BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004K23

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  109   2e-25   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  108   2e-25   Nicotiana tomentosiformis
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    107   8e-25   
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    106   2e-24   Solanum tuberosum [potatoes]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg              90.9    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  90.9    1e-18   Prunus mume [ume]
gb|EPS67420.1|  aldehyde dehydrogenase                                87.8    2e-18   Genlisea aurea
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1        89.0    6e-18   
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  87.8    1e-17   Fragaria vesca subsp. vesca
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...  87.8    2e-17   Populus trichocarpa [western balsam poplar]
emb|CBI19000.3|  unnamed protein product                              87.8    2e-17   Vitis vinifera
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...  87.4    2e-17   Craterostigma plantagineum
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  87.0    3e-17   Pyrus x bretschneideri [bai li]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...  86.7    4e-17   
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                86.7    4e-17   Sesamum indicum [beniseed]
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  86.7    4e-17   Fragaria vesca subsp. vesca
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  86.7    4e-17   
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  86.3    5e-17   Populus euphratica
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  86.3    6e-17   Populus euphratica
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  85.9    6e-17   Malus domestica [apple tree]
gb|KGN54554.1|  hypothetical protein Csa_4G361880                     85.9    7e-17   Cucumis sativus [cucumbers]
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  85.5    8e-17   
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  85.9    9e-17   Vitis vinifera
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like           85.5    9e-17   Sesamum indicum [beniseed]
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  85.5    1e-16   Vitis vinifera
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  85.5    1e-16   Populus euphratica
gb|AGC65583.1|  fatty aldehyde dehydrogenase                          85.1    1e-16   Simmondsia chinensis [goatnut]
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  85.1    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.7    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.7    2e-16   Phoenix dactylifera
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.7    2e-16   Cucumis melo [Oriental melon]
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein   84.7    2e-16   Medicago truncatula
gb|ACJ85852.1|  unknown                                               84.7    2e-16   Medicago truncatula
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1             84.3    2e-16   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                 84.3    3e-16   
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2             84.0    4e-16   
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.0    4e-16   Populus euphratica
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.0    5e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008368060.1|  PREDICTED: aldehyde dehydrogenase-like           79.7    5e-16   
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  84.0    5e-16   
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg           82.8    8e-16   Prunus persica
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  82.8    9e-16   Cicer arietinum [garbanzo]
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g           82.8    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006370386.1|  hypothetical protein POPTR_0001s421501g          82.0    1e-15   
gb|KDO80593.1|  hypothetical protein CISIN_1g011107mg                 80.5    1e-15   Citrus sinensis [apfelsine]
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  82.0    2e-15   Nelumbo nucifera [Indian lotus]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1             82.0    2e-15   Glycine soja [wild soybean]
ref|XP_008246188.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.0    2e-15   Prunus mume [ume]
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  81.6    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3             81.6    2e-15   
gb|KDO80592.1|  hypothetical protein CISIN_1g011107mg                 80.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_006434228.1|  hypothetical protein CICLE_v10000949mg           80.5    2e-15   
gb|KHN20142.1|  Aldehyde dehydrogenase family 3 member I1, chloro...  76.3    2e-15   Glycine soja [wild soybean]
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  81.6    3e-15   Glycine max [soybeans]
ref|XP_008227233.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.6    3e-15   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1             81.6    3e-15   
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2             81.6    3e-15   
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  80.9    4e-15   Tarenaya hassleriana [spider flower]
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein   80.9    4e-15   Medicago truncatula
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1        80.9    4e-15   
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                 80.5    5e-15   Citrus sinensis [apfelsine]
gb|KDP32847.1|  hypothetical protein JCGZ_12139                       80.9    5e-15   Jatropha curcas
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  81.3    5e-15   Populus euphratica
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  80.5    6e-15   Cicer arietinum [garbanzo]
emb|CDY36336.1|  BnaC08g05150D                                        80.5    6e-15   Brassica napus [oilseed rape]
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  80.5    6e-15   
ref|XP_007161481.1|  hypothetical protein PHAVU_001G0727000g          75.1    7e-15   Phaseolus vulgaris [French bean]
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...  80.5    7e-15   Vitis vinifera
emb|CBI21614.3|  unnamed protein product                              80.5    8e-15   Vitis vinifera
emb|CDY25655.1|  BnaC05g25340D                                        79.3    8e-15   Brassica napus [oilseed rape]
emb|CAN73659.1|  hypothetical protein VITISV_044129                   80.5    8e-15   Vitis vinifera
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g           80.1    8e-15   Phaseolus vulgaris [French bean]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg           79.7    1e-14   Citrus clementina [clementine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.7    1e-14   Citrus sinensis [apfelsine]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                 79.7    1e-14   Citrus sinensis [apfelsine]
gb|KJB75341.1|  hypothetical protein B456_012G037500                  79.7    1e-14   Gossypium raimondii
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200             79.7    1e-14   Arabis alpina [alpine rockcress]
gb|KJB29204.1|  hypothetical protein B456_005G089100                  79.3    1e-14   Gossypium raimondii
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg           79.7    1e-14   Eutrema salsugineum [saltwater cress]
gb|KJB64494.1|  hypothetical protein B456_010G051500                  78.2    1e-14   Gossypium raimondii
ref|NP_974679.1|  aldehyde dehydrogenase 3I1                          78.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.3    2e-14   Cicer arietinum [garbanzo]
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.3    2e-14   Cicer arietinum [garbanzo]
gb|KJB75338.1|  hypothetical protein B456_012G037500                  79.3    2e-14   Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                  79.3    2e-14   Gossypium raimondii
gb|KJB75339.1|  hypothetical protein B456_012G037500                  79.3    2e-14   Gossypium raimondii
ref|XP_002869163.1|  ALDH3I1                                          79.3    2e-14   Arabidopsis lyrata subsp. lyrata
gb|ACJ85715.1|  unknown                                               77.4    2e-14   Medicago truncatula
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.3    2e-14   
gb|EMS67814.1|  Aldehyde dehydrogenase family 3 member I1, chloro...  75.9    2e-14   Triticum urartu
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.0    2e-14   Brassica rapa
emb|CDY36018.1|  BnaA08g04430D                                        79.0    2e-14   Brassica napus [oilseed rape]
gb|KJB29202.1|  hypothetical protein B456_005G089100                  78.6    3e-14   Gossypium raimondii
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1             78.6    3e-14   Gossypium arboreum [tree cotton]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1             78.2    3e-14   Gossypium arboreum [tree cotton]
gb|KJB64493.1|  hypothetical protein B456_010G051500                  78.2    4e-14   Gossypium raimondii
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                          78.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAC84903.1|  aldehyde dehydrogenase                               78.2    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    4e-14   
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    4e-14   Glycine max [soybeans]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.8    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010500186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    6e-14   
ref|XP_010500187.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg           77.8    7e-14   Capsella rubella
emb|CAB36701.1|  putative aldehyde dehydrogenase                      77.8    7e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein   77.8    7e-14   Medicago truncatula
gb|EEC67815.1|  hypothetical protein OsI_35392                        73.9    7e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_010500185.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1        77.8    7e-14   
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g           77.4    7e-14   Phaseolus vulgaris [French bean]
ref|XP_010500184.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.9    8e-14   
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.0    9e-14   
ref|XP_008227606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  76.3    1e-13   Prunus mume [ume]
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg              77.0    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.0    1e-13   Brassica rapa
gb|ACU23701.1|  unknown                                               75.1    1e-13   Glycine max [soybeans]
gb|KCW62442.1|  hypothetical protein EUGRSUZ_H05081                   75.9    1e-13   Eucalyptus grandis [rose gum]
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  76.6    1e-13   
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  76.6    2e-13   
gb|AID60136.1|  aldehyde dehydrogenase 3                              76.6    2e-13   Brassica napus [oilseed rape]
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...  76.6    2e-13   Brassica rapa
emb|CDX75414.1|  BnaA01g02880D                                        76.6    2e-13   
gb|KCW62441.1|  hypothetical protein EUGRSUZ_H05081                   75.5    2e-13   Eucalyptus grandis [rose gum]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein   76.3    2e-13   Medicago truncatula
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  76.3    2e-13   Prunus mume [ume]
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                  76.3    2e-13   Arabis alpina [alpine rockcress]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.9    2e-13   
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.9    2e-13   Glycine max [soybeans]
gb|AAY23279.1|  aldehyde dehydrogenase, putative                      74.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1             75.9    3e-13   Gossypium arboreum [tree cotton]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.9    3e-13   Prunus mume [ume]
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    3e-13   Cicer arietinum [garbanzo]
ref|XP_002888606.1|  ALDH3H1                                          75.5    3e-13   
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    3e-13   
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    4e-13   Eucalyptus grandis [rose gum]
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1             75.9    4e-13   Glycine soja [wild soybean]
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    4e-13   Eucalyptus grandis [rose gum]
gb|EPS67391.1|  aldehyde dehydrogenase                                75.1    4e-13   Genlisea aurea
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.1    5e-13   Eucalyptus grandis [rose gum]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                   75.1    5e-13   Eucalyptus grandis [rose gum]
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                   74.7    6e-13   Eucalyptus grandis [rose gum]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.7    7e-13   Camelina sativa [gold-of-pleasure]
gb|AAX96338.1|  aldehyde dehydrogenase, putative                      74.3    9e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065921.1|  Os11g0186200                                     74.3    9e-13   
emb|CDX69039.1|  BnaC01g04140D                                        74.3    1e-12   
emb|CAE51203.1|  putative aldehyde dehydrogenase                      73.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61211.1|  aldehyde dehydrogenase, putative                      73.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                          73.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    2e-12   Oryza brachyantha
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    2e-12   Cucumis sativus [cucumbers]
gb|KJB59280.1|  hypothetical protein B456_009G247000                  73.2    2e-12   Gossypium raimondii
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    2e-12   Cucumis melo [Oriental melon]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    3e-12   
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    3e-12   Fragaria vesca subsp. vesca
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg           72.8    4e-12   Eutrema salsugineum [saltwater cress]
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    4e-12   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    4e-12   
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg           72.4    4e-12   Capsella rubella
gb|ABK24239.1|  unknown                                               72.4    4e-12   Picea sitchensis
gb|ABR16899.1|  unknown                                               72.4    5e-12   Picea sitchensis
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.0    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.6    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.6    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    1e-11   
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g           70.9    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.1    3e-11   Elaeis guineensis
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.7    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    6e-11   
dbj|BAK01937.1|  predicted protein                                    68.9    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.2    1e-10   Cucumis melo [Oriental melon]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed      67.8    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|WP_031467875.1|  aldehyde dehydrogenase                           67.4    2e-10   
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  67.4    2e-10   Brachypodium distachyon [annual false brome]
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring  67.0    3e-10   
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring       67.0    3e-10   Zea mays [maize]
gb|ACF85700.1|  unknown                                               66.6    4e-10   Zea mays [maize]
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1             66.6    5e-10   
gb|KJB17707.1|  hypothetical protein B456_003G011600                  65.1    6e-10   Gossypium raimondii
ref|XP_009060246.1|  hypothetical protein LOTGIDRAFT_229102           65.5    9e-10   Lottia gigantea
ref|WP_026197256.1|  aldehyde dehydrogenase                           65.1    1e-09   
gb|KJB17706.1|  hypothetical protein B456_003G011600                  64.7    1e-09   Gossypium raimondii
emb|CDP01945.1|  unnamed protein product                              64.3    3e-09   Coffea canephora [robusta coffee]
ref|WP_015772232.1|  aldehyde dehydrogenase                           63.9    3e-09   Jonesia denitrificans
emb|CDX72584.1|  BnaC07g46060D                                        63.9    3e-09   
tpg|DAA38940.1|  TPA: hypothetical protein ZEAMMB73_547503            62.8    3e-09   
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449            63.5    5e-09   Trichoplax adhaerens
gb|KJB17709.1|  hypothetical protein B456_003G011600                  63.2    5e-09   Gossypium raimondii
gb|KJB17708.1|  hypothetical protein B456_003G011600                  63.2    5e-09   Gossypium raimondii
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1       63.2    6e-09   Zea mays [maize]
ref|WP_014210046.1|  aldehyde dehydrogenase                           62.8    7e-09   Mycolicibacterium rhodesiae
gb|KAQ21680.1|  aldehyde dehydrogenase (NAD+)                         60.5    7e-09   Mycobacterium tuberculosis MD15770
gb|KEA73408.1|  aldehyde dehydrogenase (NAD+)                         60.5    7e-09   Mycobacterium tuberculosis NRITLD18
gb|KHG21488.1|  Aldehyde dehydrogenase family 3 member F1             62.8    8e-09   Gossypium arboreum [tree cotton]
ref|NP_001168661.1|  hypothetical protein                             62.8    8e-09   Zea mays [maize]
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.8    9e-09   Setaria italica
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.8    1e-08   
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.4    1e-08   Brassica rapa
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.4    1e-08   Brassica rapa
emb|CDX69216.1|  BnaC01g02370D                                        62.0    1e-08   
ref|XP_006118454.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  58.9    1e-08   
emb|CDX77447.1|  BnaA07g05850D                                        62.0    1e-08   
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                  62.0    1e-08   Arabis alpina [alpine rockcress]
ref|WP_042756386.1|  aldehyde dehydrogenase                           60.1    1e-08   
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.0    2e-08   
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg           61.6    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146           61.6    2e-08   
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  61.6    2e-08   Pyrus x bretschneideri [bai li]
ref|WP_043403838.1|  aldehyde dehydrogenase                           61.6    2e-08   
ref|WP_009627619.1|  Aldehyde Dehydrogenase                           61.6    2e-08   Pseudanabaena biceps
gb|EWM24499.1|  aldehyde dehydrogenase                                59.3    2e-08   Nannochloropsis gaditana
ref|WP_041308647.1|  aldehyde dehydrogenase                           61.2    3e-08   
emb|CDY24790.1|  BnaA08g15200D                                        61.2    3e-08   Brassica napus [oilseed rape]
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  61.2    3e-08   Brachypodium distachyon [annual false brome]
emb|CDY35463.1|  BnaC03g61970D                                        61.2    3e-08   Brassica napus [oilseed rape]
ref|WP_010353711.1|  aldehyde dehydrogenase                           61.2    3e-08   Streptomyces acidiscabies
emb|CDY59717.1|  BnaA03g59170D                                        61.2    3e-08   Brassica napus [oilseed rape]
ref|WP_006011635.1|  aldehyde dehydrogenase                           61.2    3e-08   Glaciecola pallidula
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  61.2    3e-08   Brassica rapa
ref|XP_001780129.1|  variable substrate                               61.2    3e-08   
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420        60.8    3e-08   Sorghum bicolor [broomcorn]
ref|XP_009023429.1|  hypothetical protein HELRODRAFT_185832           60.8    3e-08   Helobdella robusta
ref|WP_008182868.1|  aldehyde dehydrogenase                           60.8    3e-08   Moorea producens
ref|WP_031755147.1|  aldehyde dehydrogenase                           60.1    4e-08   
ref|WP_036006670.1|  aldehyde dehydrogenase                           60.8    4e-08   
ref|WP_031754101.1|  aldehyde dehydrogenase                           60.1    4e-08   
ref|WP_041246595.1|  aldehyde dehydrogenase                           60.5    4e-08   
ref|WP_016720740.1|  aldehyde dehydrogenase                           60.1    4e-08   Mycobacterium tuberculosis
gb|AEP28780.1|  NAD-dependent aldehyde dehydrogenase                  60.5    5e-08   Glaciecola nitratireducens FR1064
ref|WP_006242686.1|  aldehyde dehydrogenase                           60.5    5e-08   Mycolicibacterium tusciae
ref|XP_003746960.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  60.5    5e-08   
ref|XP_001767194.1|  variable substrate                               60.5    5e-08   
gb|AFE15141.1|  aldehyde dehydrogenase (NAD+) dependent               60.5    5e-08   Mycobacterium tuberculosis RGTB327
gb|ADD38780.1|  Fatty aldehyde dehydrogenase                          60.5    6e-08   Lepeophtheirus salmonis
ref|XP_005104004.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  60.5    6e-08   Aplysia californica
ref|WP_031698077.1|  aldehyde dehydrogenase                           60.1    6e-08   
ref|XP_009109317.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  60.1    6e-08   Brassica rapa
gb|KBM34808.1|  aldehyde dehydrogenase (NAD+)                         60.1    6e-08   Mycobacterium tuberculosis KT-0010
gb|ACO12663.1|  Aldehyde dehydrogenase, dimeric NADP-preferring       60.1    6e-08   Lepeophtheirus salmonis
ref|WP_003907304.1|  aldehyde dehydrogenase NAD-dependent             60.1    7e-08   
gb|KBM59215.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis KT-0029
gb|KAN83639.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis 1010SM
gb|KCM61171.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis BTB03-108
gb|KBB52122.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis M1928
gb|AHJ49104.1|  aldehyde dehydrogenase NAD-dependent                  60.1    7e-08   Mycobacterium tuberculosis BT1
ref|WP_003906290.1|  aldehyde dehydrogenase                           60.1    7e-08   Mycobacterium tuberculosis
gb|KBV32672.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis NRITLD21
gb|KBM62580.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis KT-0031
gb|KBK34885.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis UT0037
gb|KBI46457.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis MAL020179
gb|KAW07550.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis TKK_05SA_0050
gb|KAS98928.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis TKK_03_0116
ref|WP_003400974.1|  MULTISPECIES: aldehyde dehydrogenase             60.1    7e-08   Mycobacterium
ref|WP_031745705.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031743149.1|  aldehyde dehydrogenase                           60.1    7e-08   
gb|KAW14324.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis TKK_05SA_0054
gb|KCR56106.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis BTB12-400
gb|KAU83987.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis TKK_05MA_0037
ref|WP_031651731.1|  aldehyde dehydrogenase                           60.1    7e-08   
gb|KBL15889.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis UT0067
gb|KAR93484.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis TKK_03_0063
gb|AEM98596.1|  aldehyde dehydrogenase                                60.1    7e-08   Mycobacterium tuberculosis CTRI-2
ref|WP_014000065.1|  aldehyde dehydrogenase                           60.1    7e-08   Mycobacterium canettii
ref|WP_031664286.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_041180706.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031755153.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_044109323.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_038436781.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031699317.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031684493.1|  aldehyde dehydrogenase                           60.1    7e-08   
gb|KAM00311.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   Mycobacterium tuberculosis M1029
gb|AEJ48969.1|  aldehyde dehydrogenase                                60.1    7e-08   Mycobacterium tuberculosis CCDC5180
ref|WP_031734000.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031726101.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031719745.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_003913557.1|  MULTISPECIES: aldehyde dehydrogenase             60.1    7e-08   
gb|EKC37261.1|  Aldehyde dehydrogenase family 3 member B1             57.4    7e-08   
gb|KAW99412.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   
ref|WP_041179805.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_038437262.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031738679.1|  aldehyde dehydrogenase                           60.1    7e-08   
gb|KCR18995.1|  aldehyde dehydrogenase (NAD+)                         60.1    7e-08   
ref|WP_042509381.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031715403.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031711349.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031697875.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397           60.1    7e-08   
ref|WP_031748593.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031737236.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031648204.1|  aldehyde dehydrogenase                           60.1    7e-08   
gb|ADU48656.1|  Aldehyde Dehydrogenase                                60.1    7e-08   
ref|WP_031648856.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_031677664.1|  aldehyde dehydrogenase                           60.1    7e-08   
ref|WP_015291928.1|  Putative aldehyde dehydrogenase (NAD+) depen...  60.1    8e-08   
ref|WP_017654159.1|  aldehyde dehydrogenase                           59.3    1e-07   
ref|WP_043904999.1|  aldehyde dehydrogenase                           59.3    1e-07   
ref|WP_028953736.1|  aldehyde dehydrogenase                           59.3    1e-07   
ref|WP_006946046.1|  Aldehyde dehydrogenase                           59.3    1e-07   
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647           58.9    1e-07   
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300           58.9    1e-07   
ref|WP_044509343.1|  aldehyde dehydrogenase                           58.9    1e-07   
ref|WP_029114337.1|  aldehyde dehydrogenase                           58.9    2e-07   
gb|KEB68865.1|  aldehyde dehydrogenase (NAD+)                         58.9    2e-07   
ref|WP_031725823.1|  aldehyde dehydrogenase                           58.9    2e-07   
ref|WP_015288818.1|  Putative aldehyde dehydrogenase (NAD+) depen...  58.9    2e-07   
ref|WP_019148953.1|  hypothetical protein                             58.9    2e-07   
ref|WP_041181361.1|  aldehyde dehydrogenase                           58.9    2e-07   
ref|WP_006373067.1|  aldehyde dehydrogenase                           58.9    2e-07   
ref|WP_020171844.1|  aldehyde dehydrogenase                           58.9    2e-07   
ref|WP_034714402.1|  aldehyde dehydrogenase                           58.5    2e-07   
ref|WP_015244977.1|  aldehyde dehydrogenase                           58.9    2e-07   
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring  58.5    2e-07   
ref|WP_044487997.1|  aldehyde dehydrogenase                           58.5    2e-07   
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  58.5    2e-07   
ref|WP_007769303.1|  aldehyde dehydrogenase                           58.5    2e-07   
ref|XP_001764841.1|  variable substrate                               58.5    2e-07   
gb|ACL53721.1|  unknown                                               58.5    2e-07   
ref|XP_006033462.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  58.5    2e-07   
ref|XP_006033465.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  58.2    3e-07   
ref|WP_035378849.1|  aldehyde dehydrogenase                           58.2    3e-07   
ref|WP_017983480.1|  hypothetical protein                             58.2    3e-07   
ref|XP_002130467.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  58.2    3e-07   
ref|XP_001757163.1|  variable substrate                               58.2    3e-07   
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470        58.2    3e-07   
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  58.2    3e-07   
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg           57.8    3e-07   
ref|XP_004522592.1|  PREDICTED: fatty aldehyde dehydrogenase-like...  57.8    4e-07   
emb|CAA18131.1|  aldehyde dehydrogenase like protein                  57.8    4e-07   
ref|XP_004522591.1|  PREDICTED: fatty aldehyde dehydrogenase-like...  57.8    4e-07   
gb|KJF22961.1|  Coniferyl aldehyde dehydrogenase                      57.8    4e-07   
ref|XP_004522588.1|  PREDICTED: fatty aldehyde dehydrogenase-like...  57.8    4e-07   
ref|WP_023369511.1|  aldehyde dehydrogenase                           57.8    4e-07   
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                          57.4    5e-07   
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg           57.4    5e-07   
emb|CAE48163.1|  putative aldehyde dehydrogenase                      57.4    5e-07   
ref|WP_029767560.1|  aldehyde dehydrogenase                           57.4    5e-07   
ref|XP_004522590.1|  PREDICTED: fatty aldehyde dehydrogenase-like...  57.4    5e-07   
ref|XP_010548304.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  57.4    5e-07   
ref|XP_007068523.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.4    5e-07   
ref|NP_001087173.1|  aldehyde dehydrogenase 3 family, member B1       57.4    5e-07   
ref|WP_002673810.1|  hypothetical protein                             57.0    6e-07   
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840        57.4    6e-07   
gb|KDO71078.1|  hypothetical protein CISIN_1g0386171mg                54.3    6e-07   
ref|XP_001629556.1|  predicted protein                                57.4    6e-07   
ref|XP_006278585.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.0    6e-07   
ref|XP_004146483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.0    6e-07   
gb|KEQ60501.1|  aldehyde dehydrogenase                                57.0    6e-07   
gb|EMD92520.1|  hypothetical protein COCHEDRAFT_1155491               56.6    7e-07   
ref|XP_006278584.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.0    7e-07   
ref|WP_043058938.1|  hypothetical protein                             57.0    7e-07   
ref|XP_009610375.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.3    7e-07   
ref|WP_036471060.1|  aldehyde dehydrogenase                           57.0    7e-07   
ref|WP_019513276.1|  MULTISPECIES: hypothetical protein               57.0    7e-07   
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.0    8e-07   
ref|XP_011207298.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  57.0    8e-07   
ref|XP_002869039.1|  ALDH3F1                                          57.0    8e-07   
ref|XP_009346294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  56.6    8e-07   
ref|WP_038543308.1|  aldehyde dehydrogenase                           56.6    8e-07   
ref|XP_011207297.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  57.0    8e-07   
ref|XP_011207295.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  57.0    8e-07   
ref|XP_011207294.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  57.0    8e-07   
ref|XP_011207296.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  57.0    8e-07   
ref|WP_002688230.1|  hypothetical protein                             56.6    8e-07   
ref|WP_033232195.1|  aldehyde dehydrogenase                           56.6    9e-07   
ref|XP_010765949.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.3    9e-07   
ref|WP_043390663.1|  aldehyde dehydrogenase                           56.6    9e-07   
ref|WP_010698015.1|  hypothetical protein                             56.6    1e-06   
ref|WP_030357521.1|  MULTISPECIES: aldehyde dehydrogenase             56.6    1e-06   
ref|WP_030559087.1|  aldehyde dehydrogenase                           56.2    1e-06   
ref|WP_022707835.1|  aldehyde dehydrogenase                           56.6    1e-06   
ref|WP_043983956.1|  aldehyde dehydrogenase                           56.6    1e-06   
ref|WP_024448831.1|  aldehyde dehydrogenase                           56.2    1e-06   
ref|XP_011430143.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  56.2    1e-06   
gb|KHJ42463.1|  hypothetical protein D918_07385                       54.3    1e-06   
ref|XP_001185717.2|  PREDICTED: uncharacterized protein LOC754455     56.6    1e-06   
ref|WP_029068306.1|  aldehyde dehydrogenase                           56.2    1e-06   
ref|XP_001770374.1|  variable substrate                               55.8    1e-06   
ref|NP_001040290.1|  aldehyde dehydrogenase isoform 2                 56.2    2e-06   
gb|KDO52217.1|  hypothetical protein CISIN_1g009109mg                 55.8    2e-06   
ref|XP_006432085.1|  hypothetical protein CICLE_v10000776mg           55.8    2e-06   
ref|NP_001166835.1|  aldehyde dehydrogenase isoform 1                 56.2    2e-06   
ref|WP_036418550.1|  aldehyde dehydrogenase                           55.8    2e-06   
gb|KDP32663.1|  hypothetical protein JCGZ_13661                       55.8    2e-06   
ref|XP_003727225.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...  56.2    2e-06   
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.8    2e-06   
ref|WP_030855051.1|  aldehyde dehydrogenase                           55.8    2e-06   
ref|WP_033268258.1|  aldehyde dehydrogenase                           55.8    2e-06   
ref|WP_015226213.1|  aldehyde dehydrogenase                           55.8    2e-06   
ref|XP_002901988.1|  aldehyde dehydrogenase, putative                 55.8    2e-06   
ref|XP_006567513.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  55.8    2e-06   
ref|WP_026376419.1|  aldehyde dehydrogenase                           55.8    2e-06   
dbj|GAA83104.1|  aldehyde dehydrogenase                               56.2    2e-06   
ref|XP_004287846.2|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.8    2e-06   
ref|WP_012407600.1|  aldehyde dehydrogenase                           55.5    2e-06   
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg           55.8    2e-06   
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                 55.8    2e-06   
ref|WP_036399245.1|  aldehyde dehydrogenase                           55.8    2e-06   
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                 55.8    2e-06   
ref|WP_010909008.1|  aldehyde dehydrogenase                           55.5    2e-06   
ref|XP_001362651.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.5    2e-06   
ref|NP_001147083.1|  LOC100280692                                     55.5    2e-06   
gb|AII42523.1|  aldehyde dehydrogenase                                55.5    2e-06   
ref|WP_010283230.1|  aldehyde dehydrogenase                           55.5    2e-06   
gb|AFW72558.1|  hypothetical protein ZEAMMB73_265586                  55.1    2e-06   
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1        55.5    2e-06   
gb|ETP48266.1|  hypothetical protein F442_05962                       55.5    2e-06   
gb|ETP20334.1|  hypothetical protein F441_05926                       55.5    2e-06   
gb|ETL97017.1|  hypothetical protein L917_05624                       55.5    2e-06   
gb|ETK90433.1|  hypothetical protein L915_05804                       55.5    2e-06   
ref|XP_008891342.1|  hypothetical protein PPTG_02090                  55.5    2e-06   
gb|AFK48458.1|  unknown                                               55.5    2e-06   
ref|WP_030983991.1|  aldehyde dehydrogenase                           55.1    3e-06   
ref|WP_005142534.1|  aldehyde dehydrogenase                           55.1    3e-06   
ref|WP_002696631.1|  aldehyde dehydrogenase                           55.1    3e-06   
ref|WP_042161215.1|  aldehyde dehydrogenase                           55.1    3e-06   
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                        55.1    3e-06   
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.1    3e-06   
ref|XP_008891392.1|  hypothetical protein PPTG_02140                  55.1    3e-06   
gb|ETL43784.1|  hypothetical protein L916_05794                       55.1    3e-06   
gb|EMS54164.1|  Aldehyde dehydrogenase family 3 member F1             52.0    3e-06   
gb|ETK90372.1|  hypothetical protein L915_05858                       55.1    3e-06   
ref|WP_030279505.1|  aldehyde dehydrogenase                           54.7    3e-06   
ref|XP_002888607.1|  hypothetical protein ARALYDRAFT_894498           51.2    4e-06   
ref|WP_030550478.1|  aldehyde dehydrogenase                           54.7    4e-06   
ref|XP_007068502.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.7    4e-06   
gb|EMP27681.1|  Aldehyde dehydrogenase family 3 member B1             54.7    4e-06   
ref|XP_001197038.2|  PREDICTED: aldehyde dehydrogenase-like           53.1    4e-06   
gb|ERL90557.1|  hypothetical protein D910_07905                       54.7    4e-06   
gb|ENN71299.1|  hypothetical protein YQE_12224                        54.7    4e-06   
ref|WP_010694958.1|  hypothetical protein                             54.7    4e-06   
ref|WP_006861193.1|  aldehyde dehydrogenase                           54.7    4e-06   
ref|XP_008643572.1|  PREDICTED: LOC100280692 isoform X1               54.7    4e-06   
ref|WP_002691376.1|  hypothetical protein                             54.7    4e-06   
ref|XP_008508714.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.7    4e-06   
ref|WP_002675966.1|  aldehyde dehydrogenase                           54.7    4e-06   
gb|AIN92873.1|  aldehyde dehydrogenase                                54.7    4e-06   
ref|WP_010689581.1|  hypothetical protein                             54.7    4e-06   
ref|WP_002667397.1|  aldehyde dehydrogenase                           54.7    4e-06   
gb|EDM04680.1|  rCG33224, isoform CRA_b                               52.4    4e-06   
ref|XP_005598406.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.7    4e-06   
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.7    4e-06   
ref|WP_005623275.1|  aldehyde dehydrogenase                           54.7    4e-06   
ref|WP_040895626.1|  hypothetical protein                             54.3    4e-06   
gb|ETI50491.1|  hypothetical protein F443_05986                       54.7    4e-06   
ref|XP_011190641.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.7    5e-06   
ref|XP_011190642.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.7    5e-06   
ref|XP_011190640.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.7    5e-06   
ref|XP_011190639.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.7    5e-06   
ref|XP_011190638.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  54.7    5e-06   
ref|WP_033220514.1|  aldehyde dehydrogenase                           54.3    5e-06   
ref|WP_037681124.1|  aldehyde dehydrogenase                           54.3    5e-06   
gb|ELP63500.1|  aldehyde dehydrogenase (NAD) family protein           54.3    5e-06   
ref|WP_035544786.1|  aldehyde dehydrogenase                           54.3    5e-06   
ref|XP_001498441.2|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.7    5e-06   
gb|EMT10080.1|  Aldehyde dehydrogenase family 3 member F1             52.0    5e-06   
ref|XP_007691372.1|  hypothetical protein COCMIDRAFT_8285             54.3    5e-06   
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  54.3    6e-06   
ref|WP_002684196.1|  hypothetical protein                             54.3    6e-06   
ref|WP_044473555.1|  aldehyde dehydrogenase                           54.3    6e-06   
ref|WP_036776366.1|  aldehyde dehydrogenase                           54.3    6e-06   
ref|WP_014678898.1|  aldehyde dehydrogenase                           54.3    6e-06   
ref|WP_008846550.1|  aldehyde dehydrogenase                           54.3    6e-06   
ref|WP_016642474.1|  putative Aldehyde dehydrogenase, dimeric NAD...  53.9    6e-06   
ref|WP_020403695.1|  hypothetical protein                             53.9    6e-06   
ref|XP_010217375.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  53.9    7e-06   
ref|WP_033347589.1|  aldehyde dehydrogenase                           53.9    7e-06   
ref|XP_011090412.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.8    7e-06   
ref|XP_008280284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  53.9    8e-06   
ref|XP_006617848.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  53.9    8e-06   
ref|WP_017306063.1|  hypothetical protein                             53.9    8e-06   
ref|XP_002118495.1|  hypothetical protein TRIADDRAFT_62530            53.1    9e-06   
ref|XP_007046778.1|  Aldehyde dehydrogenase 3F1 isoform 1             53.5    9e-06   
ref|WP_017321468.1|  hypothetical protein                             53.5    9e-06   
ref|WP_025737394.1|  aldehyde dehydrogenase                           53.5    9e-06   
ref|WP_039713089.1|  aldehyde dehydrogenase                           53.5    9e-06   
ref|WP_018090498.1|  hypothetical protein                             53.5    9e-06   
ref|WP_029112122.1|  aldehyde dehydrogenase                           53.5    9e-06   
ref|WP_004019430.1|  aldehyde dehydrogenase                           53.5    9e-06   
ref|WP_028938787.1|  aldehyde dehydrogenase                           53.5    9e-06   
ref|XP_004170348.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  53.1    9e-06   
gb|EYU46262.1|  hypothetical protein MIMGU_mgv1a0057252mg             50.8    9e-06   
gb|KIW69363.1|  hypothetical protein PV04_05244                       53.5    9e-06   
ref|XP_007865629.1|  NAD-dependent aldehyde dehydrogenase             53.5    9e-06   
ref|XP_006647605.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  53.5    1e-05   
ref|XP_006409196.1|  hypothetical protein EUTSA_v10022980mg           53.5    1e-05   
gb|ETM50100.1|  hypothetical protein L914_05808                       53.5    1e-05   
ref|WP_025157096.1|  aldehyde dehydrogenase                           53.5    1e-05   
ref|XP_003746957.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  53.5    1e-05   
ref|WP_030134163.1|  aldehyde dehydrogenase                           53.5    1e-05   
ref|WP_017740423.1|  hypothetical protein                             53.5    1e-05   
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  53.5    1e-05   
ref|WP_037338325.1|  aldehyde dehydrogenase                           53.1    1e-05   
ref|WP_036459363.1|  aldehyde dehydrogenase                           53.1    1e-05   



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  342  HEIAFVK  362
            HEI+ +K
Sbjct  64   HEISMMK  70



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  342  HEIAFVK  362
            HEI+ +K
Sbjct  64   HEISMMK  70



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            MDA A V ELR T+ +GKTKSYEWRVSQLKA+LKIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGSGKTKSYEWRVSQLKALLKIAENHEKEITDALYSDLSKPELEAFI  60

Query  342  HEIAFVK  362
            HE++ +K
Sbjct  61   HEVSMMK  67



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            MDA A V ELR T+  GKTKSYEWRVSQLKA+ KIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGTGKTKSYEWRVSQLKALFKIAENHEKEITDALYSDLSKPELEAFI  60

Query  342  HEIAFVK  362
            HEI+ +K
Sbjct  61   HEISMMK  67



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  156  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            +E  A AAV ELR T ++GKTKSYEWR+SQLKA+LKI  HHE  I++AL SDL+KPE E+
Sbjct  1    MENMAEAAVKELRSTVSSGKTKSYEWRISQLKAILKIVTHHENEIIEALRSDLNKPEHEA  60

Query  336  FVHEI  350
            F+HEI
Sbjct  61   FIHEI  65



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V ELR ++ +GKT+SYEWR SQLK +LK+AEHHE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRGSYGSGKTRSYEWRESQLKNLLKVAEHHEQEIVDALRSDLSKPEFEAYVQ  75

Query  345  EIAFVK  362
            EI+ +K
Sbjct  76   EISMLK  81



>gb|EPS67420.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=225

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DA A V ELR TFA+G+T+S++WRVSQLKA +KI  +HE+ I++AL SDL+KP+LE+ V
Sbjct  2    VDAEALVGELRSTFASGRTRSFDWRVSQLKAFIKILTYHEEEIVEALRSDLNKPQLEAVV  61

Query  342  HEIA  353
            HEIA
Sbjct  62   HEIA  65



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +3

Query  132  LGREERK*LEM-DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  308
            +G EE    +  DA     ELRE+FA+GKT+SYEWR SQLK +LKI ++HE+ ++ AL S
Sbjct  1    MGSEEANAFDAKDAPKIAGELRESFASGKTRSYEWRTSQLKTILKILDNHEQDMILALRS  60

Query  309  DLSKPELESFVHEIAFVKH  365
            DLSKPE+ES++ EIA +K+
Sbjct  61   DLSKPEMESYIQEIAMLKN  79



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AAA V ELR ++ +GKT+SYEWRVSQLK + KI E HEK I++AL SDLSKPE ESFV 
Sbjct  14   EAAAMVEELRGSYRSGKTRSYEWRVSQLKKLKKITEFHEKEIVEALRSDLSKPETESFVQ  73

Query  345  EIAFVK  362
            EI  +K
Sbjct  74   EIGMLK  79



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE    +++AA  ++ ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLTKELRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  318  KPELESFVHEIAFVKHHVS  374
            KP+LES V+E+  VK+  +
Sbjct  66   KPQLESIVYELTMVKNSCT  84



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 64/91 (70%), Gaps = 9/91 (10%)
 Frame = +3

Query  129  CLGR--------EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHE  281
            C GR        E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HE
Sbjct  56   CCGRKSSMAEDSETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHE  115

Query  282  KAIMDALFSDLSKPELESFVHEIAFVKHHVS  374
            K I+DA+ +DLSKPE ES++ EI+ +K   +
Sbjct  116  KDILDAIRADLSKPEQESYIAEISIIKSSCT  146



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            ++DA   V  LR T+ +GKTKSYEWRVSQLKA+LKI  HH+K +++AL +DL KPE E++
Sbjct  3    QVDAEGVVDGLRRTYISGKTKSYEWRVSQLKALLKITTHHDKEVVEALRADLKKPEHEAY  62

Query  339  VHEIAFVKH  365
            VHEI  V +
Sbjct  63   VHEIFMVSN  71



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  141  EERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  311
            EE+K +  D   A   V ELR ++ +GKT+SYEWR SQL  +LK+ EHHE+ I+DAL SD
Sbjct  5    EEQKRMYFDSKYALTMVEELRASYNSGKTRSYEWRESQLNNLLKVVEHHEQEIVDALRSD  64

Query  312  LSKPELESFVHEIAFVKHHVS  374
            LSKPE E++V EIA +K+  +
Sbjct  65   LSKPEFEAYVQEIAMIKNSCN  85



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +3

Query  132  LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  302
            +  EE K +  D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQMVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  303  FSDLSKPELESFVHEIAFVKHHVS  374
              DLSKP+LES V+EI  +K+  +
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCT  84



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR T+ +GKTK+ EWR SQLKA+++IA HHE  I++AL SDL KPELESFVHEI  V
Sbjct  9    VKELRSTYTSGKTKTLEWRASQLKAIIRIATHHENEIVEALRSDLKKPELESFVHEICAV  68



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AAA V +LR +FA+ KT+SY+WRVSQLKA+LK+A  HE  I+DAL SDLSKPE E+ V+E
Sbjct  12   AAALVKDLRASFASSKTRSYQWRVSQLKALLKLATDHEAEIVDALSSDLSKPEFETIVYE  71

Query  348  IAFVK  362
            I  +K
Sbjct  72   IGMLK  76



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V ELR ++ +GKT+SYEWR SQL  +LK+AE HE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRASYNSGKTRSYEWRESQLNNLLKVAELHEQEIVDALRSDLSKPEFEAYVQ  75

Query  345  EIAFVKHHVS  374
            EIA +K+  +
Sbjct  76   EIAMLKNSCN  85



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  318  KPELESFVHEIAFVKHHVS  374
            KP+LES V+E+  VK+  +
Sbjct  66   KPQLESIVYELTMVKNSCT  84



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  318  KPELESFVHEIAFVKHHVS  374
            KP+LES V+E+  VK+  +
Sbjct  66   KPQLESIVYELTMVKNSCT  84



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A+A V ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES V+E
Sbjct  12   ASAVVKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESKVYE  71

Query  348  IAFVKHHVS  374
            IA +K+  +
Sbjct  72   IAMLKNSCN  80



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  336  FVHEIAFVK  362
             +HEI  VK
Sbjct  68   IIHEIGMVK  76



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  336  FVHEIAFVK  362
             +HEI  VK
Sbjct  68   IIHEIGMVK  76



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  318  KPELESFVHEIAFVKHHVS  374
            KPE ES++ EI+ +K   +
Sbjct  66   KPEQESYIAEISIIKSSCT  84



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  156  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            + +       ELR  +A GKTK++EWRVSQLKA+LKI  HHEK I++AL SDL KPELE+
Sbjct  1    MALGVEGVAGELRSIYATGKTKTFEWRVSQLKAILKITAHHEKEIVEALHSDLKKPELEA  60

Query  336  FVHEIAFV  359
            F++E++ V
Sbjct  61   FLYEVSGV  68



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  318  KPELESFVHEIAFVKHHVS  374
            KPE ES++ EI+ +K   +
Sbjct  66   KPEQESYIAEISIIKSSCT  84



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +3

Query  132  LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  302
            +  EE K    D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQTVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  303  FSDLSKPELESFVHEIAFVKHHVS  374
              DLSKP+LES V+EI  +K+  +
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCT  84



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA+ V+ELR TFAAGKT+SYEWRV+QL  ++K+ E+HE+ I++AL  DL+KPE ES ++E
Sbjct  11   AASTVTELRRTFAAGKTRSYEWRVAQLNGMIKMVENHEQEIVEALRLDLNKPEFESILYE  70

Query  348  IAFVK  362
            I  +K
Sbjct  71   IMLLK  75



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A+A   ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES V+E
Sbjct  12   ASAVAKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESQVYE  71

Query  348  IAFVKHHVS  374
            IA +K+  +
Sbjct  72   IAMIKNSCN  80



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DA   V+ELR +F AG T+ YEWRV+QLK +LKI +HHE  I+ AL  DL KPELES V
Sbjct  8    VDAIELVTELRRSFDAGVTRGYEWRVAQLKNLLKICDHHEPEIVSALRDDLGKPELESSV  67

Query  342  HEIAFVKHHV  371
            +E+A +++ +
Sbjct  68   YEVALLRNSI  77



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELRETF +G+T+S EWR +QLKA++++ E  E  IM AL++DL+KP+LES++HE
Sbjct  20   AAEMVAELRETFRSGRTRSLEWRAAQLKALVRMIEEKESDIMGALYADLAKPQLESYLHE  79

Query  348  IAFVKHHVSW  377
            I+ VK   S+
Sbjct  80   ISLVKSACSF  89



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DAAAA   V ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATELVKELRAIFISGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  336  FVHEIAFVK  362
             +HEI  VK
Sbjct  68   IIHEIGMVK  76



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  345  EIAFVKH  365
            E+  +K+
Sbjct  75   EVGMLKN  81



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  345  EIAFVKH  365
            E+  +K+
Sbjct  75   EVGMLKN  81



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLSKPELES+++EIA +
Sbjct  20   VKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLSKPELESYIYEIAML  79

Query  360  KH  365
            K+
Sbjct  80   KN  81



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            + ++ + ELR +F +GKT+SYEWRV+Q+K+++K+ + HEK I+DAL  DLSKPELES V+
Sbjct  19   EGSSMMKELRGSFGSGKTRSYEWRVTQIKSLVKLCDFHEKEIVDALRLDLSKPELESTVY  78

Query  345  EIAFVKH  365
            EI  +K+
Sbjct  79   EIGMLKN  85



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++   + D+A   V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLS
Sbjct  6    EKKAVFDTDSAKEVVKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLS  65

Query  318  KPELESFVHEIAFVKH  365
            KPELES+++EIA +K+
Sbjct  66   KPELESYIYEIAMLKN  81



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A + V EL+E+F  G+T+SYEWRVSQLK + KI E  EK I +AL+ DLSKPE E+FV 
Sbjct  78   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKIVEEREKDISEALYKDLSKPEFEAFVS  137

Query  345  EIAFVK  362
            EIA VK
Sbjct  138  EIAAVK  143



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  91   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  150

Query  348  IAFVK  362
            I+  K
Sbjct  151  ISLTK  155



>ref|XP_008368060.1| PREDICTED: aldehyde dehydrogenase-like [Malus domestica]
Length=139

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES V+ 
Sbjct  22   ASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQVYV  81

Query  348  IAFVKHHV  371
            I+ + +  
Sbjct  82   ISMLSNSC  89



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  90   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  149

Query  348  IAFVK  362
            I+  K
Sbjct  150  ISLTK  154



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A+A   ELR TFA+ KT+SY+WR SQLK++LK+   +E AI+DAL SDLSKPELES V+E
Sbjct  19   ASALAKELRATFASAKTRSYQWRESQLKSLLKLTTSNEPAIVDALRSDLSKPELESQVYE  78

Query  348  IAFVKH  365
            I+ +K+
Sbjct  79   ISMLKN  84



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A A V +LR TF +GKT+SY+WRVSQLKA+  + E HEK I+ +L+SDLSK E ESF+ 
Sbjct  15   EAFATVKDLRVTFDSGKTRSYKWRVSQLKALFDLTEGHEKEIVASLYSDLSKSETESFIQ  74

Query  345  EIAFVKH  365
            EIA +K+
Sbjct  75   EIAMLKN  81



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A + V EL+E+F  G+T+SYEWRVSQLK + K+ E  EK I +AL+ DLSKPE E+FV 
Sbjct  13   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKMVEEREKDISEALYKDLSKPEFEAFVS  72

Query  345  EIAFVK  362
            EIA VK
Sbjct  73   EIAAVK  78



>ref|XP_006370386.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
 gb|ERP66955.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
Length=423

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V EL E+F  GKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAWLVKELNESFRTGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  345  EIAFVK  362
            EIA VK
Sbjct  136  EIAMVK  141



>gb|KDO80593.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=300

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AAA + ELR +FA+GKTKSY WRV QLK VL++ + +EKAI++AL  DL+KP+ E+FV+E
Sbjct  15   AAALLKELRVSFASGKTKSYGWRVQQLKNVLRMVDENEKAIVEALRLDLAKPKFEAFVNE  74

Query  348  IAFVK  362
            I+ VK
Sbjct  75   ISLVK  79



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR+ F +G+T+SYEWRVSQLKA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQLKALLKAVVDNEEQIVDALRSDLAKPPLETVVYE  78

Query  348  IAFVKH  365
            I   K+
Sbjct  79   IGMFKN  84



>ref|XP_008246188.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like, partial 
[Prunus mume]
Length=173

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  318  KPELESFVHEIAFVKH  365
            KPE+E+F+ E  F+ +
Sbjct  126  KPEVEAFISECLFISY  141



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  156  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            +E+  A  V+ELR TF +GKT+SYEWRVSQLK+++K+ E  E  I++AL SDL+KP  ES
Sbjct  1    MEVTTADMVNELRRTFVSGKTRSYEWRVSQLKSIVKMIEECETQIVEALRSDLNKPPFES  60

Query  336  FVHEIAFVK  362
             ++EI+ +K
Sbjct  61   ILYEISMLK  69



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  13   AAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLSKPELEAFISE  72

Query  348  IAFVK  362
            I+  K
Sbjct  73   ISMTK  77



>gb|KDO80592.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=372

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>ref|XP_006434228.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47468.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=372

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>gb|KHN20142.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=78

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A   V ELR TF  GKT+SYEWR+SQLKA++K+ E +E+ I  AL SDLSK E E+FV 
Sbjct  15   EALMMVKELRVTFDCGKTRSYEWRISQLKAIIKLTEENEQEIYQALHSDLSKCETEAFVQ  74

Query  345  EIA  353
            E +
Sbjct  75   ETS  77



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A   V ELR TF  GKT+SYEWR+SQLKA++K+ E +E+ I  AL SDLSK E E+FV 
Sbjct  15   EALMMVKELRVTFDCGKTRSYEWRISQLKAIIKLTEENEQQIYQALHSDLSKCETEAFVQ  74

Query  345  EIAFVKH  365
            EIA +K+
Sbjct  75   EIAMLKN  81



>ref|XP_008227233.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like [Prunus 
mume]
Length=183

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  318  KPELESFVHEIAFVKH  365
            KPE+E+F+ E  F+ +
Sbjct  126  KPEVEAFISECLFISY  141



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  73   AAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLSKPELEAFISE  132

Query  348  IAFVK  362
            I+  K
Sbjct  133  ISMTK  137



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  68   AAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLSKPELEAFISE  127

Query  348  IAFVK  362
            I+  K
Sbjct  128  ISMTK  132



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V+ LR  F AG T+ YEWRVSQLK +LK+ +HHE  I+ AL  DL KPELES ++
Sbjct  9    DATELVTGLRRGFDAGVTRGYEWRVSQLKNLLKVCDHHEPEIVAALRDDLGKPELESSIY  68

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  69   EVALLRNSI  77



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  348  IAFVKH  365
            I   K+
Sbjct  78   IGMFKN  83



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  348  IAFVKH  365
            I   K+
Sbjct  78   IGMFKN  83



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V EL   FA+GKT+SYEWRV+QLK +LK+ + +EK I++AL  DLSKPELES
Sbjct  15   DAEAARDLVKELTGNFASGKTRSYEWRVAQLKNMLKLCDENEKEIVEALRLDLSKPELES  74

Query  336  FVHEIAFVKH  365
             ++EIA +K+
Sbjct  75   TIYEIALLKN  84



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V EL E F AGKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAFLVKELNENFRAGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  345  EIAFVK  362
            EI+ V+
Sbjct  136  EISMVR  141



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELRE F++GKT+SYEWR+SQ+KA+LK+    +  I+DAL SDL+KP LE+  +E
Sbjct  16   ASSLVKELRENFSSGKTQSYEWRISQVKALLKMVVEQQDQIIDALRSDLAKPPLETVAYE  75

Query  348  IAFVKH  365
            I  +K+
Sbjct  76   IGMLKN  81



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA+  ++ELR +F AG T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRGYEWRVSQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  69   EVALLRNSI  77



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLS+  LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSQAALES  67

Query  336  FVHEIAFVK  362
             +HEI  VK
Sbjct  68   IIHEIGMVK  76



>ref|XP_007161481.1| hypothetical protein PHAVU_001G0727000g, partial [Phaseolus vulgaris]
 gb|ESW33475.1| hypothetical protein PHAVU_001G0727000g, partial [Phaseolus vulgaris]
Length=74

 Score = 75.1 bits (183),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A A V ELR TF  GKT+  EWR SQLKA++K++E HEK I+ AL SDLSK E E+FV 
Sbjct  14   EALAMVEELRATFDCGKTRGLEWRSSQLKALIKLSEEHEKQIVQALHSDLSKSETEAFVQ  73

Query  345  E  347
            E
Sbjct  74   E  74



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  65   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  124

Query  318  KPELESFVHEIAFVK  362
            KPELE+FV EI+  K
Sbjct  125  KPELEAFVSEISMSK  139



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  64   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  123

Query  318  KPELESFVHEIAFVK  362
            KPELE+FV EI+  K
Sbjct  124  KPELEAFVSEISMSK  138



>emb|CDY25655.1| BnaC05g25340D [Brassica napus]
Length=389

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  345  EIAFVKHHVS  374
            E+A +++ ++
Sbjct  69   EVALLRNSIN  78



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  141  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  DLS
Sbjct  65   EKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHEDLS  124

Query  318  KPELESFVHEIAFVK  362
            KPELE+FV EI+  K
Sbjct  125  KPELEAFVSEISMSK  139



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRKNFGSGRTRSYEWRVSQVKALLKAMVDNEDQIVDALRSDLAKPSLETLVYE  77

Query  348  IAFVK  362
            I  +K
Sbjct  78   IGLLK  82



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  336  FVHEIAFVKHHV  371
             ++E+A +K  +
Sbjct  75   SIYEVALLKTSI  86



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  14   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  73

Query  348  I  350
            I
Sbjct  74   I  74



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   ++ELR +F +G T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DATNLMTELRRSFDSGVTRGYEWRVSQLKKLLIICDNHEPEIVSALHDDLGKPELESSVY  69

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  70   EVALLRNSI  78



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  360  KH  365
            K+
Sbjct  80   KN  81



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA+  V+ELR +F AG T  YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DASNLVTELRRSFDAGVTCGYEWRVTQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  69

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  70   EVALLRNSI  78



>gb|KJB64494.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=344

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  318  KPELESFVHEIAFVKHHV  371
            KPELES ++EIA +K+  
Sbjct  66   KPELESSIYEIAMLKNSC  83



>ref|NP_974679.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 gb|AEE86346.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=390

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  345  EIAFVK  362
            EI+  K
Sbjct  134  EISNTK  139



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  61   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  120

Query  348  I  350
            I
Sbjct  121  I  121



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  69   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  128

Query  348  I  350
            I
Sbjct  129  I  129



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  348  I  350
            I
Sbjct  130  I  130



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  73   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  132

Query  348  I  350
            I
Sbjct  133  I  133



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  348  I  350
            I
Sbjct  130  I  130



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSYEWR+SQL+++ K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVEELRSNFNTGRTKSYEWRISQLQSIAKMIDEKEKCITEALYQDLSKPELEAFLA  131

Query  345  EIAFVK  362
            EI+  K
Sbjct  132  EISNTK  137



>gb|ACJ85715.1| unknown [Medicago truncatula]
Length=313

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  360  K  362
            K
Sbjct  133  K  133



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES V+ 
Sbjct  22   ASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQVYV  81

Query  348  IAFVKH  365
            I+ + +
Sbjct  82   ISMLXN  87



>gb|EMS67814.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Triticum 
urartu]
Length=160

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  350
            AAAV ELRE FAAG+T+  EWR +QL+ VL++A   E  I DAL +DL KP+ E+ VHE+
Sbjct  6    AAAVQELRERFAAGQTRPAEWRAAQLRGVLRMATEMEAEICDALHADLGKPKTEAHVHEL  65

Query  351  AFVK  362
            + +K
Sbjct  66   SLIK  69



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  345  EIAFVKHHVS  374
            E+A +++ ++
Sbjct  69   EVALLRNSIN  78



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  69   EVALLRNSI  77



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  360  KH  365
            K+
Sbjct  80   KN  81



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  360  KH  365
            K+
Sbjct  80   KN  81



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  318  KPELESFVHEIAFVKH  365
            KPELES ++EIA +K+
Sbjct  66   KPELESSIYEIAMLKN  81



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  318  KPELESFVHEIAFVKH  365
            KPELES ++EIA +K+
Sbjct  66   KPELESSIYEIAMLKN  81



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  345  EIAFVK  362
            EI+  K
Sbjct  134  EISNTK  139



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  345  EIAFVK  362
            EI+  K
Sbjct  134  EISNTK  139



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA + V+ELR +FA GKT+SY+WR+SQL  + ++ + HE+ I+DAL +D+ KP LE+  +
Sbjct  53   DAESTVNELRASFATGKTRSYKWRLSQLNQLFELTQFHEQEIVDALKNDIDKPPLETVTY  112

Query  345  EIAFVKH  365
            EIA +K+
Sbjct  113  EIAMLKN  119



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V+ELR  FA+GKT+SYEWR+ QL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DALAASRLVTELRGNFASGKTRSYEWRLLQLNAIAKLVVDHEQEIVDALRNDLGKPPLET  80

Query  336  FVHEIAFVKH  365
              +EIA +K+
Sbjct  81   VAYEIAMLKN  90



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  131

Query  345  EIAFVKHHVS  374
            EI+  K   +
Sbjct  132  EISNTKTSCT  141



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  70   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  129

Query  345  EIAFVKHHVS  374
            EI+  K   +
Sbjct  130  EISNTKSSCT  139



>ref|XP_010500186.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=118

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
             V ELR  F  G+TKSYEWR SQL+ + ++  + E  I +AL+ DLSKPELE+F+  I  
Sbjct  46   VVDELRTNFNTGRTKSYEWRFSQLQNISRMLRNKENCITEALYQDLSKPELEAFLVYILV  105

Query  357  VKHHVSWR  380
            V+  ++++
Sbjct  106  VRCRITFK  113



>ref|XP_010500187.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X4 [Camelina sativa]
Length=104

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
             V ELR  F  G+TKSYEWR SQL+ + ++  + E  I +AL+ DLSKPELE+F+  I  
Sbjct  32   VVDELRTNFNTGRTKSYEWRFSQLQNISRMLRNKENCITEALYQDLSKPELEAFLVYILV  91

Query  357  VKHHVSWR  380
            V+  ++++
Sbjct  92   VRCRITFK  99



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  69   EAALLVDELRTNFNTGRTKSYEWRISQLQNISRMLDDKEKCITEALYQDLSKPELEAFLA  128

Query  345  EIAFVKHHVS  374
            EI+  K   +
Sbjct  129  EISNTKSSCT  138



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  345  EIAFV  359
            E+ ++
Sbjct  134  EVFYI  138



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  360  K  362
            K
Sbjct  133  K  133



>gb|EEC67815.1| hypothetical protein OsI_35392 [Oryza sativa Indica Group]
Length=140

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  339  VHEIAFVK  362
            +HEI+  K
Sbjct  63   LHEISLAK  70



>ref|XP_010500185.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=127

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
             V ELR  F  G+TKSYEWR SQL+ + ++  + E  I +AL+ DLSKPELE+F+  I  
Sbjct  55   VVDELRTNFNTGRTKSYEWRFSQLQNISRMLRNKENCITEALYQDLSKPELEAFLVYILV  114

Query  357  VKHHVSWR  380
            V+  ++++
Sbjct  115  VRCRITFK  122



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  360  K  362
            K
Sbjct  133  K  133



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V+ELR  FA+GK  SYEWRVSQ+KA+ K+   HE+ I+DAL  DL+KP LE+
Sbjct  17   DAPAASRLVTELRGAFASGKPSSYEWRVSQVKALAKLVADHEQEIVDALQKDLAKPPLET  76

Query  336  FVHEIAFVKH  365
              +EIA +K+
Sbjct  77   VAYEIAMLKN  86



>ref|XP_010500184.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=141

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
             V ELR  F  G+TKSYEWR SQL+ + ++  + E  I +AL+ DLSKPELE+F+  I  
Sbjct  69   VVDELRTNFNTGRTKSYEWRFSQLQNISRMLRNKENCITEALYQDLSKPELEAFLVYILV  128

Query  357  VKHHVSWR  380
            V+  ++++
Sbjct  129  VRCRITFK  136



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQVKALLKAVVDNEEQIVDALRSDLAKPPLETIVYE  78

Query  348  IAFVKH  365
            +   K+
Sbjct  79   VGMFKN  84



>ref|XP_008227606.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Prunus mume]
Length=368

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  318  KPELESFVHEIAFVKHHVS  374
            KPE+E+F+ EI   K   +
Sbjct  126  KPEVEAFISEIVTAKSSCN  144



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  186  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  353
            ELR  +  GKT+  EWRVSQLKA+LKI   HE  I++AL SDL+KPE E+FVHEIA
Sbjct  11   ELRAAYGGGKTRDLEWRVSQLKALLKIINLHENEIVEALRSDLNKPEYEAFVHEIA  66



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL  PELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGTPELESSVY  68

Query  345  EIAFVKHHV  371
            E+A +++ +
Sbjct  69   EVALLRNSI  77



>gb|ACU23701.1| unknown [Glycine max]
Length=329

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  348  IAFVKH  365
            I   ++
Sbjct  76   IGMFQN  81



>gb|KCW62442.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=386

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  348  IAFVK  362
            I+  +
Sbjct  131  ISMTQ  135



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  345  EIAFVK  362
            E++  K
Sbjct  138  ELSNTK  143



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  345  EIAFVK  362
            E++  K
Sbjct  140  ELSNTK  145



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  345  EIAFVK  362
            E++  K
Sbjct  138  ELSNTK  143



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  345  EIAFVK  362
            E++  K
Sbjct  140  ELSNTK  145



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  345  EIAFVK  362
            E++  K
Sbjct  140  ELSNTK  145



>gb|KCW62441.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=395

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  348  IAFVK  362
            I+  +
Sbjct  131  ISMTQ  135



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V+ELRETF +GKT++Y+W+VSQLK + K+   HE+ I+DAL +D+ KP LE+  +E+  +
Sbjct  20   VNELRETFGSGKTRNYDWKVSQLKQLFKLLNFHEEEIIDALRNDIDKPPLETVAYEVGML  79

Query  360  KH  365
            K+
Sbjct  80   KN  81



>ref|XP_008227591.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Prunus mume]
Length=479

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  318  KPELESFVHEIAFVKHHVS  374
            KPE+E+F+ EI   K   +
Sbjct  126  KPEVEAFISEIVTAKSSCN  144



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA+ V +LR  F  G+TKSYEWR+SQL+ ++++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  84   EAASLVGDLRSNFNTGRTKSYEWRISQLQNIVRMIDEKEKYITEALYQDLSKPELEAFLA  143

Query  345  EIAFVK  362
            EI+  K
Sbjct  144  EISNTK  149



>ref|XP_004502484.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=422

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  348  IAFVKH  365
            I   K+
Sbjct  76   IGMFKN  81



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLET  80

Query  336  FVHEIAFVKH  365
              +EIA +K+
Sbjct  81   VAYEIAMLKN  90



>gb|AAY23279.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91776.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=321

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  339  VHEIAFVK  362
            +HEI+  K
Sbjct  63   LHEISLAK  70



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A   V ELR++F  GKTKSY WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   ANEVVKELRDSFVTGKTKSYRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  348  IAFVKH  365
            I  V +
Sbjct  78   IQMVNN  83



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  318  KPELESFVHEIAFVKHHVS  374
            KPE+E+F+ EI   K   +
Sbjct  126  KPEVEAFISEIVTAKSSCN  144



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  348  IAFVKH  365
            I   K+
Sbjct  76   IGMFKN  81



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA+  V++LR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  11   DASILVTDLRRSFDDGVTRGYEWRVTQLKKLLIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  345  EIAFVKHHV  371
            E++ +++ +
Sbjct  71   EVSLLRNSI  79



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  348  IAFVKH  365
            I   K+
Sbjct  76   IGMFKN  81



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  348  IAFVK  362
            I+  +
Sbjct  131  ISMTQ  135



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  139  DAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLET  198

Query  336  FVHEIAFVKH  365
              +EIA +K+
Sbjct  199  VAYEIAMLKN  208



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  135  GREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALF  305
            G E  K    D A A   V+ LR +FA+G+T+S+EWR +QLK ++++ +  E AIM AL 
Sbjct  5    GEERGKGAGFDGAMAAELVAGLRRSFASGRTRSHEWRAAQLKGIVRMIDEKESAIMAALH  64

Query  306  SDLSKPELESFVHEIAFVK  362
             DL+KP++ES++HEI+  K
Sbjct  65   EDLAKPQMESYLHEISLAK  83



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  76   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  135

Query  348  IAFVK  362
            I+  +
Sbjct  136  ISMTQ  140



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR  + +G+T+S EWR SQLKA+LKIA HHE+ I++AL SDL+KP+ E+++ EIA V
Sbjct  1    VEELRSAYHSGRTRSLEWRASQLKALLKIATHHEEEILEALMSDLNKPKHEAYLFEIASV  60



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = +3

Query  141  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  311
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  312  LSKPELESFVHEIAFVKH  365
            L KPELES ++E A +++
Sbjct  64   LGKPELESVLYEAAMLRN  81



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = +3

Query  141  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  311
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  312  LSKPELESFVHEIAFVKH  365
            L KPELES ++E A +++
Sbjct  64   LGKPELESVLYEAAMLRN  81



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = +3

Query  141  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  311
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  312  LSKPELESFVHEIAFVKH  365
            L KPELES ++E A +++
Sbjct  64   LGKPELESVLYEAAMLRN  81



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSY+WR+SQL+ + ++ +  EK I +AL  DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYQWRISQLQNISRMLDEKEKCITEALNQDLSKPELEAFLA  131

Query  345  EIAFVKHHVS  374
            EI+  K   +
Sbjct  132  EISNTKSSCT  141



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  339  VHEIAFVK  362
            +HEI+  K
Sbjct  63   LHEISLAK  70



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  339  VHEIAFVK  362
            +HEI+  K
Sbjct  63   LHEISLAK  70



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL  DLSKPELE+F+ 
Sbjct  73   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALHQDLSKPELEAFLA  132

Query  345  EIAFVK  362
            E++  K
Sbjct  133  ELSNTK  138



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  7    EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  66

Query  345  EIAFVKHHV  371
            E++ +++ +
Sbjct  67   EVSLLRNSI  75



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  345  EIAFVKHHV  371
            E++ +++ +
Sbjct  71   EVSLLRNSI  79



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  345  EIAFVKHHV  371
            E++ +++ +
Sbjct  71   EVSLLRNSI  79



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ LR  FA+G+T+SYEWR +QLK ++++ +  E  IM AL  DL+KP +ES++HE
Sbjct  19   AAVLVAGLRRGFASGRTRSYEWRAAQLKGIVRMIDDKEAEIMAALHDDLAKPHMESYLHE  78

Query  348  IAFVK  362
            I+  K
Sbjct  79   ISLAK  83



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            + AA   ELR +F AG+T+  EWR +QL+A++++ E  E  I DAL SDL+KP +ES++H
Sbjct  4    EVAAVAGELRASFRAGRTRPAEWRAAQLRAIVRMVEEREGDISDALHSDLAKPRMESYLH  63

Query  345  EIAFVK  362
            EI+  K
Sbjct  64   EISLAK  69



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V+ELRE++ +GKT+SYEWR +QLK +LK+   +E+ ++  + SDL KPE E+F HEIA +
Sbjct  16   VTELRESYNSGKTRSYEWRENQLKNLLKLVCENEEVMVQTVNSDLHKPEFEAFAHEIALL  75

Query  360  K  362
            K
Sbjct  76   K  76



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A   V ELR++F  GKTKS+ WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   AKEVVKELRDSFVTGKTKSHRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  348  IAFVKH  365
            I  +K+
Sbjct  78   IQILKN  83



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  144  ERK*LEMDAA-AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSK  320
            ER   + +AA   V+ELRE++ +GKT+SYEWR +QLK +LK+   +E  ++  + SDL K
Sbjct  3    ERTVFDGEAAERVVTELRESYNSGKTRSYEWRENQLKNMLKLVCENEDVMVQTVNSDLHK  62

Query  321  PELESFVHEIAFVK  362
            PE E+F HEIA +K
Sbjct  63   PEFEAFAHEIALLK  76



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V +LR++F +G TKSY WRVSQL+A+ K+ E  EK I +AL+ DL KP LE+F+ EI+  
Sbjct  73   VKDLRKSFDSGMTKSYGWRVSQLEAIAKMLEEKEKEITEALYKDLGKPRLEAFITEISQA  132

Query  360  KHHVS  374
            K   S
Sbjct  133  KSSCS  137



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A   V ELR++F +G+TKSYEWR+ QL  + ++ +  EK I++AL+ DLSKPELE+F+ E
Sbjct  74   AGLLVKELRKSFNSGRTKSYEWRMLQLSNIARMLDEKEKDIVEALYKDLSKPELETFISE  133

Query  348  IAFVK  362
            I+  K
Sbjct  134  ISTAK  138



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  E++I +AL  DLSKPELE+F+ 
Sbjct  71   EAALLVEELRINFNTGRTKSYEWRISQLQNISRMIDEKERSIAEALHQDLSKPELEAFLA  130

Query  345  EIAFVK  362
            EI+  K
Sbjct  131  EISNTK  136



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  77   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  136

Query  348  I  350
            I
Sbjct  137  I  137



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  87   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  146

Query  348  I  350
            I
Sbjct  147  I  147



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            ++A+  V ELR +F  G T+ YEWRV+QLK +L + ++HE  I+ AL  DL KPELES V
Sbjct  10   VEASDLVKELRRSFDDGVTRGYEWRVTQLKKLLVVFDNHEPEIVAALRDDLGKPELESSV  69

Query  342  HEIAFVKHHV  371
            +E++ +++ V
Sbjct  70   YEVSLLRNSV  79



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA   V +LR TF++G+T+SYEWR++QLK V K+ + +E  I++AL  D+ KP  ESF  
Sbjct  3    DAVRVVRKLRYTFSSGRTRSYEWRIAQLKQVWKLVDENEDQIIEALSEDIGKPPFESFFA  62

Query  345  EIAFVK  362
            EI+  K
Sbjct  63   EISLTK  68



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  159  EMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            EM  A A+ ++LRETF  G T+SYEWR+SQL+ +LK+ + ++  I +AL  D+ KP  ES
Sbjct  79   EMPIADAIATQLRETFTCGSTRSYEWRMSQLEQILKLTDENQTQITEALHQDMGKPVFES  138

Query  336  FVHEIAFVK  362
            F+ EI+  K
Sbjct  139  FISEISLTK  147



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  13   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRDDLGKPELESSVF  72

Query  345  EIAFVKH  365
            E+A +++
Sbjct  73   EVALLRN  79



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHEIVEALRDDLGKPELESSVF  71

Query  345  EIAFVKH  365
            E+A +++
Sbjct  72   EVALLRN  78



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELRE+F +G+T+S+EWRV+QLK + ++    E  I  AL  DL+KP++ESF+ E
Sbjct  10   AAEVVAELRESFESGRTRSFEWRVAQLKGIARLIVEKEAEITAALDDDLAKPQIESFIGE  69

Query  348  IAFVK  362
            I+ V+
Sbjct  70   ISMVR  74



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  348  IAFVKH  365
            I   ++
Sbjct  76   IGMFQN  81



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = +3

Query  111  IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  263
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  47   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  106

Query  264  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVK  362
            + +  EK I++AL  DL KPE E FV EIA +K
Sbjct  107  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIK  139



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = +3

Query  111  IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  263
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  48   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  107

Query  264  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVK  362
            + +  EK I++AL  DL KPE E FV EIA +K
Sbjct  108  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIK  140



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRHDLGKPELESSVF  71

Query  345  EIAFVKH  365
            E+A +++
Sbjct  72   EVALLRN  78



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA  V+ELRETF +G+T+S  WR +QLKA+ ++ + +E  I  AL+ DL+KP  ESF+HE
Sbjct  10   AAEVVAELRETFRSGRTRSLRWRAAQLKALARMIDENEADIAAALYHDLAKPPTESFLHE  69

Query  348  IAFVK  362
            I+  K
Sbjct  70   ISLAK  74



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V +LR+ F +G+TKSYEWRVSQL+A+ K+ E  EK I +AL+ DL+KP  E+F+ E+   
Sbjct  98   VRDLRKCFDSGRTKSYEWRVSQLEAISKMLEEKEKEITEALYKDLAKPPFEAFITEVTQA  157

Query  360  KHHVS  374
            K   +
Sbjct  158  KSSCN  162



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA   +E+RE F +GKT+S EWR +QLK ++++ E  E  IM AL +DL+KP  ES++HE
Sbjct  20   AAEMEAEMREIFRSGKTRSLEWRAAQLKGLVRMIEEKEADIMAALDADLAKPPFESYLHE  79

Query  348  IAFVKHHVSW  377
            ++ VK   ++
Sbjct  80   VSLVKSSCTF  89



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            E   A+ V ELR+ F  GKTKSYEWR++QL+ + ++ +   K I  AL  DL+KPELE+F
Sbjct  68   EETVASLVEELRDNFKTGKTKSYEWRITQLEGIARMIDEKSKYIAQALREDLNKPELEAF  127

Query  339  VHEIAFVK  362
            + EI+  K
Sbjct  128  LAEISNTK  135



>ref|XP_010679827.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D  + +SELRETF +GKTKS EWR +QL+A+  + EH EK    ALF D+ K +LE++
Sbjct  3    DKDTMSLLSELRETFKSGKTKSLEWRKTQLQALSNMVEHQEKLCFQALFDDVGKGKLEAY  62

Query  339  VHEIAFVKHHVSW  377
              E+   K  + +
Sbjct  63   KDEVGPTKKTIEY  75



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V+ LR  FAAG+T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA V
Sbjct  8    VAALRGRFAAGRTRGAEWRAAQLRGLLRMAAEAEAEVCRALHADLAKPSTESYVHEIALV  67

Query  360  K  362
            K
Sbjct  68   K  68



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  156  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            +E  AAA ++ELR +F  G+T+  EWR +QL++++++ E  E  I DAL +DL+KP +E+
Sbjct  9    MEPTAAALMAELRGSFREGRTRPAEWRTAQLRSLVRMIEEKEDDISDALHADLAKPRMEA  68

Query  336  FVHEIAFVK  362
            ++HEI+  K
Sbjct  69   YLHEISLAK  77



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = +3

Query  165  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            DAAAA   V +LR +F  G T+SYEWRVSQL+++LK++  HE+ + +AL SDLSKP LES
Sbjct  12   DAAAATELVKKLRRSFTTGTTRSYEWRVSQLQSLLKLSLEHEEDLCNALHSDLSKPVLES  71

Query  336  FVHEIAFVK  362
             VHEIA +K
Sbjct  72   IVHEIALLK  80



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  174  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  353
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKPYTESYVHEIA  70

Query  354  FVK  362
             VK
Sbjct  71   LVK  73



>ref|WP_031467875.1| aldehyde dehydrogenase [Sciscionella sp. SE31]
Length=460

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            VS LR TFAA KTK  +WR+ QL  V ++ E HEKAI DAL++DL +P  E+++ +IA  
Sbjct  13   VSRLRATFAAAKTKDVQWRIRQLHGVERLLEEHEKAIADALYADLGRPYGEAWLGDIASS  72

Query  360  KHHVSW  377
            K   ++
Sbjct  73   KAEAAF  78



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  186  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVK  362
            ELR  F +G+T+  EWR +QLKA++++ E  E  I DAL +DL+KP +ES++HEI+  K
Sbjct  11   ELRGCFRSGRTRPAEWRAAQLKALVRMIEDKENDISDALHADLAKPRMESYLHEISLAK  69



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HEI+  
Sbjct  9    VRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHEISLT  68

Query  360  K  362
            K
Sbjct  69   K  69



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HEI+  
Sbjct  6    VRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHEISLT  65

Query  360  K  362
            K
Sbjct  66   K  66



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HEI+  
Sbjct  6    VRELRASFAAGQTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHEISLT  65

Query  360  K  362
            K
Sbjct  66   K  66



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AAA + ELR +F  G+T+  EWR +QL+A++++ E  E  I DAL +DL+KP +E+++HE
Sbjct  5    AAAVMEELRGSFREGRTRPAEWRTAQLRALVRMIEEKEDDISDALHADLAKPRMEAYLHE  64

Query  348  IA  353
            + 
Sbjct  65   VC  66



>gb|KJB17707.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=327

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  357  VKHHVSW  377
            +K  V++
Sbjct  64   LKKSVTY  70



>ref|XP_009060246.1| hypothetical protein LOTGIDRAFT_229102 [Lottia gigantea]
 gb|ESO89209.1| hypothetical protein LOTGIDRAFT_229102 [Lottia gigantea]
Length=503

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            ++EL ETF  GKTK+YEWR  QL+ +LK+ E + KAI DALF DL K   E+ + E   V
Sbjct  8    ITELHETFLTGKTKTYEWRDRQLRQLLKLIEENGKAIEDALFKDLHKHANEAQIMETGMV  67

Query  360  KH  365
            K+
Sbjct  68   KN  69



>ref|WP_026197256.1| aldehyde dehydrogenase [Sciscionella marina]
Length=460

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            VS+LR TFA  KT+  +WR+ QL  V ++ E HEKAI DAL++DL +P  E+++ +IA  
Sbjct  13   VSKLRATFATAKTRDVQWRIRQLHGVERLLEEHEKAIADALYADLGRPYGEAWLGDIASS  72

Query  360  KHHVSW  377
            K   ++
Sbjct  73   KAEAAF  78



>gb|KJB17706.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=479

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  357  VKHHVSW  377
            +K  V++
Sbjct  64   LKKSVTY  70



>emb|CDP01945.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  350
            A  ++ELR+TF +GKT+  EWR +QL+A+LK+ + +E +I DAL  DL K  +ES+  E+
Sbjct  8    ARNLAELRQTFRSGKTRGLEWRKAQLRAILKLLDENEDSIFDALQQDLGKHPVESYRDEV  67

Query  351  AFVK  362
              +K
Sbjct  68   GVLK  71



>ref|WP_015772232.1| aldehyde dehydrogenase [Jonesia denitrificans]
 gb|ACV09604.1| Aldehyde Dehydrogenase [Jonesia denitrificans DSM 20603]
Length=468

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            D A  V  LR+TF AG TK   WR+ QL A+ ++   HEK I +AL SDL KPE E+++ 
Sbjct  8    DIAGTVHGLRDTFRAGTTKPLAWRLRQLDALEQLVSSHEKEIAEALASDLGKPEAEAYLT  67

Query  345  EIAFV  359
            E +F+
Sbjct  68   ETSFL  72



>emb|CDX72584.1| BnaC07g46060D [Brassica napus]
Length=484

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QLKA++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLKAIIEMVKDNEEKMCDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>tpg|DAA38940.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=317

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HEI+  
Sbjct  6    VQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHEISIT  65

Query  360  K  362
            +
Sbjct  66   R  66



>ref|XP_002115478.1| hypothetical protein TRIADDRAFT_59449 [Trichoplax adhaerens]
 gb|EDV21841.1| hypothetical protein TRIADDRAFT_59449 [Trichoplax adhaerens]
Length=531

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 3/78 (4%)
 Frame = +3

Query  138  REERK*LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  317
            REE   +E   +  V   R  F +GKT+S ++R  QL+A+LK+   HEK I DA+F DL 
Sbjct  29   REEMMLIE---SKIVQNARTAFRSGKTQSVDFRQQQLRALLKLTRDHEKEICDAIFKDLH  85

Query  318  KPELESFVHEIAFVKHHV  371
            KP  E+ V E+AF+++ +
Sbjct  86   KPYEEALVSEVAFLRNEL  103



>gb|KJB17709.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=405

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  357  VKHHVSW  377
            +K  V++
Sbjct  64   LKKSVTY  70



>gb|KJB17708.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=406

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  357  VKHHVSW  377
            +K  V++
Sbjct  64   LKKSVTY  70



>ref|XP_008668343.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=541

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HEI+  
Sbjct  6    VQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHEISIT  65

Query  360  K  362
            +
Sbjct  66   R  66



>ref|WP_014210046.1| aldehyde dehydrogenase [Mycobacterium rhodesiae]
 gb|AEV72232.1| NAD-dependent aldehyde dehydrogenase [Mycobacterium rhodesiae 
NBB3]
Length=469

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            D A  V +LRETFA+G+T+S EWR  QL+A+ ++   +E AIM+AL SDL +   E+++ 
Sbjct  17   DIAGTVRKLRETFASGRTRSVEWRKQQLEALERMMTDNEGAIMEALESDLGRSPFEAWLA  76

Query  345  EIA  353
            +IA
Sbjct  77   DIA  79



>gb|KAQ21680.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis MD15770]
 gb|KEB37221.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis BTB07-314]
Length=185

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|KEA73408.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis NRITLD18]
 gb|KEB37958.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis BTB07-234]
Length=169

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  29   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  88

Query  339  VHEIA  353
            + +IA
Sbjct  89   LADIA  93



>gb|KHG21488.1| Aldehyde dehydrogenase family 3 member F1 [Gossypium arboreum]
Length=479

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKNGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  357  VKHHVSW  377
            +K  V++
Sbjct  64   LKKSVTY  70



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HEI+  
Sbjct  6    VQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHEISIT  65

Query  360  K  362
            +
Sbjct  66   R  66



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  348  IAFV  359
            I+ V
Sbjct  67   ISLV  70



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  168  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  348  IAFV  359
            I+ V
Sbjct  67   ISLV  70



>ref|XP_009138416.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Brassica rapa]
Length=472

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|XP_009138415.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Brassica rapa]
Length=484

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>emb|CDX69216.1| BnaC01g02370D [Brassica napus]
Length=481

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  357  V  359
            V
Sbjct  68   V  68



>ref|XP_006118454.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like, partial 
[Pelodiscus sinensis]
Length=117

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  171  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  350
            A  VS LR  + AGKT+  E RVSQL+A+ +  +  ++ I+DA+ SD+ KP LE+ + +I
Sbjct  31   AGLVSGLRAAWLAGKTRGAEHRVSQLEALGRFLDDKKQPILDAMASDMRKPPLEAELSQI  90

Query  351  AFVKHHVSW  377
              VK+ V++
Sbjct  91   LLVKNEVNY  99



>emb|CDX77447.1| BnaA07g05850D [Brassica napus]
Length=481

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  357  V  359
            V
Sbjct  68   V  68



>gb|KFK30260.1| hypothetical protein AALP_AA7G238000 [Arabis alpina]
Length=485

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLGAIIEMVKDNEDKLCDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|WP_042756386.1| aldehyde dehydrogenase, partial [Mycobacterium tuberculosis]
Length=216

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  30   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  89

Query  339  VHEIA  353
            + +IA
Sbjct  90   LADIA  94



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  186  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKH  365
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K 
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  366  HVS  374
              +
Sbjct  153  SCN  155



>ref|XP_006412015.1| hypothetical protein EUTSA_v10025045mg [Eutrema salsugineum]
 gb|ESQ53468.1| hypothetical protein EUTSA_v10025045mg [Eutrema salsugineum]
Length=485

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLAAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V+ELR+ F +G+T+  EWR +QL+A+L++ +  E  I++AL  D+ KP  E++V E++ +
Sbjct  10   VAELRDAFRSGRTRPMEWRAAQLRAMLRMIDEREGEIIEALDRDIGKPAYETYVAELSTI  69

Query  360  --------KHHVSW  377
                    KH  SW
Sbjct  70   ANSCTNALKHLRSW  83



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  186  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKH  365
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K 
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  366  HVS  374
              +
Sbjct  153  SCN  155



>ref|WP_043403838.1| aldehyde dehydrogenase [Mycobacterium rufum]
 gb|KGI66223.1| aldehyde dehydrogenase [Mycobacterium rufum]
Length=469

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            D AA V  LRETFA+G+T+S EWR  QL+A+ ++   +E AI DAL  DL +   E+++ 
Sbjct  17   DIAATVRRLRETFASGRTRSVEWRKQQLQALERLMTENEGAIADALAKDLDRKPFEAWLA  76

Query  345  EIA  353
            +IA
Sbjct  77   DIA  79



>ref|WP_009627619.1| Aldehyde Dehydrogenase [Pseudanabaena biceps]
 gb|ELS32285.1| Aldehyde Dehydrogenase [Pseudanabaena biceps PCC 7429]
Length=463

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +D  A +++ R  F   KTK YE+RVSQLK + ++ + +EK I+DA+++DL KP +E F 
Sbjct  9    LDIPATIAKQRIFFDGNKTKDYEFRVSQLKKLAQLIKENEKLILDAVYADLRKPTIEIFG  68

Query  342  HEIAF--------VKHHVSW  377
             EI          +KH  +W
Sbjct  69   SEILIALSEIRYVIKHLKAW  88



>gb|EWM24499.1| aldehyde dehydrogenase, partial [Nannochloropsis gaditana]
Length=211

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  156  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  335
            LE     AV+ELR TF +G T  Y+WR  QLKA+  + + H+K I+ A+  DL KPE E+
Sbjct  5    LETKMKDAVAELRATFESGVTLPYKWREEQLKALEAMIKGHKKEILAAIHKDLRKPEAEA  64

Query  336  FVHEIAFVKHHV  371
             + E+A  +H V
Sbjct  65   DITELAVAEHEV  76



>ref|WP_041308647.1| aldehyde dehydrogenase [Intrasporangium calvum]
Length=461

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            M+AA+ V ELR  FAAG TK   WR +QL  + ++    E A+ DAL +DL K   ES++
Sbjct  1    MEAASLVDELRSVFAAGVTKPLAWRTAQLTGLRRMLTEQETALADALATDLGKHGTESWI  60

Query  342  HEIAFVKHHVS  374
             E+ F  + ++
Sbjct  61   TELGFTSNEIT  71



>emb|CDY24790.1| BnaA08g15200D [Brassica napus]
Length=488

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            DA +  +ELR  F  G T++ EWR +QL+ +L++A   E  + DAL +DL+KP  E+ +H
Sbjct  3    DARSWAAELRGRFEEGLTRAAEWRAAQLRGLLRMATEMEAEMCDALHADLAKPRTEACLH  62

Query  345  EIAFVK  362
            EI+ +K
Sbjct  63   EISLIK  68



>emb|CDY35463.1| BnaC03g61970D [Brassica napus]
Length=488

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|WP_010353711.1| aldehyde dehydrogenase [Streptomyces acidiscabies]
Length=464

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DAAA VS L  TFA G+T+   WR  QL+A+  +    +  + DAL +DL K  LES++
Sbjct  9    LDAAATVSRLNATFATGRTRPASWRKEQLRALRALLIDRQTELSDALHADLGKSPLESYL  68

Query  342  HEIAFVKHHV  371
             E+ FV + +
Sbjct  69   TELGFVVNEI  78



>emb|CDY59717.1| BnaA03g59170D [Brassica napus]
Length=484

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  70

Query  357  V  359
            V
Sbjct  71   V  71



>ref|WP_006011635.1| aldehyde dehydrogenase [Glaciecola pallidula]
 dbj|GAC29092.1| aldehyde dehydrogenase [Glaciecola pallidula DSM 14239 = ACAM 
615]
Length=468

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            + EL+ TFA G+TK Y+WRV QL A+ ++ + +  AI+ AL +DL K E ES++ EI +
Sbjct  21   IDELKRTFATGRTKPYQWRVEQLTALKQLIQENSNAIILALHTDLGKSETESWLTEIGY  79



>ref|XP_009145598.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Brassica 
rapa]
Length=481

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  357  V  359
            V
Sbjct  68   V  68



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            V+E+RE +   +TK  EWRV QLK +L++    E  I++AL++DL KP  ES++ EI+ V
Sbjct  19   VAEVREAYMTMRTKPAEWRVQQLKGLLRMVIESESEIVEALYADLGKPAHESYMSEISLV  78

Query  360  K  362
            K
Sbjct  79   K  79



>ref|XP_002452841.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
 gb|EES05817.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
Length=486

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            VS+LRE + +G+T+  EWR SQL+ ++++ E  E+AI DAL  DL K  +E+F  E+  +
Sbjct  18   VSDLREVYESGRTQDMEWRQSQLRGLVRLLEDEEEAIFDALHEDLGKHRVEAFRDEVGVL  77

Query  360  KHHV  371
            K  V
Sbjct  78   KKSV  81



>ref|XP_009023429.1| hypothetical protein HELRODRAFT_185832 [Helobdella robusta]
 gb|ESN98475.1| hypothetical protein HELRODRAFT_185832 [Helobdella robusta]
Length=496

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            VS+L  +FA GKTK+ EWR++QL A+L   E     I +AL  DLSKP LES V E   V
Sbjct  8    VSDLHASFATGKTKTKEWRMAQLLALLNFIEKESDGIAEALAKDLSKPFLESIVFECDTV  67

Query  360  KHHV  371
            ++ +
Sbjct  68   RNEI  71



>ref|WP_008182868.1| aldehyde dehydrogenase [Moorea producens]
 gb|EGJ33158.1| NAD-dependent aldehyde dehydrogenase [Moorea producens 3L]
Length=461

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  359
            VS LR T+A GKT+S +WR+ QL+ V K+   +E  I +AL +DL K +LE++  EI+++
Sbjct  13   VSRLRNTYATGKTRSLQWRIQQLQQVKKMTLDNEDKIREALLADLGKCQLEAWSAEISYI  72

Query  360  KHHV  371
               V
Sbjct  73   ATEV  76



>ref|WP_031755147.1| aldehyde dehydrogenase, partial [Mycobacterium tuberculosis]
Length=324

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  29   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  88

Query  339  VHEIA  353
            + +IA
Sbjct  89   LADIA  93



>ref|WP_036006670.1| aldehyde dehydrogenase [Leptolyngbya sp. JSC-1]
Length=451

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  171  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  350
            AA V   R  FA G+T+S E+R++QLKA+ +    HE AI+ AL +DL KPELE+++ EI
Sbjct  2    AAIVHRQRTFFATGQTQSVEFRLTQLKALKQAILDHEAAILKALKADLHKPELEAYLTEI  61

Query  351  AFVK  362
              +K
Sbjct  62   GVIK  65



>ref|WP_031754101.1| aldehyde dehydrogenase, partial [Mycobacterium tuberculosis]
Length=322

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  29   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  88

Query  339  VHEIA  353
            + +IA
Sbjct  89   LADIA  93



>ref|WP_041246595.1| aldehyde dehydrogenase [Glaciecola nitratireducens]
Length=457

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI +
Sbjct  9    IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGY  67



>ref|WP_016720740.1| aldehyde dehydrogenase, partial [Mycobacterium tuberculosis]
Length=341

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  16   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  75

Query  339  VHEIA  353
            + +IA
Sbjct  76   LADIA  80



>gb|AEP28780.1| NAD-dependent aldehyde dehydrogenase [Glaciecola nitratireducens 
FR1064]
Length=469

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI +
Sbjct  21   IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGY  79



>ref|WP_006242686.1| aldehyde dehydrogenase [Mycobacterium tusciae]
Length=469

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  165  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  344
            D  A V  LRETFA+G+T+S EWR  QL+A+ ++   +E AIM+AL  DL +   E+++ 
Sbjct  16   DIPATVRRLRETFASGRTRSVEWRKQQLEALERMMTENEGAIMEALEKDLGRSPFEAWLA  75

Query  345  EIA  353
            +IA
Sbjct  76   DIA  78



>ref|XP_003746960.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like 
[Metaseiulus occidentalis]
Length=511

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +3

Query  126  YCLGREERK*LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALF  305
            + LG EER  +       +  LR +FA+GKTKS +WR+ QLKA+ +  E H  A   A+ 
Sbjct  9    HTLGAEER--VHTKYTDRLDRLRRSFASGKTKSVKWRIQQLKAMRRFLEDHRGAFKQAMK  66

Query  306  SDLSKPELESFVHEIAFVKHHV  371
             DL+K  +E+ + E+ FV + +
Sbjct  67   KDLNKNPMEADLFEVEFVINEI  88



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            +DAA   S LRETF  G+T+   WR+ QL A++K+ E +E  I  ALF+DL KP  E+  
Sbjct  10   LDAAKVASCLRETFRTGRTRPSNWRLEQLHAIVKLIEENEDEICRALFADLHKPRHEALT  69

Query  342  HE  347
             E
Sbjct  70   ME  71



>gb|AFE15141.1| aldehyde dehydrogenase (NAD+) dependent [Mycobacterium tuberculosis 
RGTB327]
Length=474

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|ADD38780.1| Fatty aldehyde dehydrogenase [Lepeophtheirus salmonis]
Length=500

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            MD    V+ LR  F  GKTK  +WR SQL+A++K+ +  E   + AL  DL KP+ ES +
Sbjct  1    MDFPKTVNALRSAFNTGKTKDLKWRKSQLRALVKMFDEQEDVFVSALKQDLGKPKQESIL  60

Query  342  HEIAFVKH  365
             EI F ++
Sbjct  61   MEIKFTQN  68



>ref|XP_005104004.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like isoform 
X1 [Aplysia californica]
 ref|XP_005104005.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like isoform 
X2 [Aplysia californica]
Length=501

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  180  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  347
            + ++R  FA GKT++YEWR+SQLKA+++  + +   I + LF DL K  LES V E
Sbjct  6    MKDVRSAFATGKTRTYEWRISQLKAIMRCLQENSDKINEVLFKDLHKHSLESVVME  61



>ref|WP_031698077.1| aldehyde dehydrogenase [Mycobacterium tuberculosis]
Length=491

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  30   QTDVAKTVARLRKTFASGRTRSVEWRKPQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  89

Query  339  VHEIA  353
            + +IA
Sbjct  90   LADIA  94



>ref|XP_009109317.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Brassica 
rapa]
Length=494

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  177  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  356
            ++ E+R+TFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  17   SLREMRDTFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  76

Query  357  V  359
            V
Sbjct  77   V  77



>gb|KBM34808.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis KT-0010]
Length=506

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKPQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|ACO12663.1| Aldehyde dehydrogenase, dimeric NADP-preferring [Lepeophtheirus 
salmonis]
Length=500

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +3

Query  162  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  341
            MD    V+ LR  F  GKTK  +WR SQL+A++K+ +  E   + AL  DL KP+ ES +
Sbjct  1    MDFPKTVNALRSAFNTGKTKDLKWRKSQLRALVKMFDEQEDVFVSALKQDLGKPKQESIL  60

Query  342  HEIAFVKH  365
             EI F ++
Sbjct  61   MEIKFTQN  68



>ref|WP_003907304.1| aldehyde dehydrogenase NAD-dependent, partial [Mycobacterium 
tuberculosis]
 gb|EFD45444.1| LOW QUALITY PROTEIN: aldehyde dehydrogenase NAD-dependent, partial 
[Mycobacterium tuberculosis T17]
Length=491

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|KBM59215.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis KT-0029]
Length=506

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|KAN83639.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis 1010SM]
Length=506

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



>gb|KCM61171.1| aldehyde dehydrogenase (NAD+) [Mycobacterium tuberculosis BTB03-108]
Length=506

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  338
            + D A  V+ LR+TFA+G+T+S EWR  QL+A+ K+ + +E AI  AL  DL +   E++
Sbjct  45   QTDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY  104

Query  339  VHEIA  353
            + +IA
Sbjct  105  LADIA  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565581808380