BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004I13

Length=424
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010325953.1|  PREDICTED: ER membrane protein complex subun...  82.8    3e-15   Solanum lycopersicum
ref|XP_006366781.1|  PREDICTED: ER membrane protein complex subun...  82.8    3e-15   Solanum tuberosum [potatoes]
emb|CDY67992.1|  BnaCnng57230D                                        80.1    1e-14   Brassica napus [oilseed rape]
ref|XP_011094459.1|  PREDICTED: ER membrane protein complex subun...  78.6    8e-14   Sesamum indicum [beniseed]
ref|XP_010419729.1|  PREDICTED: ER membrane protein complex subun...  78.2    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009597396.1|  PREDICTED: ER membrane protein complex subun...  78.2    1e-13   Nicotiana tomentosiformis
ref|XP_010491889.1|  PREDICTED: ER membrane protein complex subun...  76.3    5e-13   Camelina sativa [gold-of-pleasure]
emb|CDX85707.1|  BnaA02g01060D                                        75.5    8e-13   
ref|XP_002324236.2|  hypothetical protein POPTR_0018s00550g           74.3    3e-12   
ref|XP_011026615.1|  PREDICTED: ER membrane protein complex subun...  74.3    3e-12   Populus euphratica
ref|XP_008378089.1|  PREDICTED: ER membrane protein complex subun...  72.4    9e-12   
ref|XP_009346082.1|  PREDICTED: ER membrane protein complex subun...  72.4    9e-12   Pyrus x bretschneideri [bai li]
ref|XP_009785843.1|  PREDICTED: ER membrane protein complex subun...  71.6    2e-11   Nicotiana sylvestris
gb|KFK25418.1|  hypothetical protein AALP_AA8G112000                  71.2    2e-11   Arabis alpina [alpine rockcress]
ref|XP_006399663.1|  hypothetical protein EUTSA_v10012570mg           71.2    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009125814.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...  69.7    9e-11   Brassica rapa
ref|XP_010100254.1|  hypothetical protein L484_007251                 68.2    3e-10   
ref|XP_009121935.1|  PREDICTED: ER membrane protein complex subun...  67.8    3e-10   Brassica rapa
gb|KDO79764.1|  hypothetical protein CISIN_1g002016mg                 67.8    3e-10   Citrus sinensis [apfelsine]
ref|XP_006450658.1|  hypothetical protein CICLE_v10007348mg           67.8    3e-10   Citrus clementina [clementine]
gb|KDO79766.1|  hypothetical protein CISIN_1g002016mg                 67.4    4e-10   Citrus sinensis [apfelsine]
emb|CDX69747.1|  BnaA10g20960D                                        67.8    4e-10   
gb|KDO79765.1|  hypothetical protein CISIN_1g002016mg                 67.4    4e-10   Citrus sinensis [apfelsine]
emb|CDX91208.1|  BnaC02g03890D                                        67.4    5e-10   
ref|XP_010453205.1|  PREDICTED: ER membrane protein complex subun...  67.0    6e-10   Camelina sativa [gold-of-pleasure]
gb|EYU41569.1|  hypothetical protein MIMGU_mgv1a000799mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
gb|KDP34198.1|  hypothetical protein JCGZ_07769                       66.2    1e-09   Jatropha curcas
ref|XP_002516556.1|  catalytic, putative                              66.2    1e-09   
ref|XP_002284012.1|  PREDICTED: ER membrane protein complex subun...  66.2    1e-09   Vitis vinifera
ref|XP_002308610.1|  hypothetical protein POPTR_0006s25700g           65.9    2e-09   
ref|XP_011019630.1|  PREDICTED: ER membrane protein complex subun...  65.9    2e-09   Populus euphratica
ref|XP_009396281.1|  PREDICTED: ER membrane protein complex subun...  65.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008393881.1|  PREDICTED: ER membrane protein complex subun...  65.1    3e-09   
ref|XP_009367894.1|  PREDICTED: ER membrane protein complex subun...  65.1    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_010541259.1|  PREDICTED: ER membrane protein complex subun...  65.1    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_009395509.1|  PREDICTED: ER membrane protein complex subun...  64.3    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002873520.1|  hypothetical protein ARALYDRAFT_487993           63.5    9e-09   
ref|XP_007137196.1|  hypothetical protein PHAVU_009G1078000g          62.8    1e-08   Phaseolus vulgaris [French bean]
ref|NP_196717.3|  PQQ_DH domain-containing protein                    62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522701.1|  PREDICTED: ER membrane protein complex subun...  61.6    3e-08   Glycine max [soybeans]
gb|KHN10213.1|  Hypothetical protein glysoja_017817                   61.6    4e-08   Glycine soja [wild soybean]
emb|CDP15321.1|  unnamed protein product                              61.2    5e-08   Coffea canephora [robusta coffee]
ref|XP_003636448.1|  hypothetical protein MTR_041s0018                60.5    8e-08   
ref|XP_006287000.1|  hypothetical protein CARUB_v10000146mg           60.5    1e-07   Capsella rubella
gb|KEH36041.1|  ER membrane protein complex subunit-like protein      60.1    1e-07   Medicago truncatula
ref|XP_009623191.1|  PREDICTED: ER membrane protein complex subun...  60.1    1e-07   Nicotiana tomentosiformis
ref|XP_009759124.1|  PREDICTED: ER membrane protein complex subun...  60.1    1e-07   Nicotiana sylvestris
ref|XP_010254043.1|  PREDICTED: ER membrane protein complex subun...  59.7    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010254044.1|  PREDICTED: ER membrane protein complex subun...  59.7    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008802826.1|  PREDICTED: ER membrane protein complex subun...  59.7    2e-07   Phoenix dactylifera
ref|XP_003526482.1|  PREDICTED: ER membrane protein complex subun...  59.3    2e-07   Glycine max [soybeans]
gb|KHN18187.1|  Hypothetical protein glysoja_025077                   58.9    3e-07   Glycine soja [wild soybean]
ref|XP_010925904.1|  PREDICTED: ER membrane protein complex subun...  58.5    4e-07   Elaeis guineensis
ref|XP_004291191.2|  PREDICTED: ER membrane protein complex subun...  57.8    7e-07   Fragaria vesca subsp. vesca
ref|XP_004501175.1|  PREDICTED: ER membrane protein complex subun...  57.8    8e-07   Cicer arietinum [garbanzo]
gb|KJB65683.1|  hypothetical protein B456_010G108200                  57.0    1e-06   Gossypium raimondii
gb|KJB65685.1|  hypothetical protein B456_010G108200                  57.0    1e-06   Gossypium raimondii
gb|KJB65682.1|  hypothetical protein B456_010G108200                  57.0    1e-06   Gossypium raimondii
gb|KHG26099.1|  Uncharacterized protein F383_09262                    57.0    1e-06   Gossypium arboreum [tree cotton]
gb|KJB65684.1|  hypothetical protein B456_010G108200                  56.6    2e-06   Gossypium raimondii
ref|XP_006833394.1|  hypothetical protein AMTR_s00109p00121860        55.8    3e-06   Amborella trichopoda
ref|XP_001765108.1|  predicted protein                                55.5    4e-06   
gb|KJB27314.1|  hypothetical protein B456_004G290400                  55.1    5e-06   Gossypium raimondii
gb|KHG18967.1|  Uncharacterized protein F383_07420                    55.1    6e-06   Gossypium arboreum [tree cotton]
ref|XP_010049094.1|  PREDICTED: ER membrane protein complex subun...  54.7    7e-06   Eucalyptus grandis [rose gum]
ref|XP_010049093.1|  PREDICTED: ER membrane protein complex subun...  54.7    7e-06   Eucalyptus grandis [rose gum]
ref|XP_008648064.1|  PREDICTED: uncharacterized protein LOC100381...  54.3    9e-06   
ref|XP_007012092.1|  Catalytics isoform 1                             54.3    1e-05   
ref|XP_007012093.1|  Catalytics isoform 2                             54.3    1e-05   
ref|XP_010668174.1|  PREDICTED: ER membrane protein complex subun...  53.5    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004164260.1|  PREDICTED: ER membrane protein complex subun...  52.4    3e-05   
ref|XP_004150284.1|  PREDICTED: ER membrane protein complex subun...  52.4    4e-05   Cucumis sativus [cucumbers]
ref|XP_008445027.1|  PREDICTED: ER membrane protein complex subun...  52.4    4e-05   Cucumis melo [Oriental melon]
gb|KHG08509.1|  Uncharacterized protein F383_13837                    51.6    6e-05   Gossypium arboreum [tree cotton]
gb|KJB82870.1|  hypothetical protein B456_013G218700                  51.6    7e-05   Gossypium raimondii
ref|XP_008220058.1|  PREDICTED: ER membrane protein complex subun...  51.2    8e-05   Prunus mume [ume]
gb|AFW82067.1|  hypothetical protein ZEAMMB73_676127                  51.2    9e-05   
ref|XP_008656322.1|  PREDICTED: ER membrane protein complex subun...  51.2    1e-04   
ref|XP_007227052.1|  hypothetical protein PRUPE_ppa000842mg           50.8    1e-04   
ref|XP_006654166.1|  PREDICTED: ER membrane protein complex subun...  50.4    2e-04   Oryza brachyantha
gb|EEE62894.1|  hypothetical protein OsJ_17698                        50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054975.1|  Os05g0230600                                     50.4    2e-04   
ref|XP_002439481.1|  hypothetical protein SORBIDRAFT_09g007880        49.7    3e-04   Sorghum bicolor [broomcorn]
ref|XP_009822483.1|  hypothetical protein H257_01127                  49.3    4e-04   Aphanomyces astaci
ref|XP_008861519.1|  hypothetical protein H310_00483                  49.3    4e-04   Aphanomyces invadans
ref|XP_004960655.1|  PREDICTED: ER membrane protein complex subun...  48.9    5e-04   Setaria italica
ref|XP_003568721.1|  PREDICTED: ER membrane protein complex subun...  48.9    5e-04   Brachypodium distachyon [annual false brome]
gb|EMS55546.1|  hypothetical protein TRIUR3_31633                     48.9    5e-04   Triticum urartu
gb|EMT32849.1|  hypothetical protein F775_31297                       48.9    5e-04   



>ref|XP_010325953.1| PREDICTED: ER membrane protein complex subunit 1 [Solanum lycopersicum]
Length=982

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLL +++FSS+YT+F+LYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  1    MAIRAFLLCIILFSSSYTSFALYEDQVGLMDWHQQYIGKVKKAVF  45



>ref|XP_006366781.1| PREDICTED: ER membrane protein complex subunit 1-like [Solanum 
tuberosum]
Length=982

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLL +++FSS+YT+F+LYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  1    MAIRAFLLCIILFSSSYTSFALYEDQVGLMDWHQQYIGKVKKAVF  45



>emb|CDY67992.1| BnaCnng57230D [Brassica napus]
Length=446

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  2    AMALRLYLLLIVFVSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  47



>ref|XP_011094459.1| PREDICTED: ER membrane protein complex subunit 1 [Sesamum indicum]
Length=982

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLLL++ F+S+   +SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  3    MAIRAFLLLLMFFASSDPAYSLYEDQVGLMDWHQQYIGKVKHAVF  47



>ref|XP_010419729.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FL+LVL  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLVLVLFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVF  45



>ref|XP_009597396.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=982

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLL +++  S+YTTF+LYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  1    MAIRAFLLFLILLVSSYTTFALYEDQVGLMDWHQQYIGKVKKAVF  45



>ref|XP_010491889.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FLLL +  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLLLPVFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVF  45



>emb|CDX85707.1| BnaA02g01060D [Brassica napus]
Length=942

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AM I+A LLL++  S A  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  2    AMEIKASLLLLIFLSYAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  47



>ref|XP_002324236.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
 gb|EEF02801.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
Length=985

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+ L+ + I S    TFSLYEDQ GLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRSLLIFLCILSITVPTFSLYEDQAGLMDWHQKYIGKVKHAVF  47



>ref|XP_011026615.1| PREDICTED: ER membrane protein complex subunit 1 [Populus euphratica]
Length=985

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+ L+ + I S    TFSLYEDQ GLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRSLLIFLCILSITVPTFSLYEDQAGLMDWHQKYIGKVKHAVF  47



>ref|XP_008378089.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=985

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
             MA+R F+LL+L  S+A  + SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  2    GMAVRGFVLLLLFLSAANLSLSLYEDQVGLMDWHQQYIGKVKEAVF  47



>ref|XP_009346082.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=985

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
             MA+R F+LL+L  S+A  + SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  2    GMAVRGFVLLLLFLSAANLSLSLYEDQVGLMDWHQQYIGKVKEAVF  47



>ref|XP_009785843.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=981

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLL +++F S+ TTF+LYEDQVGLMDWHQ+YIGKVK  VF
Sbjct  1    MAIRAFLLFLILFVSS-TTFALYEDQVGLMDWHQQYIGKVKKTVF  44



>gb|KFK25418.1| hypothetical protein AALP_AA8G112000 [Arabis alpina]
Length=982

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FLLL+L  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLLLLLFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  45



>ref|XP_006399663.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
 gb|ESQ41116.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
Length=984

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR  LLL+L  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  2    AMAIRFTLLLLLFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  47



>ref|XP_009125814.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1-like [Brassica rapa]
Length=984

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAI+A LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  2    AMAIKASLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  47



>ref|XP_010100254.1| hypothetical protein L484_007251 [Morus notabilis]
 gb|EXB82261.1| hypothetical protein L484_007251 [Morus notabilis]
Length=973

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 3/48 (6%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA R FLLL ++FS  YT  +FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  2    AMASRVFLLLFIMFS-FYTELSFSLYEDQVGLMDWHQQYIGKVKQAVF  48



>ref|XP_009121935.1| PREDICTED: ER membrane protein complex subunit 1 [Brassica rapa]
Length=980

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  2    AMALRLYLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  47



>gb|KDO79764.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=859

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVF  46



>ref|XP_006450658.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 ref|XP_006476068.1| PREDICTED: ER membrane protein complex subunit 1-like [Citrus 
sinensis]
 gb|ESR63898.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 gb|KDO79763.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=981

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVF  46



>gb|KDO79766.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
 gb|KDO79767.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=795

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVF  46



>emb|CDX69747.1| BnaA10g20960D [Brassica napus]
Length=1546

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  568  AMALRLYLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVF  613



>gb|KDO79765.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=794

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVF  46



>emb|CDX91208.1| BnaC02g03890D [Brassica napus]
Length=997

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR  LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  1    MAIRVSLLLLVFLSSAVVSFSLYEDQVGLMDWHQRYIGKVKHAVF  45



>ref|XP_010453205.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FLLL+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLLLLLFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVF  45



>gb|EYU41569.1| hypothetical protein MIMGU_mgv1a000799mg [Erythranthe guttata]
Length=983

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            M IR FLLL+L F ++Y TFSL+EDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MGIRVFLLLLLFFCTSYPTFSLHEDQVGLMDWHQQYIGKVKHAVF  45



>gb|KDP34198.1| hypothetical protein JCGZ_07769 [Jatropha curcas]
Length=985

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            +AIR F++ + + S+  +T SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  3    VAIRVFIISLFLLSTITSTLSLYEDQVGLMDWHQQYIGKVKDAVF  47



>ref|XP_002516556.1| catalytic, putative [Ricinus communis]
 gb|EEF45897.1| catalytic, putative [Ricinus communis]
Length=983

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FL  +L+ S+A  TFSLYEDQVGLMDWHQRYIGKVK AVF
Sbjct  1    MAIRVFLFSLLLLSTAIPTFSLYEDQVGLMDWHQRYIGKVKDAVF  45



>ref|XP_002284012.1| PREDICTED: ER membrane protein complex subunit 1 [Vitis vinifera]
 emb|CBI20872.3| unnamed protein product [Vitis vinifera]
Length=987

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +2

Query  287  AMAIRAFLLLVLI-FSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA R FLLL+L+  SS   +FSLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMATRVFLLLLLVLISSPSPSFSLYEDQVGLMDWHQQYIGKVKHAVF  48



>ref|XP_002308610.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|EEE92133.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=985

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+ L+ + I S    TFSL+EDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRSLLIFLFILSLTVPTFSLHEDQVGLMDWHQKYIGKVKHAVF  47



>ref|XP_011019630.1| PREDICTED: ER membrane protein complex subunit 1-like [Populus 
euphratica]
Length=985

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+ L+ + I S    TFSL+EDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRSLLIFLFILSLTVPTFSLHEDQVGLMDWHQKYIGKVKHAVF  47



>ref|XP_009396281.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=997

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +2

Query  272  FKSPSAMAIRA---FLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
             +  +AMAIRA   F++L+ +F SA  + +LYEDQVGL DWH +YIGKVKHAVF
Sbjct  6    LRPRTAMAIRARLGFVILLSLFFSATLSTALYEDQVGLADWHHKYIGKVKHAVF  59



>ref|XP_008393881.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=988

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  284  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++MAIR FLLL+L  S+A+ + SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  4    ASMAIRGFLLLLLFLSAAHLSLSLYEDQVGLMDWHQQYIGKVKEAVF  50



>ref|XP_009367894.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=988

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  284  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++MAIR FLLL+L  S+A+ + SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  4    ASMAIRGFLLLLLFLSAAHLSLSLYEDQVGLMDWHQQYIGKVKEAVF  50



>ref|XP_010541259.1| PREDICTED: ER membrane protein complex subunit 1 [Tarenaya hassleriana]
Length=983

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR  L+L+L  SSA  + SLYEDQVGLMDWHQRYIGKVKHAVF
Sbjct  3    MAIRVSLVLLLFLSSAIVSLSLYEDQVGLMDWHQRYIGKVKHAVF  47



>ref|XP_009395509.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=983

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  290  MAIRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRA L  +++L+FSS  +T +L+EDQVGL DWHQ+YIGKVKHA+F
Sbjct  1    MAIRACLGLMILLVFSSTIST-ALFEDQVGLADWHQKYIGKVKHAIF  46



>ref|XP_002873520.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49779.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
Length=982

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FL L+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLTLLLFLSSAIVSFSLYEDQAGLTDWHQRYIGKVKHAVF  45



>ref|XP_007137196.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
 gb|ESW09190.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
Length=897

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR FLLL L  SS    +SL+EDQVGLMDWHQ+YIGKVKHA+F
Sbjct  2    AMAIRVFLLLFLFLSSTNIGYSLFEDQVGLMDWHQQYIGKVKHALF  47



>ref|NP_196717.3| PQQ_DH domain-containing protein [Arabidopsis thaliana]
 gb|AED91695.1| PQQ_DH domain-containing protein [Arabidopsis thaliana]
Length=982

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FL L+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVF
Sbjct  1    MAIRVFLTLLLFLSSAILSFSLYEDQAGLTDWHQRYIGKVKHAVF  45



>ref|XP_003522701.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AM IR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+F
Sbjct  2    AMTIRVFLILLLFLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALF  47



>gb|KHN10213.1| Hypothetical protein glysoja_017817 [Glycine soja]
Length=983

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AM IR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+F
Sbjct  2    AMTIRVFLILLLFLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALF  47



>emb|CDP15321.1| unnamed protein product [Coffea canephora]
Length=987

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            A+ IR  LL +   S ++ TFSLY+DQVGLMDWHQ+YIGKVKHAVF
Sbjct  4    AIRIRVLLLFLFFLSLSHLTFSLYQDQVGLMDWHQQYIGKVKHAVF  49



>ref|XP_003636448.1| hypothetical protein MTR_041s0018 [Medicago truncatula]
Length=982

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR FL  +L  S      SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRVFLSFLLFLSLTNLASSLYEDQVGLMDWHQQYIGKVKHAVF  47



>ref|XP_006287000.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
 gb|EOA19898.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
Length=981

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            M IR FL L+L  SSA  +FSLYEDQ G+ DWHQRYIGKVKHAVF
Sbjct  1    MGIRVFLPLLLFLSSAIVSFSLYEDQAGITDWHQRYIGKVKHAVF  45



>gb|KEH36041.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=983

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR FL  +L  S      SLYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAIRVFLSFLLFLSLTNLASSLYEDQVGLMDWHQQYIGKVKHAVF  47



>ref|XP_009623191.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=983

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLLL+++FSS+Y   +LYEDQVGLMDWHQ+YIGKVK+AVF
Sbjct  1    MAIRAFLLLLILFSSSYYAVALYEDQVGLMDWHQQYIGKVKNAVF  45



>ref|XP_009759124.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=983

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIRAFLLL+++FSS+Y   +LYEDQVGLMDWHQ+YIGKVK+AVF
Sbjct  1    MAIRAFLLLLILFSSSYYAVALYEDQVGLMDWHQQYIGKVKNAVF  45



>ref|XP_010254043.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Nelumbo 
nucifera]
Length=989

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R FLLL L+F  A  + +LYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAVRVFLLLTLLFLYANFSSALYEDQVGLMDWHQQYIGKVKHAVF  47



>ref|XP_010254044.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Nelumbo 
nucifera]
Length=985

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R FLLL L+F  A  + +LYEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  2    AMAVRVFLLLTLLFLYANFSSALYEDQVGLMDWHQQYIGKVKHAVF  47



>ref|XP_008802826.1| PREDICTED: ER membrane protein complex subunit 1 [Phoenix dactylifera]
Length=985

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 4/48 (8%)
 Frame = +2

Query  287  AMAIRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMA+R  L  L+VL++S+  T  +LYEDQVGL DWHQ+YIGKVK AVF
Sbjct  2    AMAVRVCLGFLIVLLYSNFST--ALYEDQVGLADWHQKYIGKVKQAVF  47



>ref|XP_003526482.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+F
Sbjct  2    AMAIRVFLILLLSLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALF  47



>gb|KHN18187.1| Hypothetical protein glysoja_025077 [Glycine soja]
Length=983

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+F
Sbjct  2    AMAIRVFLILLLSLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALF  47



>ref|XP_010925904.1| PREDICTED: ER membrane protein complex subunit 1 [Elaeis guineensis]
Length=983

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  290  MAIRAFL-LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MA+R  L  L+L+  S ++T +LYEDQVGL DWHQ+YIGKVK AVF
Sbjct  1    MAVRVCLGFLILLLHSNFST-ALYEDQVGLADWHQKYIGKVKQAVF  45



>ref|XP_004291191.2| PREDICTED: ER membrane protein complex subunit 1 [Fragaria vesca 
subsp. vesca]
Length=988

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            +MAIRA LLL+L  S    T SLYEDQVGL+DWHQ+YIGKVK AVF
Sbjct  5    SMAIRASLLLLLFLSLTTLTVSLYEDQVGLVDWHQQYIGKVKDAVF  50



>ref|XP_004501175.1| PREDICTED: ER membrane protein complex subunit 1-like [Cicer 
arietinum]
Length=981

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            MAIR FL L+L  S +    S+YEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  1    MAIRVFLTLLLFLSLSNIVSSIYEDQVGLMDWHQQYIGKVKHAVF  45



>gb|KJB65683.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=964

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  21   FSLYEDQVGLMDWHQQYIGKVKQAVF  46



>gb|KJB65685.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=1003

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  21   FSLYEDQVGLMDWHQQYIGKVKQAVF  46



>gb|KJB65682.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=984

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  21   FSLYEDQVGLMDWHQQYIGKVKQAVF  46



>gb|KHG26099.1| Uncharacterized protein F383_09262 [Gossypium arboreum]
Length=984

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  21   FSLYEDQVGLMDWHQQYIGKVKQAVF  46



>gb|KJB65684.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=821

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  21   FSLYEDQVGLMDWHQQYIGKVKQAVF  46



>ref|XP_006833394.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
 gb|ERM98672.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
Length=976

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  338  YTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            Y + +LYEDQVG+MDWHQ+YIGKV HAVF
Sbjct  19   YPSCALYEDQVGIMDWHQQYIGKVNHAVF  47



>ref|XP_001765108.1| predicted protein [Physcomitrella patens]
 gb|EDQ70103.1| predicted protein [Physcomitrella patens]
Length=998

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +2

Query  296  IRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            +RA L  L V++   + T  +LYEDQVG+ DWHQ+YIG+VKHAVF
Sbjct  6    LRASLCQLFVVVACLSSTCLALYEDQVGVRDWHQQYIGRVKHAVF  50



>gb|KJB27314.1| hypothetical protein B456_004G290400 [Gossypium raimondii]
Length=982

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
             SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  20   LSLYEDQVGLMDWHQQYIGKVKQAVF  45



>gb|KHG18967.1| Uncharacterized protein F383_07420 [Gossypium arboreum]
Length=982

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
             SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  20   LSLYEDQVGLMDWHQQYIGKVKQAVF  45



>ref|XP_010049094.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81549.1| hypothetical protein EUGRSUZ_C02905 [Eucalyptus grandis]
Length=984

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  356  YEDQVGLMDWHQRYIGKVKHAVF  424
            YEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  25   YEDQVGLMDWHQKYIGKVKHAVF  47



>ref|XP_010049093.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Eucalyptus 
grandis]
Length=986

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  356  YEDQVGLMDWHQRYIGKVKHAVF  424
            YEDQVGLMDWHQ+YIGKVKHAVF
Sbjct  25   YEDQVGLMDWHQKYIGKVKHAVF  47



>ref|XP_008648064.1| PREDICTED: uncharacterized protein LOC100381974 isoform X1 [Zea 
mays]
 gb|AFW77478.1| hypothetical protein ZEAMMB73_969683 [Zea mays]
Length=988

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  278  SPSAMAIRAFLLLVLIFSSAYT-TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            +P   ++   L  +L+F S  T   ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  3    APPRRSLLVLLAGILVFGSLTTLATAIYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_007012092.1| Catalytics isoform 1 [Theobroma cacao]
 gb|EOY29711.1| Catalytics isoform 1 [Theobroma cacao]
Length=988

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTT-FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+FL L+L+F S+     SLYEDQVGLMDWHQ++IGKVK AVF
Sbjct  4    AMAIRSFLFLLLLFFSSLNPILSLYEDQVGLMDWHQQFIGKVKQAVF  50



>ref|XP_007012093.1| Catalytics isoform 2 [Theobroma cacao]
 gb|EOY29712.1| Catalytics isoform 2 [Theobroma cacao]
Length=870

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTT-FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR+FL L+L+F S+     SLYEDQVGLMDWHQ++IGKVK AVF
Sbjct  4    AMAIRSFLFLLLLFFSSLNPILSLYEDQVGLMDWHQQFIGKVKQAVF  50



>ref|XP_010668174.1| PREDICTED: ER membrane protein complex subunit 1 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            AMAIR  LL +L  SS++  FSLYEDQVGLMDWHQ+Y+GKVK A+F
Sbjct  2    AMAIRVSLLFLLFLSSSFLVFSLYEDQVGLMDWHQQYLGKVKQAIF  47



>ref|XP_004164260.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
Length=985

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDW Q+Y+GK KHA+F
Sbjct  24   FSLYEDQVGLMDWRQQYLGKAKHALF  49



>ref|XP_004150284.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
 gb|KGN62826.1| Catalytic [Cucumis sativus]
Length=985

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDW Q+Y+GK KHA+F
Sbjct  24   FSLYEDQVGLMDWRQQYLGKAKHALF  49



>ref|XP_008445027.1| PREDICTED: ER membrane protein complex subunit 1 [Cucumis melo]
Length=985

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
            FSLYEDQVGLMDW Q+Y+GK KHA+F
Sbjct  24   FSLYEDQVGLMDWRQQYLGKAKHALF  49



>gb|KHG08509.1| Uncharacterized protein F383_13837 [Gossypium arboreum]
Length=980

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
             SLYEDQVGL+DWHQ+Y+GKVK AVF
Sbjct  22   LSLYEDQVGLVDWHQQYLGKVKQAVF  47



>gb|KJB82870.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82871.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82872.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82873.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
Length=985

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  347  FSLYEDQVGLMDWHQRYIGKVKHAVF  424
             SLYEDQVGL+DWHQ+Y+GKVK AVF
Sbjct  22   LSLYEDQVGLVDWHQQYLGKVKQAVF  47



>ref|XP_008220058.1| PREDICTED: ER membrane protein complex subunit 1 [Prunus mume]
Length=988

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  284  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++MA R FLLL++  SS   + SLYEDQVGLMDWHQ+YIGKVK AVF
Sbjct  4    TSMASRVFLLLLIFLSSTNLSLSLYEDQVGLMDWHQQYIGKVKGAVF  50



>gb|AFW82067.1| hypothetical protein ZEAMMB73_676127 [Zea mays]
Length=881

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  344  TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            T ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  26   TTAIYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_008656322.1| PREDICTED: ER membrane protein complex subunit 1-like [Zea mays]
Length=989

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  344  TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            T ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  26   TTAIYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_007227052.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
 gb|EMJ28251.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
Length=983

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  356  YEDQVGLMDWHQRYIGKVKHAVF  424
            YEDQVGLMDWHQ+YIGKVK AVF
Sbjct  23   YEDQVGLMDWHQQYIGKVKGAVF  45



>ref|XP_006654166.1| PREDICTED: ER membrane protein complex subunit 1-like [Oryza 
brachyantha]
Length=985

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  350  SLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++YEDQVGL DWHQRYIGKVK AV+
Sbjct  25   AVYEDQVGLADWHQRYIGKVKQAVY  49



>gb|EEE62894.1| hypothetical protein OsJ_17698 [Oryza sativa Japonica Group]
Length=950

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  344  TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            T ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  26   TAAVYEDQVGLADWHQKYIGKVKQAVY  52



>ref|NP_001054975.1| Os05g0230600 [Oryza sativa Japonica Group]
 gb|AAS98480.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT93850.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16889.1| Os05g0230600 [Oryza sativa Japonica Group]
 dbj|BAG91928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  344  TFSLYEDQVGLMDWHQRYIGKVKHAVF  424
            T ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  26   TAAVYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_002439481.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
 gb|EES17911.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
Length=989

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  350  SLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  28   AIYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_009822483.1| hypothetical protein H257_01127 [Aphanomyces astaci]
 gb|ETV87620.1| hypothetical protein H257_01127 [Aphanomyces astaci]
Length=968

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
             I A +L++L+ +S     +LYEDQ+GL DWH+  +G+V HAVF
Sbjct  6    GIVALMLVMLLHASVCVHSALYEDQIGLFDWHREGLGEVTHAVF  49



>ref|XP_008861519.1| hypothetical protein H310_00483 [Aphanomyces invadans]
 gb|ETW10108.1| hypothetical protein H310_00483 [Aphanomyces invadans]
Length=973

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVF  424
             I A +LLVL+ +S     +LYEDQ+GL DWH+  +G++ HAVF
Sbjct  6    GIVAAMLLVLLNASVRVLSALYEDQIGLFDWHREGLGELTHAVF  49



>ref|XP_004960655.1| PREDICTED: ER membrane protein complex subunit 1-like [Setaria 
italica]
Length=988

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +2

Query  350  SLYEDQVGLMDWHQRYIGKVKHAVF  424
            ++YEDQVGL DWHQ+YIGKVK AV+
Sbjct  28   AIYEDQVGLADWHQKYIGKVKQAVY  52



>ref|XP_003568721.1| PREDICTED: ER membrane protein complex subunit 1 [Brachypodium 
distachyon]
Length=989

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  356  YEDQVGLMDWHQRYIGKVKHAVF  424
            YEDQVGL DWHQ+YIGKVK AV+
Sbjct  29   YEDQVGLADWHQKYIGKVKQAVY  51



>gb|EMS55546.1| hypothetical protein TRIUR3_31633 [Triticum urartu]
Length=885

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +2

Query  353  LYEDQVGLMDWHQRYIGKVKHAVF  424
            +YEDQVGL DWHQ+YIGKVK AV+
Sbjct  28   VYEDQVGLADWHQKYIGKVKQAVY  51



>gb|EMT32849.1| hypothetical protein F775_31297 [Aegilops tauschii]
Length=1139

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +2

Query  353  LYEDQVGLMDWHQRYIGKVKHAVF  424
            +YEDQVGL DWHQ+YIGKVK AV+
Sbjct  28   VYEDQVGLADWHQKYIGKVKQAVY  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350