BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004M10

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092178.1|  PREDICTED: chloroplast stem-loop binding pro...  89.4    8e-19   Sesamum indicum [beniseed]
ref|XP_004302291.1|  PREDICTED: chloroplast stem-loop binding pro...  88.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_009619213.1|  PREDICTED: chloroplast stem-loop binding pro...  87.4    4e-18   Nicotiana tomentosiformis
ref|XP_009780849.1|  PREDICTED: chloroplast stem-loop binding pro...  87.4    4e-18   Nicotiana sylvestris
ref|XP_007031209.1|  Chloroplast RNA binding                          85.9    2e-17   
gb|KFK43232.1|  hypothetical protein AALP_AA1G097200                  85.1    2e-17   Arabis alpina [alpine rockcress]
gb|ABK96584.1|  unknown                                               84.7    3e-17   Populus trichocarpa x Populus deltoides
ref|XP_011023817.1|  PREDICTED: chloroplast stem-loop binding pro...  84.7    3e-17   Populus euphratica
ref|XP_004241412.1|  PREDICTED: chloroplast stem-loop binding pro...  84.7    4e-17   Solanum lycopersicum
ref|XP_006347295.1|  PREDICTED: chloroplast stem-loop binding pro...  84.7    4e-17   Solanum tuberosum [potatoes]
ref|XP_006417582.1|  hypothetical protein EUTSA_v10007937mg           84.7    4e-17   Eutrema salsugineum [saltwater cress]
dbj|BAJ33886.1|  unnamed protein product                              84.7    4e-17   Eutrema halophilum
ref|XP_008777573.1|  PREDICTED: chloroplast stem-loop binding pro...  84.3    5e-17   Phoenix dactylifera
emb|CDX94984.1|  BnaC05g06870D                                        84.3    5e-17   
emb|CDP20929.1|  unnamed protein product                              84.0    7e-17   Coffea canephora [robusta coffee]
gb|KDP23362.1|  hypothetical protein JCGZ_23195                       84.0    7e-17   Jatropha curcas
ref|XP_010674555.1|  PREDICTED: chloroplast stem-loop binding pro...  84.0    8e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45476.1|  hypothetical protein B456_007G308300                  84.0    8e-17   Gossypium raimondii
ref|XP_002512541.1|  NAD dependent epimerase/dehydratase, putative    83.6    1e-16   Ricinus communis
ref|XP_010544150.1|  PREDICTED: chloroplast stem-loop binding pro...  83.2    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_009148185.1|  PREDICTED: chloroplast stem-loop binding pro...  83.2    1e-16   Brassica rapa
ref|XP_002319474.2|  hypothetical protein POPTR_0013s00760g           82.8    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006305088.1|  hypothetical protein CARUB_v10009455mg           82.8    2e-16   Capsella rubella
ref|XP_010024151.1|  PREDICTED: chloroplast stem-loop binding pro...  82.4    3e-16   Eucalyptus grandis [rose gum]
ref|XP_010270866.1|  PREDICTED: chloroplast stem-loop binding pro...  82.4    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010489928.1|  PREDICTED: chloroplast stem-loop binding pro...  82.0    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008442117.1|  PREDICTED: chloroplast stem-loop binding pro...  82.0    4e-16   Cucumis melo [Oriental melon]
ref|XP_004146391.1|  PREDICTED: chloroplast stem-loop binding pro...  82.0    4e-16   Cucumis sativus [cucumbers]
ref|XP_010475766.1|  PREDICTED: chloroplast stem-loop binding pro...  81.6    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008246177.1|  PREDICTED: chloroplast stem-loop binding pro...  81.6    5e-16   Prunus mume [ume]
ref|XP_002889743.1|  catalytic/ coenzyme binding protein              81.6    5e-16   
ref|XP_008370362.1|  PREDICTED: chloroplast stem-loop binding pro...  81.6    6e-16   
ref|NP_172405.1|  chloroplast stem-loop binding protein               81.6    6e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75602.1|  putative RNA binding protein                         81.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65150.1|  putative RNA-binding protein                          81.6    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207335.1|  hypothetical protein PRUPE_ppa007071mg           81.6    6e-16   Prunus persica
emb|CAA71589.1|  g5bf                                                 81.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32648.1|  g5bf protein                                          81.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458216.1|  PREDICTED: chloroplast stem-loop binding pro...  81.3    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008350588.1|  PREDICTED: chloroplast stem-loop binding pro...  80.9    1e-15   
ref|XP_010092951.1|  hypothetical protein L484_018888                 80.9    1e-15   Morus notabilis
ref|XP_009337636.1|  PREDICTED: chloroplast stem-loop binding pro...  80.9    1e-15   Pyrus x bretschneideri [bai li]
gb|EYU38405.1|  hypothetical protein MIMGU_mgv1a008259mg              80.9    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_010549317.1|  PREDICTED: chloroplast stem-loop binding pro...  80.5    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010270864.1|  PREDICTED: chloroplast stem-loop binding pro...  80.1    2e-15   Nelumbo nucifera [Indian lotus]
gb|EPS69756.1|  hypothetical protein M569_05003                       79.7    3e-15   Genlisea aurea
ref|XP_006433573.1|  hypothetical protein CICLE_v10001494mg           77.8    5e-15   
ref|XP_006382356.1|  hypothetical protein POPTR_0005s01370g           79.0    6e-15   
gb|AFK44229.1|  unknown                                               78.6    7e-15   Medicago truncatula
ref|XP_009412145.1|  PREDICTED: chloroplast stem-loop binding pro...  78.6    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007163307.1|  hypothetical protein PHAVU_001G223800g           78.2    9e-15   Phaseolus vulgaris [French bean]
ref|XP_006472242.1|  PREDICTED: chloroplast stem-loop binding pro...  78.2    1e-14   Citrus sinensis [apfelsine]
ref|XP_006433571.1|  hypothetical protein CICLE_v10001494mg           78.2    1e-14   Citrus clementina [clementine]
ref|XP_009335504.1|  PREDICTED: chloroplast stem-loop binding pro...  78.2    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009373315.1|  PREDICTED: chloroplast stem-loop binding pro...  77.8    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009337637.1|  PREDICTED: chloroplast stem-loop binding pro...  77.8    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_006433572.1|  hypothetical protein CICLE_v10001494mg           77.4    2e-14   Citrus clementina [clementine]
gb|AFK36692.1|  unknown                                               76.6    3e-14   Medicago truncatula
ref|XP_008246198.1|  PREDICTED: chloroplast stem-loop binding pro...  76.3    4e-14   Prunus mume [ume]
gb|AFK37744.1|  unknown                                               76.3    6e-14   Lotus japonicus
gb|AFK48065.1|  unknown                                               75.9    6e-14   Lotus japonicus
ref|XP_010941507.1|  PREDICTED: chloroplast stem-loop binding pro...  75.1    1e-13   Elaeis guineensis
ref|XP_004494526.1|  PREDICTED: chloroplast stem-loop binding pro...  74.7    2e-13   Cicer arietinum [garbanzo]
ref|XP_002281395.1|  PREDICTED: chloroplast stem-loop binding pro...  74.3    3e-13   Vitis vinifera
ref|XP_006604786.1|  PREDICTED: chloroplast stem-loop binding pro...  73.9    3e-13   Glycine max [soybeans]
ref|XP_003554610.1|  PREDICTED: chloroplast stem-loop binding pro...  73.9    4e-13   Glycine max [soybeans]
gb|KHN43352.1|  Hypothetical protein glysoja_001935                   73.9    4e-13   Glycine soja [wild soybean]
gb|KCW58626.1|  hypothetical protein EUGRSUZ_H01287                   71.6    6e-13   Eucalyptus grandis [rose gum]
ref|XP_010070063.1|  PREDICTED: psbP domain-containing protein 1,...  72.0    7e-13   Eucalyptus grandis [rose gum]
ref|NP_001242018.1|  uncharacterized protein LOC100791076             72.8    1e-12   
gb|KHN03920.1|  Hypothetical protein glysoja_022606                   72.8    1e-12   Glycine soja [wild soybean]
ref|XP_006664006.1|  PREDICTED: chloroplast stem-loop binding pro...  72.4    1e-12   Oryza brachyantha
ref|XP_004962574.1|  PREDICTED: chloroplast stem-loop binding pro...  71.2    3e-12   Setaria italica
ref|XP_010070062.1|  PREDICTED: psbP domain-containing protein 1,...  70.1    4e-12   Eucalyptus grandis [rose gum]
gb|KCW58622.1|  hypothetical protein EUGRSUZ_H01287                   70.1    5e-12   Eucalyptus grandis [rose gum]
ref|XP_010237291.1|  PREDICTED: chloroplast stem-loop binding pro...  69.7    1e-11   Brachypodium distachyon [annual false brome]
ref|NP_001066657.1|  Os12g0420200                                     68.9    2e-11   
gb|EEC69165.1|  hypothetical protein OsI_38123                        68.2    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_002442964.1|  hypothetical protein SORBIDRAFT_08g005500        67.8    5e-11   Sorghum bicolor [broomcorn]
dbj|BAK05017.1|  predicted protein                                    66.2    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT28966.1|  hypothetical protein F775_32001                       66.2    4e-10   
gb|AFK39183.1|  unknown                                               64.3    6e-10   Lotus japonicus
emb|CDY64776.1|  BnaC08g50030D                                        57.4    2e-08   Brassica napus [oilseed rape]
gb|KCW58625.1|  hypothetical protein EUGRSUZ_H01287                   58.9    5e-08   Eucalyptus grandis [rose gum]
ref|XP_008648443.1|  PREDICTED: chloroplast stem-loop binding pro...  58.2    1e-07   
ref|NP_001131905.1|  uncharacterized protein LOC100193292             58.2    1e-07   Zea mays [maize]
gb|ABK24300.1|  unknown                                               56.6    6e-07   Picea sitchensis
ref|XP_008246190.1|  PREDICTED: psbP domain-containing protein 1,...  55.1    1e-06   Prunus mume [ume]



>ref|XP_011092178.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Sesamum indicum]
Length=381

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M S+V V  +  S +   L SS SDFNG +L  +SVQYKRK+WQPKGAL+++AS+ KKIL
Sbjct  1    MASMVVVHHKQPSSTSILLSSSLSDFNGARL-TASVQYKRKLWQPKGALRVTASSTKKIL  59

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIGIFLSRLLVKE
Sbjct  60   IMGGTRFIGIFLSRLLVKE  78



>ref|XP_004302291.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=380

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  257
            M  LV+V + P    L     S  DFNGT+L  S +Q+KR+V QP+GALQ+SAS AKKIL
Sbjct  1    MAKLVSVQRHPSVSLLPPSSLS--DFNGTRLLHSHLQFKRRVSQPRGALQVSASSAKKIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIGIFLSRLLVKE
Sbjct  59   IMGGTRFIGIFLSRLLVKE  77



>ref|XP_009619213.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Nicotiana tomentosiformis]
Length=374

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  257
            M SLVAV  Q K  S + LPSS SDFNG KL +SS+Q+KRK  QPKGAL ++AS AKKIL
Sbjct  1    MASLVAV--QHKQPSFAVLPSSHSDFNGAKL-ISSLQFKRKPCQPKGALHVTASSAKKIL  57

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  58   IMGGTRFIGVFLSRLLVKE  76



>ref|XP_009780849.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Nicotiana sylvestris]
Length=378

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  257
            M SLVAV  Q K  S + LPSS SDFNG KL +SS+Q+KRK  QPKGAL ++AS AKKIL
Sbjct  1    MASLVAV--QHKQPSFAVLPSSHSDFNGAKL-ISSLQFKRKPCQPKGALHVTASSAKKIL  57

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  58   IMGGTRFIGVFLSRLLVKE  76



>ref|XP_007031209.1| Chloroplast RNA binding [Theobroma cacao]
 gb|EOY11711.1| Chloroplast RNA binding [Theobroma cacao]
Length=379

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +3

Query  84   VSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISA-SAKKILI  260
            +S + V Q  K  S+S LPSS SDF+GTKL     QYKRKVWQPKGAL ++A S KKIL+
Sbjct  1    MSKLVVFQPTKQPSISLLPSSLSDFSGTKLC--QFQYKRKVWQPKGALHVAAASTKKILV  58

Query  261  MGGTRFIGIFLSRLLVKE  314
            MGGTRFIGIFLSRLLVKE
Sbjct  59   MGGTRFIGIFLSRLLVKE  76



>gb|KFK43232.1| hypothetical protein AALP_AA1G097200 [Arabis alpina]
Length=379

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKE  76



>gb|ABK96584.1| unknown [Populus trichocarpa x Populus deltoides]
Length=380

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M  LVAV QQ +        S   DFNGT+L  S VQ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVQCKRRVWQTKGALQVSASSSKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>ref|XP_011023817.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Populus euphratica]
Length=380

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M  LVAV QQ +        S   DFNGT+L  S VQ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVQCKRRVWQTKGALQVSASSSKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>ref|XP_004241412.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Solanum lycopersicum]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M SLVA+  QPK  S S LPSS SDFNG +L +SS QYKRK    KGALQ++AS+ KKIL
Sbjct  1    MASLVAI--QPKQPSFSLLPSSNSDFNGARL-ISSFQYKRKPCLSKGALQVTASSEKKIL  57

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  58   IMGGTRFIGVFLSRLLVKE  76



>ref|XP_006347295.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Solanum tuberosum]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M SLVA+  QPK  S S LPSS SDFNG +L +SS QYKRK    KGALQ++AS+ KKIL
Sbjct  1    MASLVAI--QPKQPSFSVLPSSHSDFNGARL-ISSFQYKRKPCLSKGALQVTASSEKKIL  57

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  58   IMGGTRFIGVFLSRLLVKE  76



>ref|XP_006417582.1| hypothetical protein EUTSA_v10007937mg [Eutrema salsugineum]
 gb|ESQ35935.1| hypothetical protein EUTSA_v10007937mg [Eutrema salsugineum]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKE  76



>dbj|BAJ33886.1| unnamed protein product [Thellungiella halophila]
Length=379

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_008777573.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Phoenix dactylifera]
Length=388

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            +FNGT L +S VQ KRKVWQPKGALQ+ AS AKKILIMGGTRFIG+FLSRLLVK+
Sbjct  32   EFNGTALNIS-VQKKRKVWQPKGALQVKASSAKKILIMGGTRFIGVFLSRLLVKD  85



>emb|CDX94984.1| BnaC05g06870D [Brassica napus]
Length=378

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL  S VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKE
Sbjct  23   DFNGAKLH-SQVQYKRKVQQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKE  76



>emb|CDP20929.1| unnamed protein product [Coffea canephora]
Length=378

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M S+ AV  Q K  S S LPSS SDFNG +L  +SVQYKRKV  P+GAL +SASA KKIL
Sbjct  1    MASMAAV--QAKQPSFSVLPSSLSDFNGIRL-TTSVQYKRKVLHPRGALHVSASAAKKIL  57

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIGIFLSR LVKE
Sbjct  58   IMGGTRFIGIFLSRFLVKE  76



>gb|KDP23362.1| hypothetical protein JCGZ_23195 [Jatropha curcas]
Length=380

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  257
            M  LVAV QQ +        S   DFNGT+L  S +Q KRKVWQ KGALQ++AS +K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSFS-DFNGTRLH-SQIQCKRKVWQTKGALQVTASTSKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>ref|XP_010674555.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=382

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 57/77 (74%), Gaps = 3/77 (4%)
 Frame = +3

Query  90   LVAVVQ-QPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIM  263
            L+AV Q QP S       S  SDFNG +L   SVQ+KR V QPKGAL ++AS+ KKILIM
Sbjct  5    LMAVQQNQPASSLALFHSSLSSDFNGCRLT-HSVQFKRNVVQPKGALHVTASSGKKILIM  63

Query  264  GGTRFIGIFLSRLLVKE  314
            GGTRFIGIFLSRLLVKE
Sbjct  64   GGTRFIGIFLSRLLVKE  80



>gb|KJB45476.1| hypothetical protein B456_007G308300 [Gossypium raimondii]
Length=379

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 3/54 (6%)
 Frame = +3

Query  156  FNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            FNGTKL    +QYKRKV+QPKGAL I+AS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  25   FNGTKLC--QIQYKRKVYQPKGALHIAASSTKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_002512541.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF49993.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=381

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M  L+ + QQ +        S  SDFNGT+L  + +Q KR+VWQ KGALQ++AS+ K IL
Sbjct  1    MARLITIQQQTQPSFSLLTSSLSSDFNGTRLH-TQIQCKRRVWQAKGALQVTASSSKNIL  59

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  60   IMGGTRFIGVFLSRLLVKE  78



>ref|XP_010544150.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Tarenaya hassleriana]
Length=379

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNGTKL    VQYKRK ++PKGAL +SAS AKKILIMGGTRFIG+FLSRLLVK+
Sbjct  23   DFNGTKLNFR-VQYKRKAYRPKGALHVSASSAKKILIMGGTRFIGVFLSRLLVKD  76



>ref|XP_009148185.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Brassica rapa]
 emb|CDX93509.1| BnaA06g05390D [Brassica napus]
Length=378

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVQQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKE  76



>ref|XP_002319474.2| hypothetical protein POPTR_0013s00760g [Populus trichocarpa]
 gb|ABK95651.1| unknown [Populus trichocarpa]
 gb|EEE95397.2| hypothetical protein POPTR_0013s00760g [Populus trichocarpa]
Length=380

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M  LVAV QQ +        S   DFNGT+L  S V+ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVRCKRRVWQTKGALQVSASSSKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>ref|XP_006305088.1| hypothetical protein CARUB_v10009455mg [Capsella rubella]
 gb|EOA37986.1| hypothetical protein CARUB_v10009455mg [Capsella rubella]
Length=379

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_010024151.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Eucalyptus grandis]
 gb|KCW60581.1| hypothetical protein EUGRSUZ_H03311 [Eucalyptus grandis]
Length=382

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG++L  + VQYKRKV QPKGAL+++AS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  26   DFNGSRLH-ACVQYKRKVGQPKGALRVTASSNKKILIMGGTRFIGVFLSRLLVKE  79



>ref|XP_010270866.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=381

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQY-KRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNG +L+ SS+Q+ KRK WQ KGA Q+ AS AKKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGVRLSNSSIQFSKRKEWQAKGAFQVKASSAKKILIMGGTRFIGVFLSRLLVKE  78



>ref|XP_010489928.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Camelina sativa]
Length=367

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS  KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASTEKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_008442117.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Cucumis melo]
Length=383

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKE  314
            DFNG +L  + VQYKRKV QPKG L ++ASAKK ILIMGGTRFIGIFLSRLLVKE
Sbjct  27   DFNGARLH-AQVQYKRKVMQPKGGLHVTASAKKNILIMGGTRFIGIFLSRLLVKE  80



>ref|XP_004146391.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004156003.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cucumis sativus]
 gb|KGN54798.1| hypothetical protein Csa_4G500330 [Cucumis sativus]
Length=383

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKE  314
            DFNG +L  + VQYKRKV QPKG L ++ASAKK ILIMGGTRFIGIFLSRLLVKE
Sbjct  27   DFNGARLH-AQVQYKRKVMQPKGGLHVTASAKKNILIMGGTRFIGIFLSRLLVKE  80



>ref|XP_010475766.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Camelina sativa]
Length=379

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG K+ +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKIHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_008246177.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Prunus mume]
Length=383

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKI  254
            M  LVAV  QQ         PSS SDFNGT+L  S +Q KR+V QPK ALQ++AS AKKI
Sbjct  1    MARLVAVQPQQRHPSFSLLPPSSLSDFNGTRLLHSQLQCKRRVSQPKVALQVTASSAKKI  60

Query  255  LIMGGTRFIGIFLSRLLVKE  314
            LIMGGTRFIG+FLSRLLVKE
Sbjct  61   LIMGGTRFIGLFLSRLLVKE  80



>ref|XP_002889743.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66002.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 2/54 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVK
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALHVSASSEKKILIMGGTRFIGVFLSRLLVK  75



>ref|XP_008370362.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Malus domestica]
Length=383

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  251
            M  LVAV  QQ         PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNPSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGXALQVSASSAKK  60

Query  252  ILIMGGTRFIGIFLSRLLVKE  314
            ILIMGGTRFIGIFLSRLLVKE
Sbjct  61   ILIMGGTRFIGIFLSRLLVKE  81



>ref|NP_172405.1| chloroplast stem-loop binding protein [Arabidopsis thaliana]
 sp|Q9SA52.1|CP41B_ARATH RecName: Full=Chloroplast stem-loop binding protein of 41 kDa 
b, chloroplastic; Short=CSP41-b; AltName: Full=Heteroglycan-interacting 
protein 1.3; AltName: Full=Protein CHLOROPLAST 
RNA BINDING; AltName: Full=Protein Gb5f; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG40395.1|AF325043_1 At1g09340 [Arabidopsis thaliana]
 gb|AAL16114.1|AF428282_1 At1g09340/T31J12_6 [Arabidopsis thaliana]
 gb|AAD18098.1| Identical to gb|Y10557 g5bf gene from Arabidopsis thaliana. ESTs 
gb|R30578, gb|R90475, gb|T22384, gb|T22425, gb|N64934 and 
gb|T46767 come from this gene [Arabidopsis thaliana]
 gb|AAK59555.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAL47493.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEE28431.1| chloroplast stem-loop binding protein [Arabidopsis thaliana]
Length=378

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKE  76



>emb|CAA75602.1| putative RNA binding protein [Arabidopsis thaliana]
Length=374

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKE
Sbjct  19   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKE  72



>gb|AAM65150.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=378

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKE  76



>ref|XP_007207335.1| hypothetical protein PRUPE_ppa007071mg [Prunus persica]
 gb|EMJ08534.1| hypothetical protein PRUPE_ppa007071mg [Prunus persica]
Length=383

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKI  254
            M  LVAV  QQ         PSS SDFNGT+L  S +Q KR+V QPK ALQ++AS AKKI
Sbjct  1    MARLVAVQPQQRHPSFSLLPPSSLSDFNGTRLLHSQLQCKRRVSQPKVALQVTASSAKKI  60

Query  255  LIMGGTRFIGIFLSRLLVKE  314
            LIMGGTRFIG+FLSRLLVKE
Sbjct  61   LIMGGTRFIGLFLSRLLVKE  80



>emb|CAA71589.1| g5bf [Arabidopsis thaliana]
Length=378

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKE  76



>gb|AAL32648.1| g5bf protein [Arabidopsis thaliana]
Length=378

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKE  76



>ref|XP_010458216.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Camelina sativa]
Length=379

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRKV QPKG L +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGGLYVSASSEKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_008350588.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Malus domestica]
Length=383

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  251
            M  LVAV  QQ         PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNPSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGGALQVSASSAKK  60

Query  252  ILIMGGTRFIGIFLSRLLVKE  314
            ILIMGGTRFIG+FLSRLLVKE
Sbjct  61   ILIMGGTRFIGVFLSRLLVKE  81



>ref|XP_010092951.1| hypothetical protein L484_018888 [Morus notabilis]
 gb|EXB53004.1| hypothetical protein L484_018888 [Morus notabilis]
Length=380

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = +3

Query  99   VVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTR  275
            VVQQ     LS LPSS SDFNGTKL  + VQ+K++  QPKGALQ++AS+ KKILIMGGTR
Sbjct  6    VVQQQHKTPLSLLPSSLSDFNGTKLH-AQVQFKKRDSQPKGALQVTASSTKKILIMGGTR  64

Query  276  FIGIFLSRLLVKE  314
            FIG+FLSRLLVKE
Sbjct  65   FIGVFLSRLLVKE  77



>ref|XP_009337636.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X3 [Pyrus x bretschneideri]
Length=383

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 60/81 (74%), Gaps = 3/81 (4%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  251
            M  LVAV  QQ  S      PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNSSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGGALQVSASSAKK  60

Query  252  ILIMGGTRFIGIFLSRLLVKE  314
            ILIMGGTRFIG+FLSRLLVKE
Sbjct  61   ILIMGGTRFIGVFLSRLLVKE  81



>gb|EYU38405.1| hypothetical protein MIMGU_mgv1a008259mg [Erythranthe guttata]
Length=379

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+G +L  +SVQYKRKVWQ K AL ++AS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGARLT-ASVQYKRKVWQSKSALSVTASSEKKILIMGGTRFIGLFLSRLLVKE  76



>ref|XP_010549317.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Tarenaya hassleriana]
Length=379

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNG KL +  VQYKRK ++PKGAL +SAS AKKILIMGGTRFIG+FLSRLL+K+
Sbjct  23   DFNGAKLNLR-VQYKRKAYKPKGALHVSASSAKKILIMGGTRFIGVFLSRLLMKD  76



>ref|XP_010270864.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=382

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 3/57 (5%)
 Frame = +3

Query  153  DFNGTKLAVSSVQY--KRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNG +L+ SS+Q   KRK WQ KGA Q+ AS AKKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFNGVRLSNSSIQQFSKRKEWQAKGAFQVKASSAKKILIMGGTRFIGVFLSRLLVKE  79



>gb|EPS69756.1| hypothetical protein M569_05003 [Genlisea aurea]
Length=379

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 3/56 (5%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG++L  +S+QYKR + QPKGA++++AS+  KKILIMGGTRFIGIFLSRLLVKE
Sbjct  23   DFNGSRL-TASIQYKRAMKQPKGAMRVTASSSSKKILIMGGTRFIGIFLSRLLVKE  77



>ref|XP_006433573.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46813.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=305

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKE  314
            DFNGT++  S +QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKE
Sbjct  24   DFNGTRIH-SQIQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKE  77



>ref|XP_006382356.1| hypothetical protein POPTR_0005s01370g [Populus trichocarpa]
 gb|ERP60153.1| hypothetical protein POPTR_0005s01370g [Populus trichocarpa]
Length=380

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  257
            M  LVA+ QQ +      L S   DFNGT+L  S VQ KR+ WQ K ALQ+SAS+ K IL
Sbjct  1    MARLVAMQQQTQPSLSLLLSSLS-DFNGTRLH-SQVQCKRRAWQTKRALQVSASSSKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>gb|AFK44229.1| unknown [Medicago truncatula]
Length=378

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNGT+L  + +Q KRK WQPKG+L +SAS+ KKILIMGGTRFIG+FLSR LVKE
Sbjct  23   DFNGTRLQ-THIQLKRKTWQPKGSLIVSASSTKKILIMGGTRFIGVFLSRQLVKE  76



>ref|XP_009412145.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=385

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            +F+G  L++S +Q +R+ WQPKGALQ++AS AKKILIMGGTRFIG+FLSRLLVKE
Sbjct  29   EFSGAALSIS-LQKRRRTWQPKGALQVTASGAKKILIMGGTRFIGVFLSRLLVKE  82



>ref|XP_007163307.1| hypothetical protein PHAVU_001G223800g [Phaseolus vulgaris]
 gb|ESW35301.1| hypothetical protein PHAVU_001G223800g [Phaseolus vulgaris]
Length=378

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q KRK+WQPKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLP-TQLQLKRKLWQPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_006472242.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Citrus sinensis]
Length=380

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-IL  257
            M S+V VVQ     S S L SS SDFNGT++  S +QY+RKV QPK  LQ++AS++K IL
Sbjct  1    MASMV-VVQHQTQPSFSTLTSSLSDFNGTRIH-SQIQYRRKVLQPKVGLQVTASSEKNIL  58

Query  258  IMGGTRFIGIFLSRLLVKE  314
            IMGGTRFIG+FLSRLLVKE
Sbjct  59   IMGGTRFIGVFLSRLLVKE  77



>ref|XP_006433571.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46811.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=380

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKE  314
            DFNGT++  S +QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKE
Sbjct  24   DFNGTRIH-SQIQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKE  77



>ref|XP_009335504.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Pyrus x bretschneideri]
Length=383

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  251
            M  LVAV  QQ         PSS SDFNGTKL    +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQTQQRNPSFSLLPPSSLSDFNGTKLLHFQLQCKRRASQPRGGALQVSASSAKK  60

Query  252  ILIMGGTRFIGIFLSRLLVKE  314
            ILIMGGTRFIG+FLSRLLVK+
Sbjct  61   ILIMGGTRFIGVFLSRLLVKD  81



>ref|XP_009373315.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Pyrus x bretschneideri]
Length=383

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  81   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  251
            M  LVAV  QQ         PSS SDFNGTKL    +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQTQQRNPSFSLLPPSSLSDFNGTKLLHFQLQCKRRASQPRGGALQVSASSAKK  60

Query  252  ILIMGGTRFIGIFLSRLLVKE  314
            ILIMGGTRFIG+FLSRLLVK+
Sbjct  61   ILIMGGTRFIGVFLSRLLVKD  81



>ref|XP_009337637.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X4 [Pyrus x bretschneideri]
Length=381

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 3/80 (4%)
 Frame = +3

Query  81   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKKI  254
            M  LV VVQQ +  SLS LPSS S FNGT+L    +Q KR+  QP+G ALQ+SAS AKKI
Sbjct  1    MARLV-VVQQQRQPSLSPLPSSFSHFNGTRLHTPQLQCKRRASQPRGGALQVSASSAKKI  59

Query  255  LIMGGTRFIGIFLSRLLVKE  314
            LIMGGTRFIG+FLSRLLVKE
Sbjct  60   LIMGGTRFIGVFLSRLLVKE  79



>ref|XP_006433572.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46812.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=381

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKE  314
            DFNGT++     QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKE
Sbjct  24   DFNGTRIHSQIQQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKE  78



>gb|AFK36692.1| unknown [Medicago truncatula]
 gb|KEH24465.1| stem-loop-binding protein of 41 kDa protein B [Medicago truncatula]
Length=378

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DFNG +L  + +Q KRK WQPKG+L +SAS+ KKILIMGGTRFIG+FLSR LVKE
Sbjct  23   DFNGARLQ-THIQLKRKTWQPKGSLIVSASSTKKILIMGGTRFIGVFLSRQLVKE  76



>ref|XP_008246198.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X4 [Prunus mume]
Length=382

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNGT+L  + +Q KR+V QPK ALQ++AS AKKILIMGGTRFIG+FLSRLLVKE
Sbjct  26   DFNGTRLH-TQLQCKRRVSQPKVALQVTASSAKKILIMGGTRFIGLFLSRLLVKE  79



>gb|AFK37744.1| unknown [Lotus japonicus]
Length=377

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q++RK WQPKG    ++S KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQIQFRRKAWQPKGFHVSASSTKKILIMGGTRFIGVFLSRLLVKE  75



>gb|AFK48065.1| unknown [Lotus japonicus]
Length=377

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q++RK WQPKG    ++S KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQIQFRRKAWQPKGFHVSASSTKKILIMGGTRFIGVFLSRLLVKE  75



>ref|XP_010941507.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=388

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +3

Query  183  SVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            S+Q KRKVWQPKGAL + AS AKKILIMGGTRFIG+FLSRLLVK+
Sbjct  41   SIQKKRKVWQPKGALHVKASSAKKILIMGGTRFIGVFLSRLLVKD  85



>ref|XP_004494526.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cicer arietinum]
Length=378

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF GT+   + +Q KRK WQPKG+  +SAS  KK+LIMGGTRFIG+FLSRLLVK+
Sbjct  23   DFTGTRFQ-THIQLKRKTWQPKGSFYVSASTNKKVLIMGGTRFIGVFLSRLLVKQ  76



>ref|XP_002281395.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Vitis vinifera]
 emb|CAN73432.1| hypothetical protein VITISV_032681 [Vitis vinifera]
 emb|CBI39625.3| unnamed protein product [Vitis vinifera]
Length=378

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  99   VVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTR  275
            VVQ     S S LPSS SDFNG +L  + +Q +RKV QPKGAL ++AS  KKIL+MGGTR
Sbjct  5    VVQHQNQPSFSLLPSSLSDFNGIRLT-NHIQCRRKVCQPKGALHVTASGEKKILMMGGTR  63

Query  276  FIGIFLSRLLVKE  314
            FIG+FL+RLLVKE
Sbjct  64   FIGVFLARLLVKE  76



>ref|XP_006604786.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X2 [Glycine max]
Length=376

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_003554610.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X1 [Glycine max]
Length=378

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>gb|KHN43352.1| Hypothetical protein glysoja_001935 [Glycine soja]
Length=378

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>gb|KCW58626.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=251

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +3

Query  162  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTK  78



>ref|XP_010070063.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW58624.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=311

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +3

Query  162  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTK  78



>ref|NP_001242018.1| uncharacterized protein LOC100791076 [Glycine max]
 gb|ACU24022.1| unknown [Glycine max]
Length=378

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q+KRK   PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQLQFKRKQCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>gb|KHN03920.1| Hypothetical protein glysoja_022606 [Glycine soja]
Length=378

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            DF+GT+L  + +Q+KRK   PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKE
Sbjct  23   DFSGTRLQ-TQLQFKRKQCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKE  76



>ref|XP_006664006.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Oryza brachyantha]
Length=376

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF+G  L++SS Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSGAALSISS-QTRRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKE  74



>ref|XP_004962574.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Setaria italica]
Length=376

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF+G  ++VS+ Q +R+ WQP+GA +Q+SA+A  K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSGAAVSVST-QKRRRSWQPRGARIQVSAAADSKNILVMGGTRFIGVFLSRLLVKE  74



>ref|XP_010070062.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW58623.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=314

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +3

Query  162  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTK  78



>gb|KCW58622.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=329

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +3

Query  162  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTK  78



>ref|XP_010237291.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Brachypodium distachyon]
Length=378

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF+G  L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+F+SRLLVKE
Sbjct  21   DFSGAALSMST-QNRRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFMSRLLVKE  76



>ref|NP_001066657.1| Os12g0420200 [Oryza sativa Japonica Group]
 gb|ABA97622.2| RNA binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29676.1| Os12g0420200 [Oryza sativa Japonica Group]
 gb|EEE53110.1| hypothetical protein OsJ_35887 [Oryza sativa Japonica Group]
Length=376

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF+   L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSSAALSIST-QARRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKE  74



>gb|EEC69165.1| hypothetical protein OsI_38123 [Oryza sativa Indica Group]
Length=373

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF+   L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSSAALSIST-QARRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKE  74



>ref|XP_002442964.1| hypothetical protein SORBIDRAFT_08g005500 [Sorghum bicolor]
 gb|EES16802.1| hypothetical protein SORBIDRAFT_08g005500 [Sorghum bicolor]
Length=384

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 6/60 (10%)
 Frame = +3

Query  153  DFNGTKLAVS-SVQYKRKVWQPKGA-LQISASA----KKILIMGGTRFIGIFLSRLLVKE  314
            DF+G  +++S S Q +R  WQP+GA +Q+SA+A    K IL+MGGTRFIG+FLSR+LVKE
Sbjct  19   DFSGAAVSISVSAQKRRSSWQPRGARVQVSAAAAADSKNILVMGGTRFIGVFLSRILVKE  78



>dbj|BAK05017.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF G  +++S+ Q +R+ WQP+GA +Q++A+A  K ILIMGGTRFIG+FLSR LV+E
Sbjct  12   DFGGAAISISA-QNRRRSWQPRGARMQVAAAADSKNILIMGGTRFIGLFLSRKLVQE  67



>gb|EMT28966.1| hypothetical protein F775_32001 [Aegilops tauschii]
Length=903

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 4/57 (7%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKE  314
            DF G  +++S+ Q +R+ WQP+GA +Q++A+A  K ILIMGGTRFIG+FLSR LV+E
Sbjct  87   DFGGAAISISA-QNRRRSWQPRGARMQVAAAADSKNILIMGGTRFIGLFLSRKLVQE  142



>gb|AFK39183.1| unknown [Lotus japonicus]
Length=326

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  177  VSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKE  314
            ++ +Q KRKVWQPKG+   +AS+ KK+L+MGG RF G+FLSRL VKE
Sbjct  33   LTQIQLKRKVWQPKGSFSATASSPKKMLMMGGNRFTGVFLSRLFVKE  79



>emb|CDY64776.1| BnaC08g50030D [Brassica napus]
Length=81

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFI  281
            DFNG KL +  VQ KRKV QPKGAL +SAS+ KKILI+GGTRFI
Sbjct  23   DFNGAKLHLQ-VQCKRKVNQPKGALYVSASSEKKILIVGGTRFI  65



>gb|KCW58625.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=310

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 1/38 (3%)
 Frame = +3

Query  201  KVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVK  311
            +VWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K
Sbjct  37   QVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTK  74



>ref|XP_008648443.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X1 [Zea mays]
 ref|XP_008658099.1| PREDICTED: uncharacterized protein LOC100193292 isoform X1 [Zea 
mays]
 gb|AFW74489.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86811.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=375

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKE  314
            DF+G   AVS    KR+    +  +  +A +K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSGAAAAVSISTQKRRSRGARVQVSAAADSKNILVMGGTRFIGVFLSRLLVKE  72



>ref|NP_001131905.1| uncharacterized protein LOC100193292 [Zea mays]
 ref|XP_008648444.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X2 [Zea mays]
 gb|ACF80521.1| unknown [Zea mays]
 gb|AFW74488.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86812.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=374

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKE  314
            DF+G   AVS    KR+    +  +  +A +K IL+MGGTRFIG+FLSRLLVKE
Sbjct  19   DFSGAAAAVSISTQKRRSRGARVQVSAAADSKNILVMGGTRFIGVFLSRLLVKE  72



>gb|ABK24300.1| unknown [Picea sitchensis]
Length=407

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 7/60 (12%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRK--VWQPKGALQISASA-----KKILIMGGTRFIGIFLSRLLVK  311
            DFNG +L     Q++     ++ +G ++I+AS+     KKILIMGGTRFIG++LSRLLVK
Sbjct  44   DFNGVRLDNHPQQFQTNKLSYKSRGRVEITASSSSVPPKKILIMGGTRFIGVYLSRLLVK  103



>ref|XP_008246190.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X3 [Prunus mume]
Length=330

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  153  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKE  314
            DFNGT+L  + +QY+R V +PK  L ++AS AKK L  GG + IG+FLSRL +K+
Sbjct  26   DFNGTRLH-TQLQYRRNVSRPKETLYVTASNAKKSLTAGGIQSIGVFLSRLFIKD  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556888308225