BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004O23

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010041882.1|  PREDICTED: heat shock 70 kDa protein cognate...    124   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010456364.1|  PREDICTED: probable mediator of RNA polymera...    125   2e-34   
ref|XP_010423854.1|  PREDICTED: probable mediator of RNA polymera...    127   3e-34   Camelina sativa [gold-of-pleasure]
gb|AAC84134.1|  heat shock protein                                      125   5e-34   Cichorium intybus [radicchio]
gb|KDO67651.1|  hypothetical protein CISIN_1g0212721mg                  124   5e-34   Citrus sinensis [apfelsine]
gb|AAA32820.1|  heat shock protein HSP70-2                              124   5e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30764.1|  Heat shock cognate 70 kDa                               123   6e-34   Gossypium arboreum [tree cotton]
gb|KHG18124.1|  Heat shock cognate 70 kDa                               123   7e-34   Gossypium arboreum [tree cotton]
gb|AFV46216.1|  hypothetical protein                                    127   1e-33   Scutellaria baicalensis [Baikal skullcap]
gb|AAA32819.1|  heat shock protein HSP70-1                              123   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EAY81902.1|  hypothetical protein OsI_37074                          122   1e-33   Oryza sativa Indica Group [Indian rice]
gb|EAY89449.1|  hypothetical protein OsI_10981                          122   2e-33   Oryza sativa Indica Group [Indian rice]
emb|CAA78036.1|  70-kD heat shock protein                               122   2e-33   Solanum tuberosum [potatoes]
emb|CDY02235.1|  BnaA03g39320D                                          125   2e-33   
emb|CAA54420.1|  heat shock cognate 70-2                                122   2e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAA78037.1|  70-Kd heat shock protein                               121   2e-33   Solanum tuberosum [potatoes]
ref|XP_010423867.1|  PREDICTED: heat shock 70 kDa protein 18-like       122   3e-33   Camelina sativa [gold-of-pleasure]
emb|CDX89754.1|  BnaC03g46680D                                          125   3e-33   
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   127   3e-33   Citrus sinensis [apfelsine]
emb|CDY36723.1|  BnaC02g31440D                                          124   8e-33   Brassica napus [oilseed rape]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    127   1e-32   Arabis alpina [alpine rockcress]
emb|CDY53148.1|  BnaAnng12070D                                          124   2e-32   Brassica napus [oilseed rape]
gb|ADB85325.1|  putative heat shock cognate                             120   2e-32   Phyllostachys edulis [kikko-chiku]
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    127   2e-32   Populus euphratica
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     129   3e-32   Eucalyptus grandis [rose gum]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     129   3e-32   Eucalyptus grandis [rose gum]
gb|EPS64948.1|  hypothetical protein M569_09829                         128   3e-32   Genlisea aurea
emb|CDY16175.1|  BnaA09g29090D                                          124   3e-32   Brassica napus [oilseed rape]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    127   4e-32   Camelina sativa [gold-of-pleasure]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       127   4e-32   Medicago truncatula
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          126   4e-32   
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       127   5e-32   Glycine soja [wild soybean]
ref|XP_001751923.1|  predicted protein                                  127   5e-32   
ref|XP_001783048.1|  predicted protein                                  127   5e-32   
ref|XP_001767839.1|  predicted protein                                  127   5e-32   
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   5e-32   Glycine max [soybeans]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         127   5e-32   Jatropha curcas
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   5e-32   Elaeis guineensis
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       127   5e-32   Cucumis melo [Oriental melon]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     127   5e-32   
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         127   5e-32   Jatropha curcas
ref|XP_002316294.1|  heat shock protein 70                              127   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Populus euphratica
gb|AIZ68155.1|  heat shock protein 70                                   127   6e-32   Ornithogalum longebracteatum [sea-onion]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    127   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002527736.1|  heat shock protein, putative                       127   6e-32   Ricinus communis
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Nicotiana tomentosiformis
ref|XP_002311161.1|  heat shock protein 70                              127   6e-32   Populus trichocarpa [western balsam poplar]
gb|EPS68565.1|  hypothetical protein M569_06198                         127   6e-32   Genlisea aurea
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Cicer arietinum [garbanzo]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    127   6e-32   Populus euphratica
ref|XP_002312090.1|  heat shock protein 70 cognate                      127   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002312089.1|  heat shock protein 70 cognate                      127   6e-32   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   6e-32   
emb|CDP09040.1|  unnamed protein product                                127   6e-32   Coffea canephora [robusta coffee]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Populus euphratica
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Elaeis guineensis
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Populus euphratica
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Nicotiana sylvestris
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Fragaria vesca subsp. vesca
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             127   6e-32   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Phoenix dactylifera
gb|AAB42159.1|  Hsc70                                                   127   6e-32   Solanum lycopersicum
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     127   6e-32   Eucalyptus grandis [rose gum]
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     127   6e-32   Eucalyptus grandis [rose gum]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Solanum tuberosum [potatoes]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             127   6e-32   Citrus clementina [clementine]
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             127   6e-32   Capsella rubella
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         127   6e-32   Jatropha curcas
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    127   6e-32   
emb|CAB72130.1|  heat shock protein 70                                  127   6e-32   Cucumis sativus [cucumbers]
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    127   6e-32   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             127   6e-32   Citrus clementina [clementine]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Cucumis sativus [cucumbers]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   6e-32   Fragaria vesca subsp. vesca
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     127   6e-32   Vitis vinifera
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    127   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    127   6e-32   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   6e-32   Solanum tuberosum [potatoes]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         127   6e-32   Jatropha curcas
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   6e-32   Cucumis melo [Oriental melon]
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    127   6e-32   Fragaria vesca subsp. vesca
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   7e-32   Eucalyptus grandis [rose gum]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Prunus mume [ume]
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   7e-32   Phoenix dactylifera
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        127   7e-32   Morus notabilis
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   Eucalyptus grandis [rose gum]
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   Nicotiana tomentosiformis
gb|AGR45355.1|  HSP70                                                   127   7e-32   Dendrobium officinale
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             127   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Camelina sativa [gold-of-pleasure]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       127   7e-32   Medicago truncatula
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   Citrus sinensis [apfelsine]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    127   7e-32   Fragaria vesca subsp. vesca
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    127   7e-32   
gb|ADZ46371.1|  HSP70                                                   127   7e-32   Malus hupehensis
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   Sesamum indicum [beniseed]
gb|ACR38891.1|  heat shock protein 70                                   127   7e-32   Apopellia endiviifolia (species B)
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       127   7e-32   Medicago truncatula
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   7e-32   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    127   7e-32   Solanum lycopersicum
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          127   7e-32   Amborella trichopoda
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    127   7e-32   Solanum lycopersicum
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   Solanum tuberosum [potatoes]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   8e-32   Phoenix dactylifera
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   8e-32   Pyrus x bretschneideri [bai li]
ref|XP_008371640.1|  PREDICTED: uncharacterized protein LOC103435023    120   8e-32   Malus domestica [apple tree]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    127   8e-32   Tarenaya hassleriana [spider flower]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                127   8e-32   Erythranthe guttata [common monkey flower]
gb|ACB70177.1|  70 kDa heat shock protein                               127   8e-32   Capparis spinosa [caper]
gb|EPS60056.1|  heat shock protein 70                                   127   8e-32   Genlisea aurea
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    127   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   9e-32   Populus euphratica
ref|NP_176036.1|  heat shock protein ERD2                               127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   1e-31   Phoenix dactylifera
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    128   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    125   1e-31   Brassica rapa
emb|CCD74508.1|  early-responsive to dehydration 2                      126   1e-31   Arabidopsis halleri subsp. halleri
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     127   1e-31   Vitis vinifera
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             127   1e-31   Phaseolus vulgaris [French bean]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     127   1e-31   Vigna radiata [mung bean]
ref|XP_002891955.1|  early-responsive to dehydration 2                  126   1e-31   
gb|AEK70336.1|  heat shock protein 70                                   127   1e-31   Paeonia lactiflora [common garden peony]
gb|KHG09207.1|  Heat shock 70 kDa 1 -like protein                       125   1e-31   Gossypium arboreum [tree cotton]
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     126   1e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|AFA51946.1|  heat shock protein 70                                   126   1e-31   Paeonia suffruticosa [moutan peony]
gb|AIU34470.1|  putative heat shock protein                             126   1e-31   Taraxacum brevicorniculatum
gb|EAY89450.1|  hypothetical protein OsI_10982                          125   1e-31   Oryza sativa Indica Group [Indian rice]
emb|CAA83548.1|  PsHSC71.0                                              126   1e-31   Pisum sativum [garden pea]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   1e-31   
gb|AAV97978.1|  heat shock protein hsp70                                126   1e-31   Saussurea medusa
gb|AAM48131.1|AF509336_1  heat shock protein 70                         126   1e-31   Saussurea medusa
ref|NP_001119156.1|  heat shock cognate protein 70-1                    125   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003621886.1|  Heat shock protein                                 126   2e-31   Medicago truncatula
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   Populus euphratica
gb|AAV98051.1|  heat shock protein 70                                   126   2e-31   Medicago sativa [alfalfa]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Phoenix dactylifera
gb|ACJ85522.1|  unknown                                                 126   2e-31   Medicago truncatula
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             126   2e-31   Citrus clementina [clementine]
gb|KJB16980.1|  hypothetical protein B456_002G258500                    126   2e-31   Gossypium raimondii
ref|XP_006378714.1|  heat shock protein 70 cognate                      126   2e-31   Populus trichocarpa [western balsam poplar]
ref|NP_195869.1|  heat shock protein 70                                 126   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   
gb|ACJ11745.1|  heat shock protein 70                                   126   2e-31   Gossypium hirsutum [American cotton]
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             126   2e-31   Populus trichocarpa [western balsam poplar]
gb|AIA22210.1|  heat shock protein 70                                   126   2e-31   Chrysanthemum indicum
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Camelina sativa [gold-of-pleasure]
gb|AAA62445.1|  heat shock protein                                      126   2e-31   Spinacia oleracea
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                126   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_003621869.1|  Heat shock protein                                 126   2e-31   Medicago truncatula
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     126   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_039310754.1|  molecular chaperone DnaK                           126   2e-31   Paenibacillus sp. IHB B 3415
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Camelina sativa [gold-of-pleasure]
emb|CDY50531.1|  BnaA01g30490D                                          126   2e-31   Brassica napus [oilseed rape]
ref|XP_002873055.1|  predicted protein                                  126   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             126   2e-31   Arabidopsis lyrata subsp. lyrata
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       126   2e-31   Cucurbita maxima [Boston marrow]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                126   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             126   2e-31   Capsella rubella
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   Tarenaya hassleriana [spider flower]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     126   2e-31   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             126   2e-31   Eutrema salsugineum [saltwater cress]
dbj|BAJ34054.1|  unnamed protein product                                126   2e-31   Eutrema halophilum
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   
ref|XP_007009369.1|  Heat shock protein 70                              126   2e-31   
emb|CAA05547.1|  heat shock protein 70                                  126   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABD32895.1|  Heat shock protein Hsp70                                126   2e-31   Medicago truncatula
emb|CDX85038.1|  BnaC05g20170D                                          122   2e-31   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                126   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_001759874.1|  predicted protein                                  126   2e-31   
ref|NP_187864.1|  heat shock protein 70-4                               126   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ11742.1|  heat shock protein 70                                   126   2e-31   Gossypium hirsutum [American cotton]
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   Elaeis guineensis
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Brassica rapa
ref|NP_187555.1|  heat shock protein 70-3                               126   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Camelina sativa [gold-of-pleasure]
gb|AGL07711.1|  heat shock protein 70                                   126   2e-31   Ziziphus jujuba [Chinese jujube]
emb|CDY00784.1|  BnaC03g37680D                                          126   2e-31   
emb|CDP00073.1|  unnamed protein product                                126   2e-31   Coffea canephora [robusta coffee]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             126   2e-31   Prunus persica
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       125   2e-31   Gossypium arboreum [tree cotton]
gb|EAY81899.1|  hypothetical protein OsI_37065                          124   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        126   2e-31   Morus notabilis
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     126   2e-31   Prunus mume [ume]
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             126   2e-31   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    126   2e-31   Arabis alpina [alpine rockcress]
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   Brassica rapa
emb|CDY31804.1|  BnaC01g27600D                                          124   2e-31   Brassica napus [oilseed rape]
emb|CDX73815.1|  BnaA03g32320D                                          126   2e-31   
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   2e-31   Fragaria vesca subsp. vesca
gb|KJB36734.1|  hypothetical protein B456_006G174000                    125   2e-31   Gossypium raimondii
dbj|BAJ86014.1|  predicted protein                                      126   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       125   3e-31   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                125   3e-31   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  125   3e-31   Morus notabilis
gb|KJB16979.1|  hypothetical protein B456_002G258500                    125   3e-31   Gossypium raimondii
emb|CCA29120.1|  heat shock protein 70 isoform 1                        125   3e-31   Solanum lycopersicum
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       125   3e-31   Cucurbita maxima [Boston marrow]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Solanum tuberosum [potatoes]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_002528432.1|  heat shock protein, putative                       125   3e-31   Ricinus communis
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       125   3e-31   Nicotiana sylvestris
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Nicotiana tomentosiformis
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             125   3e-31   Phaseolus vulgaris [French bean]
gb|ACJ11741.1|  heat shock protein 70                                   125   3e-31   Gossypium hirsutum [American cotton]
gb|ACD93209.1|  heat shock protein 70                                   126   3e-31   Camellia sinensis [black tea]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       125   3e-31   Nicotiana tomentosiformis
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          125   3e-31   
gb|AII99890.1|  heat shock protein                                      126   3e-31   Cicer arietinum [garbanzo]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     125   3e-31   Sesamum indicum [beniseed]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     125   3e-31   Vitis vinifera
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    125   3e-31   Petunia x hybrida [garden petunia]
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    125   3e-31   Brassica rapa
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   3e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    125   3e-31   Glycine max [soybeans]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Nicotiana sylvestris
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Sesamum indicum [beniseed]
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             125   3e-31   Citrus clementina [clementine]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         125   3e-31   Spinacia oleracea
gb|KJB46580.1|  hypothetical protein B456_007G375600                    125   3e-31   Gossypium raimondii
gb|KJB55903.1|  hypothetical protein B456_009G100400                    125   3e-31   Gossypium raimondii
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   3e-31   Cicer arietinum [garbanzo]
gb|AAB88009.1|  heat shock cognate protein HSC70                        125   3e-31   Brassica napus [oilseed rape]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             125   3e-31   Phaseolus vulgaris [French bean]
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       125   3e-31   Triticum urartu
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    125   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     125   3e-31   Nelumbo nucifera [Indian lotus]
dbj|BAP90755.1|  heat shock protein 70                                  125   3e-31   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_002532297.1|  heat shock protein, putative                       125   3e-31   Ricinus communis
gb|ACJ11740.1|  heat shock protein 70                                   125   3e-31   Gossypium hirsutum [American cotton]
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                123   4e-31   Erythranthe guttata [common monkey flower]
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     125   4e-31   Vigna radiata [mung bean]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    125   4e-31   
gb|ACM42161.1|  heat shock protein 70.58                                125   4e-31   Ageratina adenophora
ref|XP_002873056.1|  HSC70-1                                            125   4e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_003625487.1|  Heat shock protein                                 125   4e-31   
emb|CAA52684.1|  heat shock protein 70 cognate                          125   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    125   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             125   4e-31   Capsella rubella
ref|NP_195870.1|  heat shock cognate protein 70-1                       125   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAA86903.1|  heat shock protein cognate 70                           119   4e-31   Sorghum bicolor [broomcorn]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             125   5e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    125   5e-31   Camelina sativa [gold-of-pleasure]
gb|AAS09825.1|  heat shock cognate protein 70                           125   5e-31   Eutrema halophilum
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    125   5e-31   Arabis alpina [alpine rockcress]
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       125   5e-31   Phaseolus vulgaris [French bean]
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    124   5e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       125   5e-31   Solanum lycopersicum
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    125   6e-31   Setaria italica
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    123   6e-31   
ref|NP_001049712.1|  Os03g0276500                                       125   6e-31   
emb|CAB72129.1|  heat shock protein 70                                  125   6e-31   Cucumis sativus [cucumbers]
emb|CDP09035.1|  unnamed protein product                                125   6e-31   Coffea canephora [robusta coffee]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    125   6e-31   Setaria italica
gb|AAR17080.1|  heat shock protein 70-3                                 125   6e-31   Nicotiana tabacum [American tobacco]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     124   6e-31   Glycine soja [wild soybean]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    124   6e-31   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    125   7e-31   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   7e-31   Glycine max [soybeans]
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             124   7e-31   Capsella rubella
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          124   7e-31   Sorghum bicolor [broomcorn]
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    124   7e-31   Cicer arietinum [garbanzo]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    124   7e-31   Zea mays [maize]
gb|EAY89457.1|  hypothetical protein OsI_10990                          122   7e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        124   7e-31   Camelina sativa [gold-of-pleasure]
gb|AAP04522.1|  heat shock protein 70                                   124   7e-31   Nicotiana tabacum [American tobacco]
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             124   7e-31   
gb|AFU34347.1|  70-kDa heat shock protein                               124   7e-31   
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    124   7e-31   
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     124   7e-31   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                124   7e-31   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     124   7e-31   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     124   8e-31   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     123   8e-31   
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        124   8e-31   
emb|CCA29121.1|  heat shock protein 70 isoform 2                        124   8e-31   
ref|NP_001068540.1|  Os11g0703900                                       124   8e-31   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
gb|KJB73858.1|  hypothetical protein B456_011G256600                    124   8e-31   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-31   
gb|ADD71975.1|  heat shock protein 70                                   124   9e-31   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   9e-31   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    124   9e-31   
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    124   9e-31   
gb|ABP35942.1|  heat shock protein 70                                   124   9e-31   
emb|CAA47948.2|  heat shock protein 70                                  124   9e-31   
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    123   1e-30   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                124   1e-30   
emb|CDY52661.1|  BnaC01g38510D                                          124   1e-30   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                124   1e-30   
ref|XP_001785822.1|  predicted protein                                  124   1e-30   
ref|XP_008649290.1|  PREDICTED: heat shock 70 kDa protein 18-like...    115   1e-30   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          124   1e-30   
ref|XP_008649291.1|  PREDICTED: heat shock 70 kDa protein 18-like...    115   1e-30   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    124   1e-30   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   1e-30   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    124   1e-30   
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           124   1e-30   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   1e-30   
ref|XP_002975959.1|  hypothetical protein SELMODRAFT_104343             115   1e-30   
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             123   1e-30   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     125   1e-30   
gb|ABX76301.1|  heat shock protein 70                                   124   2e-30   
ref|XP_001767221.1|  predicted protein                                  124   2e-30   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             123   2e-30   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   2e-30   
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             123   2e-30   
emb|CAA27293.1|  unnamed protein product                                114   2e-30   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    123   2e-30   
gb|EAY98319.1|  hypothetical protein OsI_20227                          121   2e-30   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     123   2e-30   
pir||PC1156  dnaK-type molecular chaperone (clone pMON9508) - mai...    114   2e-30
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     123   2e-30   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     123   2e-30   
dbj|BAJ91305.1|  predicted protein                                      123   2e-30   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     123   3e-30   
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     123   3e-30   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    123   3e-30   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          123   3e-30   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       123   3e-30   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    123   3e-30   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   3e-30   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             122   3e-30   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             122   3e-30   
gb|ACJ54890.1|  heat shock protein 70                                   122   3e-30   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    122   3e-30   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   4e-30   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   4e-30   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    123   5e-30   
gb|EEC71767.1|  hypothetical protein OsI_04375                          120   6e-30   
dbj|BAA04848.1|  HSP70                                                  122   6e-30   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    121   6e-30   
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    116   8e-30   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   9e-30   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          121   9e-30   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    121   9e-30   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          121   9e-30   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   9e-30   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    121   1e-29   
gb|AAB99745.1|  HSP70                                                   121   1e-29   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     122   1e-29   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     121   1e-29   
gb|ABR18415.1|  unknown                                                 121   1e-29   
ref|NP_001055754.1|  Os05g0460000                                       121   1e-29   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    121   1e-29   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    121   1e-29   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   1e-29   
dbj|BAK00257.1|  predicted protein                                      121   1e-29   
gb|EEC76425.1|  hypothetical protein OsI_14101                          119   1e-29   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       121   1e-29   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    121   1e-29   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    121   1e-29   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    121   1e-29   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    121   2e-29   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       120   2e-29   
dbj|BAK02194.1|  predicted protein                                      120   2e-29   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       120   2e-29   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    120   2e-29   
ref|XP_001781229.1|  predicted protein                                  120   2e-29   
ref|XP_010321717.1|  PREDICTED: heat shock 70 kDa protein 18-like       112   2e-29   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    120   3e-29   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       120   3e-29   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       120   3e-29   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         119   3e-29   
gb|AIU40169.1|  heat shock protein 70                                   120   3e-29   
gb|KDP44978.1|  hypothetical protein JCGZ_01478                         119   4e-29   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          119   4e-29   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        119   4e-29   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    119   5e-29   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    119   5e-29   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   5e-29   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    119   6e-29   
ref|NP_001051724.1|  Os03g0821100                                       119   6e-29   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     120   6e-29   
ref|XP_003064239.1|  heat shock protein 70kDa                           119   9e-29   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     119   9e-29   
dbj|BAK07857.1|  predicted protein                                      119   1e-28   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       118   1e-28   
ref|NP_001044757.1|  Os01g0840100                                       118   1e-28   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    118   1e-28   
emb|CAA78034.1|  70-kD heat shock protein                               109   2e-28   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    118   2e-28   
gb|KJB49429.1|  hypothetical protein B456_008G119200                    117   2e-28   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               117   2e-28   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   3e-28   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    117   3e-28   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  117   4e-28   
emb|CDO98244.1|  unnamed protein product                                117   4e-28   
emb|CBI36549.3|  unnamed protein product                                113   4e-28   
gb|AES65513.2|  animal HSPA9 nucleotide-binding domain protein          118   4e-28   
ref|XP_003595262.1|  Heat shock protein                                 118   5e-28   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          117   5e-28   
gb|EMD49224.1|  heat shock protein hsp70A2, putative                    110   5e-28   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               117   5e-28   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   116   5e-28   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             117   5e-28   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   117   5e-28   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             117   5e-28   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    117   5e-28   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             117   5e-28   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               117   5e-28   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             117   5e-28   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             116   6e-28   
ref|XP_007023492.1|  Heat shock protein 70B                             116   6e-28   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    116   7e-28   
ref|XP_004300725.1|  PREDICTED: heat shock cognate 70 kDa protein...    116   7e-28   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          116   7e-28   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             116   8e-28   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          116   8e-28   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         116   8e-28   
ref|XP_006368489.1|  heat shock protein 70 cognate                      116   8e-28   
ref|XP_006368490.1|  heat shock protein 70 cognate                      116   8e-28   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             116   9e-28   
gb|EGW10857.1|  Heat shock cognate 71 kDa protein                       107   9e-28   
gb|KHN13881.1|  Heat shock 70 kDa protein 4                             107   1e-27   
gb|ACD45076.1|  heat-shock protein 70                                   116   1e-27   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             115   1e-27   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     115   1e-27   
gb|ACC93947.1|  heat-shock protein 70                                   115   1e-27   
ref|XP_008485618.1|  PREDICTED: heat shock 70 kDa protein cognate...    106   1e-27   
gb|AAO44919.1|  Hsp70                                                   108   1e-27   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    115   1e-27   
gb|EAW67542.1|  heat shock 70kDa protein 8, isoform CRA_c               107   1e-27   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    115   1e-27   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               115   1e-27   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    116   1e-27   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
ref|XP_005667499.1|  PREDICTED: heat shock cognate 71 kDa protein...    106   2e-27   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     115   2e-27   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    115   2e-27   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          115   2e-27   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    115   2e-27   
gb|ETK90402.1|  hsp70-like protein                                      108   2e-27   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    112   2e-27   
gb|ETI50522.1|  hsp70-like protein                                      108   2e-27   
gb|EMC90781.1|  Heat shock cognate 71 kDa protein                       106   3e-27   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          114   3e-27   
gb|AAM94003.1|  heat shock protein 70                                   109   3e-27   
ref|XP_002502667.1|  heat shock 70 kDa protein                          114   3e-27   
gb|AES65523.2|  animal HSPA9 nucleotide-binding domain protein          116   3e-27   
ref|XP_003595272.1|  Heat shock protein                                 116   3e-27   
gb|KEH37494.1|  animal HSPA9 nucleotide-binding domain protein          116   3e-27   
ref|XP_004292156.2|  PREDICTED: probable mediator of RNA polymera...    114   3e-27   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               114   3e-27   
gb|ENN76737.1|  hypothetical protein YQE_06802                          105   4e-27   
gb|KIY98351.1|  heat shock 70kDa protein 1/8                            110   4e-27   
gb|ETL43818.1|  hsp70-like protein                                      108   5e-27   
dbj|BAM44861.1|  heat shock protein                                     111   6e-27   
ref|XP_004255736.1|  heat shock protein, putative                       107   6e-27   
emb|CEG00633.1|  Heat shock protein 70 family                           113   7e-27   
gb|ETL96982.1|  hsp70-like protein                                      107   7e-27   
ref|XP_003788031.1|  PREDICTED: heat shock cognate 71 kDa protein...    107   7e-27   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     114   7e-27   
ref|XP_010787963.1|  PREDICTED: heat shock cognate 71 kDa protein...    107   7e-27   
gb|ETO79272.1|  hsp70-like protein                                      105   8e-27   
ref|XP_003919076.1|  PREDICTED: heat shock cognate 71 kDa protein...    107   8e-27   
gb|ABR18795.1|  heat shock protein 70                                   104   9e-27   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               113   1e-26   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               113   1e-26   
ref|XP_003768981.1|  PREDICTED: heat shock 70 kDa protein 1-like        105   1e-26   
prf||1205208A  heat shock protein hsp70                                 113   1e-26
ref|XP_002512742.1|  heat shock protein, putative                       113   1e-26   
gb|KDD74618.1|  heat shock protein Hsp70                                112   1e-26   
ref|NP_001153992.1|  heat shock cognate 70-kd protein                   107   1e-26   
ref|NP_001140123.1|  Heat shock cognate 71 kDa protein                  105   1e-26   
ref|XP_008931816.1|  PREDICTED: heat shock cognate 71 kDa protein...    107   1e-26   
ref|XP_002416543.1|  heat shock protein, putative                       106   1e-26   
ref|XP_008912741.1|  hsp70-like protein                                 108   1e-26   
gb|ETM50132.1|  hsp70-like protein                                      107   1e-26   
gb|AEY80026.1|  heat shock protein 70                                   112   2e-26   
gb|ABD85507.1|  heat shock protein 70                                   106   2e-26   
ref|XP_003738251.1|  PREDICTED: heat shock cognate 71 kDa protein...    105   2e-26   
emb|CDP11906.1|  unnamed protein product                                112   2e-26   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               112   2e-26   
gb|AFP65439.1|  heat shock protein 70KD                                 112   2e-26   
gb|ACJ54702.1|  heat shock protein 70                                   112   2e-26   
gb|ABK25453.1|  unknown                                                 112   2e-26   



>ref|XP_010041882.1| PREDICTED: heat shock 70 kDa protein cognate 1-like, partial 
[Eucalyptus grandis]
Length=83

 Score =   124 bits (312),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010456364.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=115

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010423854.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=190

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AAC84134.1| heat shock protein [Cichorium intybus]
Length=153

 Score =   125 bits (315),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KDO67651.1| hypothetical protein CISIN_1g0212721mg, partial [Citrus sinensis]
Length=109

 Score =   124 bits (312),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AAA32820.1| heat shock protein HSP70-2, partial [Arabidopsis thaliana]
Length=102

 Score =   124 bits (311),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KHG30764.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=73

 Score =   123 bits (308),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|KHG18124.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=77

 Score =   123 bits (308),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AAA32819.1| heat shock protein HSP70-1, partial [Arabidopsis thaliana]
Length=120

 Score =   123 bits (309),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|EAY81902.1| hypothetical protein OsI_37074 [Oryza sativa Indica Group]
Length=85

 Score =   122 bits (306),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  59



>gb|EAY89449.1| hypothetical protein OsI_10981 [Oryza sativa Indica Group]
Length=73

 Score =   122 bits (305),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA78036.1| 70-kD heat shock protein [Solanum tuberosum]
Length=71

 Score =   122 bits (305),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  59



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA54420.1| heat shock cognate 70-2 [Arabidopsis thaliana]
Length=98

 Score =   122 bits (307),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGKGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA78037.1| 70-Kd heat shock protein [Solanum tuberosum]
Length=72

 Score =   121 bits (304),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  59



>ref|XP_010423867.1| PREDICTED: heat shock 70 kDa protein 18-like [Camelina sativa]
Length=97

 Score =   122 bits (306),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YVAFTDTERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPCYVAFTDTERLIGDAAK  59



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  98



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   124 bits (310),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|ADB85325.1| putative heat shock cognate [Phyllostachys edulis]
Length=93

 Score =   120 bits (300),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/61 (98%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +2

Query  119  LLMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  298
            LLMA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  7    LLMAVKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  66

Query  299  K  301
            K
Sbjct  67   K  67



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  122  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            + AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010495044.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=611

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  122  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  16   VMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  75



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010423858.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010446275.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=632

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010463615.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008371640.1| PREDICTED: uncharacterized protein LOC103435023 [Malus domestica]
Length=173

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEII NDQ NRTTPSYVAFTDTE LIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIVNDQSNRTTPSYVAFTDTEMLIGDAAK  59



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAK  59



>ref|XP_010456365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=931

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CCD74508.1| early-responsive to dehydration 2 [Arabidopsis halleri subsp. 
halleri]
Length=622

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAK  59



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002891955.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68214.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   126 bits (316),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KHG09207.1| Heat shock 70 kDa 1 -like protein [Gossypium arboreum]
Length=506

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|NP_195869.1| heat shock protein 70 [Arabidopsis thaliana]
 sp|P22954.2|MD37D_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 2; 
AltName: Full=Heat shock cognate 70 kDa protein 2; AltName: 
Full=Heat shock cognate protein 70-2; Short=AtHsc70-2; AltName: 
Full=Heat shock protein 70-2; Short=AtHsp70-2 [Arabidopsis 
thaliana]
 emb|CAB85986.1| dnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAM13151.1| DnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAP37770.1| At5g02490 [Arabidopsis thaliana]
 dbj|BAE99142.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
 gb|AED90479.1| heat shock protein 70 [Arabidopsis thaliana]
Length=653

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002884737.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60996.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002873055.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49314.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDX85038.1| BnaC05g20170D [Brassica napus]
Length=263

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  122  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010931247.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|NP_187555.1| heat shock protein 70-3 [Arabidopsis thaliana]
 ref|NP_001189847.1| heat shock protein 70-3 [Arabidopsis thaliana]
 sp|O65719.1|HSP7C_ARATH RecName: Full=Heat shock 70 kDa protein 3; AltName: Full=Heat 
shock cognate 70 kDa protein 3; AltName: Full=Heat shock cognate 
protein 70-3; Short=AtHsc70-3; AltName: Full=Heat shock 
protein 70-3; Short=AtHsp70-3 [Arabidopsis thaliana]
 gb|AAF14038.1|AC011436_22 heat-shock protein (At-hsc70-3) [Arabidopsis thaliana]
 gb|AAF23276.1|AC016661_1 heat shock cognate 70kD protein [Arabidopsis thaliana]
 emb|CAA76606.1| At-hsc70-3 [Arabidopsis thaliana]
 gb|AAK92833.1| putative heat-shock protein At-hsc70-3 [Arabidopsis thaliana]
 gb|AAM20310.1| putative heat-shock protein [Arabidopsis thaliana]
 gb|AAM26685.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AAN46823.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AEE74767.1| heat shock protein 70-3 [Arabidopsis thaliana]
 gb|AEE74768.1| heat shock protein 70-3 [Arabidopsis thaliana]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010484430.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPS+VAFTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSFVAFTDTERLIGDAAK  59



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  59



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_006424798.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
 gb|ESR38038.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
Length=636

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT+TERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTNTERLIGDAAK  59



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDY31804.1| BnaC01g27600D [Brassica napus]
Length=417

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MTGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|EMT11692.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAK  59



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_010669896.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104887018 
[Beta vulgaris subsp. vulgaris]
Length=1526

 Score =   127 bits (319),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|EMS65159.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=702

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDPERLIGDAAK  59



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  59



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  59



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  68   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  126



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  301
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564737980045