNVS
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKIGTSSQRAFPGKDFMKAKSNGRTTMAVAVNVS  60

Query  333  RFEGISMAPPDPILGVSE  386
            RFEGI+MAP DPILGVSE
Sbjct  61   RFEGITMAPADPILGVSE  78



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  320
            MAST+ +LASA+PS SLS+Q+ LK K +       TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASATPSASLSMQEILKGKARPGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VNVSRFEGI+MAPPDPILGVSE
Sbjct  61   VNVSRFEGIAMAPPDPILGVSE  82



>ref|XP_008378725.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
 ref|XP_008378741.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
Length=126

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSE
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSE  80



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  320
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  321  VNVSRFEGISMAPPDPILGVSE  386
             NVSRFEGI+MAP DPILGVSE
Sbjct  59   SNVSRFEGITMAPSDPILGVSE  80



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  320
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F           KS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKIKSFGRISMVVA  58

Query  321  VNVSRFEGISMAPPDPILGVSE  386
             NVSRFEGI+MAPPDPILGVSE
Sbjct  59   SNVSRFEGITMAPPDPILGVSE  80



>gb|KJB55010.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=339

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  320
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  321  VNVSRFEGISMAPPDPILGVSE  386
             NVSRFEGI+MAP DPILGVSE
Sbjct  59   SNVSRFEGITMAPSDPILGVSE  80



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  219  QDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
             D  K K KL    +  LF N T+S GR+ MVA V  SRF+G++MAPPDPILGVSE
Sbjct  15   HDTHKGKIKLGSLERSNLFLN-TQSAGRVSMVAAVKTSRFDGVTMAPPDPILGVSE  69



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +3

Query  222  DKLKAKPKLREYG--QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            DKLK       +   Q   F NA KS  R+ MVA VNVSRFEGI MAPPDPILGVSE
Sbjct  15   DKLKVGGNSLRFSKEQSNTFSNA-KSSCRISMVAAVNVSRFEGIPMAPPDPILGVSE  70



>gb|AFP86894.1| aspartate aminotransferase, partial [Ilex paraguariensis]
Length=368

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 36/63 (57%), Gaps = 7/63 (11%)
 Frame = +3

Query  219  QDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVATVNVSRFEGISMAPPDPILG  377
            QD LK K KL      +  G         TK+ GR+ M   V VSRFE I+MAPPDPILG
Sbjct  21   QDTLKTKLKLTSSNHTSFLGKGKSVPFTNTKTFGRITMAVAVKVSRFESITMAPPDPILG  80

Query  378  VSE  386
            VSE
Sbjct  81   VSE  83



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TKS GR+ MV T NVSRFEGI+MAPPDPILGVSE
Sbjct  47   TKSFGRISMVITSNVSRFEGITMAPPDPILGVSE  80



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  320
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  321  VNVSRFEGISMAPPDPILGVSE  386
             NVSRFEGI MAPPDPILGVSE
Sbjct  60   DNVSRFEGIPMAPPDPILGVSE  81



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSE
Sbjct  47   TESFGRISMVAAVNVSKFEGVTMAPPDPILGVSE  80



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSE
Sbjct  48   KSFSRISMVASVNVSRFEGITMAPPDPILGVSE  80



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSE
Sbjct  49   KSFSRISMVASVNVSRFEGITMAPPDPILGVSE  81



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSE
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSE  80



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  320
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  321  VNVSRFEGISMAPPDPILGVSE  386
             NVSRFEGI MAPPDPILGVSE
Sbjct  60   DNVSRFEGIPMAPPDPILGVSE  81



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            T+S GR+ MVA VNVS+FEG+++APPDPILGVSE
Sbjct  47   TESFGRISMVAAVNVSKFEGVTLAPPDPILGVSE  80



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  320
            MAS++ +LAS SPS SLS+ + LK K +       T F          TKS GR+ M   
Sbjct  1    MASSMLSLASTSPSASLSVHETLKGKVRHGTGSLTTWFNKEKANRFRNTKSPGRISMAIA  60

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VNVSRFEGI+MAPPDPILGVSE
Sbjct  61   VNVSRFEGITMAPPDPILGVSE  82



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 53/84 (63%), Gaps = 9/84 (11%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQD--KLKAKPKLREYGQCTLFGN-------ATKSHGRMRMV  314
            MAS+VF+LASA+PS SLS  D  K+ ++ KL        F          TKS GR+ MV
Sbjct  1    MASSVFSLASATPSASLSSHDIEKISSQGKLNLRNTSLCFKKEKNNPFMKTKSFGRISMV  60

Query  315  ATVNVSRFEGISMAPPDPILGVSE  386
               NVSRFEGI+MAP DPILGVSE
Sbjct  61   VASNVSRFEGITMAPSDPILGVSE  84



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  320
            MAS++F+LA AS S S+   D LK K +L      T F          TKS GR+ M A 
Sbjct  1    MASSMFSLAGASLSPSM--HDTLKEKVRLGSGSIGTWFTKDKVHSFMKTKSSGRISMTAA  58

Query  321  VNVSRFEGISMAPPDPILGVSE  386
            VN+SRFEGI+MA PDPILGVSE
Sbjct  59   VNISRFEGITMALPDPILGVSE  80



>gb|KHG09550.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=332

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
             KS GR+ MV   NVSRFEGI+MAPPDPILGVSE
Sbjct  43   AKSFGRVSMVVASNVSRFEGITMAPPDPILGVSE  76



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TKS GR+ M   VN SRFEG++MAPPDPILGVSE
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSE  78



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TKS GR+ M   VN SRFEG++MAPPDPILGVSE
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSE  78



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TK  GR+ M   VNVSRFEGI+MAPPDPILGVSE
Sbjct  45   TKHFGRVSMSVAVNVSRFEGITMAPPDPILGVSE  78



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSE
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSE  70



>emb|CAN64661.1| hypothetical protein VITISV_034785 [Vitis vinifera]
Length=420

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TKS GR+ M   VN SRFEG++MAPPDPILGVSE
Sbjct  23   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSE  56



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSE
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSE  70



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  273  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            F N ++S GR+ M   VNVSRFEGI MAPPDPILGVSE
Sbjct  47   FSN-SRSSGRISMAVAVNVSRFEGIPMAPPDPILGVSE  83



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 10/84 (12%)
 Frame = +3

Query  165  ASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF-------GNAT---KSHGRMRMV  314
            +ST+ +L SASP   L++ +  K  P+  ++G   L        GN++   +S GR+ M 
Sbjct  3    SSTILSLGSASPLALLAVSENSKVPPQKVKFGSSGLTNSFLKAKGNSSLKSQSFGRISMT  62

Query  315  ATVNVSRFEGISMAPPDPILGVSE  386
              VNVSRFEG++MAPPDPILGVSE
Sbjct  63   VAVNVSRFEGVTMAPPDPILGVSE  86



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  285  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            TKS GR+ MV   NVSRFEGI+MAP DPILGVSE
Sbjct  79   TKSFGRISMVVASNVSRFEGITMAPSDPILGVSE  112



>ref|XP_006495466.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Citrus 
sinensis]
Length=113

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            MVA VNVSRFEG++MAPPDPILGVSE
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSE  26



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS GR+ MV   NVS FEGI+MAPPDPILGVSE
Sbjct  44   KSFGRVSMVVASNVSHFEGITMAPPDPILGVSE  76



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS GR+ MV   NVS FEGI+MAPPDPILGVSE
Sbjct  44   KSFGRVSMVVASNVSHFEGITMAPPDPILGVSE  76



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/26 (92%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            MVA+VNVSRFEGI+MAPPDPILGVSE
Sbjct  1    MVASVNVSRFEGITMAPPDPILGVSE  26



>gb|ABN48559.1| chloroplast aspartate aminotransferase [Brassica juncea]
Length=135

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  341
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  342  GISMAPPDPILGVSE  386
            GI+MAPPDPILGVSE
Sbjct  55   GITMAPPDPILGVSE  69



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            K  GR+ M   VNVSRFEGI++APPDPILGVSE
Sbjct  104  KHFGRVSMTVAVNVSRFEGITIAPPDPILGVSE  136



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = +3

Query  237  KPKLREYGQCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KPKL    Q ++FG     T+S  R  M   +NVSRFE I+MAPPDPILGVSE
Sbjct  115  KPKL--LNQASVFGKRFVNTESFTRTTMAVALNVSRFESITMAPPDPILGVSE  165



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  RMRMVATVNVSRFEGISMAPPDPILGVSE  386
            R+ M  +VNVSRFEG++MAPPDPILGVSE
Sbjct  13   RVSMTVSVNVSRFEGVTMAPPDPILGVSE  41



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            MVA VNVSRFEG++MAPPDPILGVSE
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSE  26



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            +S  R+ MVATVN SRF+G+SMAP DPILGVSE
Sbjct  43   QSFSRVSMVATVNASRFDGVSMAPADPILGVSE  75



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  264  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            C L G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  35   CRL-GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSE  74



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            +S GR+ M    NVSRFEGI MAPPDPILGVSE
Sbjct  39   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSE  71



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            +S GR+ M    NVSRFEGI MAPPDPILGVSE
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSE  81



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G A K+ GR+ M   V+ SRFEG+ MAPPDPILGVSE
Sbjct  35   GIARKNFGRVVMALAVDTSRFEGVPMAPPDPILGVSE  71



>prf||1908424A Asp aminotransferase
Length=465

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            +S GR+ M    NVSRFEGI MAPPDPILGVSE
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSE  81



>prf||2009357A Asp aminotransferase
Length=463

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            +S GR+ M    NVSRFEGI MAPPDPILGVSE
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSE  81



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  37   GITRKNFGRVLMALAVDVSRFEGVPMAPPDPILGVSE  73



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            K+ GR+ +   VNVSRFE ++MAPPDPILGVSE
Sbjct  38   KAFGRVSLAVAVNVSRFESVTMAPPDPILGVSE  70



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  341
            MAST F+L SAS        DK     KL   G    F   TKS GR+ M   V  SRF+
Sbjct  1    MASTTFSLVSASVFPREISVDK----QKLGNSGSNAFF--KTKSFGRVTMSIAVKTSRFD  54

Query  342  GISMAPPDPILGVSE  386
            GI+MAP DPILGVSE
Sbjct  55   GITMAPADPILGVSE  69



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  GRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            GR+ M   VN SRFEGI MAPPDPILGVSE
Sbjct  44   GRISMAVAVNASRFEGIPMAPPDPILGVSE  73



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSE  75



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSE  75



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  38   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSE  74



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSE
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSE  73



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSE
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSE  73



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            ++ G + M   VNVSRFEG++MAPPDPILGVSE
Sbjct  53   QNSGGVTMTVAVNVSRFEGVTMAPPDPILGVSE  85



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 16/80 (20%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATVN  326
            MAS++ +L S S       +DKLK     + P LR           TKS  R+ M  +V 
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPSGSNPFLR-----------TKSLSRVTMSVSVK  49

Query  327  VSRFEGISMAPPDPILGVSE  386
             SRFEGI+MAPPDPILGVSE
Sbjct  50   PSRFEGITMAPPDPILGVSE  69



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 16/80 (20%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATVN  326
            MAS++ +L   S       +DKLK     + P LR           TKS  R+ M  +V 
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPSGSNPFLR-----------TKSLSRVTMSVSVK  49

Query  327  VSRFEGISMAPPDPILGVSE  386
             SRFEGI+MAPPDPILGVSE
Sbjct  50   PSRFEGITMAPPDPILGVSE  69



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 16/80 (20%)
 Frame = +3

Query  162  MASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATVN  326
            MAS++ +L S S       +DKLK     + P LR           TKS  R+ M  +V 
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPSGSNPFLR-----------TKSLSRVTMSVSVK  49

Query  327  VSRFEGISMAPPDPILGVSE  386
             SRFEGI+MAPPDPILGVSE
Sbjct  50   PSRFEGITMAPPDPILGVSE  69



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  GRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            GR+ M   V+VSRFEG+ MAPPDPILGVSE
Sbjct  1    GRVMMALAVDVSRFEGVPMAPPDPILGVSE  30



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSE  69



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 48/86 (56%), Gaps = 17/86 (20%)
 Frame = +3

Query  147  PSP-ITMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMR  308
            P+P ++MAS++ +L S S       +DKLK     + P L+            KS  R+ 
Sbjct  37   PNPALSMASSMLSLGSTSLLPREISKDKLKLGTSGSNPFLK-----------AKSFSRVT  85

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   V  SRFEGI+MAPPDPILGVSE
Sbjct  86   MTVAVKPSRFEGITMAPPDPILGVSE  111



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 6/55 (11%)
 Frame = +3

Query  231  KAKPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            K KPK+   G    F  +    +S GR+  VA VN SRFEGI MAPPDPILGVSE
Sbjct  26   KGKPKIG--GNALRFNKSFPNARSSGRVMAVA-VNGSRFEGIPMAPPDPILGVSE  77



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMAVAVTPSRFEGITMAPPDPILGVSE  69



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  RMRMVATVNVSRFEGISMAPPDPILGVSE  386
            R+ M    +VSRFEG++MAPPDPILGVSE
Sbjct  41   RINMALATDVSRFEGVTMAPPDPILGVSE  69



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M   VNVSRFEGI MAPPDPILGVSE
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSE  79



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  RMRMVATVNVSRFEGISMAPPDPILGVSE  386
            R+ M    +VSRFEG++MAPPDPILGVSE
Sbjct  52   RINMALATDVSRFEGVTMAPPDPILGVSE  80



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  276  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            G   K+ GR+ M   V+VSRFE + MAPPDPILGVSE
Sbjct  2    GITRKNFGRVMMALAVDVSRFEIVPMAPPDPILGVSE  38



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  288  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            KS  R+ M   V  SRFEGI+MAPPDPILGVSE
Sbjct  37   KSISRVTMTVAVKPSRFEGITMAPPDPILGVSE  69



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 3/45 (7%)
 Frame = +3

Query  261  QCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSE  386
            Q TLFG      KS  R  + + V VSRF  I+MAPPDPILGVSE
Sbjct  23   QSTLFGKDYIRAKSFTRKSVTSAVEVSRFGDITMAPPDPILGVSE  67



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  309  MVATVNVSRFEGISMAPPDPILGVSE  386
            M    NVSRFEG+ MAPPDPILGVSE
Sbjct  1    MAVATNVSRFEGVKMAPPDPILGVSE  26



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563429479010