BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004H04

Length=331
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                89.0    2e-18   Ipomoea batatas [batate]
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase             79.7    6e-15   Nicotiana tabacum [American tobacco]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.3    7e-15   Nicotiana sylvestris
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    2e-14   Nicotiana tomentosiformis
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.8    3e-14   Solanum tuberosum [potatoes]
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase         77.4    3e-14   
ref|NP_001275483.1|  HQT                                              77.4    3e-14   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein             77.4    3e-14   Solanum tuberosum [potatoes]
emb|CDP02827.1|  unnamed protein product                              77.8    4e-14   Coffea canephora [robusta coffee]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  75.9    1e-13   Platycodon grandiflorus [balloon-flower]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.1    2e-13   Nicotiana tomentosiformis
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.1    2e-13   Nicotiana sylvestris
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  73.6    8e-13   Cynara cardunculus var. altilis [cultivated cardoon]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  73.6    8e-13   Cynara cardunculus var. scolymus [artichoke]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...  73.6    9e-13   Cynara cardunculus var. scolymus [artichoke]
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4       72.0    2e-12   Coffea arabica [arabica coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  72.0    2e-12   Coffea canephora [robusta coffee]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  72.0    2e-12   Coffea canephora [robusta coffee]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  72.0    3e-12   Coffea arabica [arabica coffee]
gb|AEK80405.1|  HQT                                                   68.6    4e-11   Lonicera japonica [Japanese honeysuckle]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  67.8    9e-11   Lonicera japonica [Japanese honeysuckle]
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1            67.4    1e-10   Cynara cardunculus var. scolymus [artichoke]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                    67.0    2e-10   Cynara cardunculus var. scolymus [artichoke]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase       63.9    2e-09   Fagopyrum tataricum [Kangra buckwheat]
gb|AFR40289.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.8    2e-09   Populus fremontii
gb|AFR40306.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    2e-09   Populus nigra [black poplar]
gb|AFR40293.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.5    2e-09   Populus fremontii
gb|ABR17170.1|  unknown                                               63.5    3e-09   Picea sitchensis
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...  63.5    3e-09   Pinus pinaster [cluster pine]
gb|AFR40292.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus fremontii
gb|AFR40286.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.5    3e-09   Populus fremontii
gb|AFR40294.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus fremontii
gb|AFR40273.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  59.7    3e-09   Populus trichocarpa [western balsam poplar]
gb|AFR40280.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.5    3e-09   Populus alba [abele]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...  63.2    3e-09   Larix kaempferi [karamatsu]
gb|AFR40282.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus alba [abele]
gb|AFR40291.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus fremontii
gb|AFR40266.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus trichocarpa [western balsam poplar]
gb|AFR40272.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus trichocarpa [western balsam poplar]
gb|AFR40277.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    3e-09   Populus trichocarpa [western balsam poplar]
gb|ABR14148.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  59.7    3e-09   Coffea arabica [arabica coffee]
gb|AFR40271.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  60.1    4e-09   Populus trichocarpa [western balsam poplar]
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...  63.2    4e-09   Pinus radiata
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.8    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.4    6e-09   Populus euphratica
gb|AFR40305.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  58.9    7e-09   Populus nigra [black poplar]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.0    8e-09   Malus domestica [apple tree]
emb|CAT00088.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  60.1    9e-09   Coffea arabica [arabica coffee]
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.0    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.0    1e-08   Nicotiana tomentosiformis
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  61.6    1e-08   Coffea canephora [robusta coffee]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  61.6    1e-08   Coffea canephora [robusta coffee]
emb|CBI25231.3|  unnamed protein product                              61.6    1e-08   Vitis vinifera
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  61.6    1e-08   Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora    61.6    1e-08   Coffea canephora [robusta coffee]
emb|CDO98242.1|  unnamed protein product                              61.6    1e-08   Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  61.6    1e-08   Coffea canephora [robusta coffee]
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.6    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  61.2    1e-08   Ipomoea batatas [batate]
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.2    2e-08   Nicotiana sylvestris
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...  61.2    2e-08   Populus trichocarpa [western balsam poplar]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                         61.2    2e-08   Coffea arabica [arabica coffee]
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           61.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.8    2e-08   Vitis vinifera
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  60.8    2e-08   Theobroma cacao [chocolate]
emb|CAN82918.1|  hypothetical protein VITISV_023290                   60.8    2e-08   Vitis vinifera
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.8    2e-08   Populus euphratica
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  60.5    2e-08   Erythroxylum coca [coca]
gb|AFR40295.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  57.8    3e-08   Populus fremontii
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like     60.5    3e-08   Prunus mume [ume]
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  60.5    3e-08   Platycodon grandiflorus [balloon-flower]
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  60.5    3e-08   Coffea arabica [arabica coffee]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...  60.5    3e-08   Populus tomentosa [Chinese white poplar]
ref|XP_006368492.1|  transferase family protein                       60.5    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.5    3e-08   Elaeis guineensis
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.5    3e-08   Nicotiana tomentosiformis
emb|CDY05770.1|  BnaC07g00330D                                        60.1    3e-08   
emb|CDY31956.1|  BnaA07g00390D                                        60.1    3e-08   Brassica napus [oilseed rape]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.1    3e-08   Brassica rapa
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.1    4e-08   Nicotiana tomentosiformis
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.1    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     60.1    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.1    4e-08   Nicotiana sylvestris
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg           60.1    4e-08   Eutrema salsugineum [saltwater cress]
gb|KDP41953.1|  hypothetical protein JCGZ_26971                       59.7    6e-08   Jatropha curcas
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  59.3    8e-08   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006826659.1|  hypothetical protein AMTR_s00137p00027820        56.6    8e-08   
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  58.9    9e-08   Hibiscus cannabinus [bimli-jute]
gb|KJB56501.1|  hypothetical protein B456_009G122600                  58.9    1e-07   Gossypium raimondii
gb|KJB56505.1|  hypothetical protein B456_009G122600                  58.9    1e-07   Gossypium raimondii
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           58.9    1e-07   Cucumis sativus [cucumbers]
ref|XP_002894568.1|  transferase family protein                       58.5    1e-07   Arabidopsis lyrata subsp. lyrata
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...  58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    1e-07   
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  58.5    1e-07   
gb|AAM61215.1|  anthranilate N-benzoyltransferase                     58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.5    1e-07   
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  58.5    1e-07   
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  58.2    2e-07   Lonicera japonica [Japanese honeysuckle]
ref|XP_007099552.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  56.6    2e-07   
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                 58.2    2e-07   Capsicum annuum
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             58.2    2e-07   Selaginella moellendorffii
gb|KDO55352.1|  hypothetical protein CISIN_1g014116mg                 55.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.2    2e-07   Citrus sinensis [apfelsine]
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase         58.2    2e-07   Medicago truncatula
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  57.4    2e-07   
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.8    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  57.8    3e-07   Gossypium hirsutum [American cotton]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  57.8    3e-07   Cynara cardunculus [cardoon]
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              57.4    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.4    3e-07   Solanum tuberosum [potatoes]
ref|XP_006427659.1|  hypothetical protein CICLE_v10026558mg           55.1    3e-07   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.4    3e-07   Glycine max [soybeans]
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            57.4    3e-07   Selaginella moellendorffii
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  57.4    3e-07   Glycine soja [wild soybean]
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.4    4e-07   Camelina sativa [gold-of-pleasure]
gb|EPS58233.1|  hypothetical protein M569_16582                       54.7    4e-07   Genlisea aurea
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    4e-07   Setaria italica
ref|NP_001145871.1|  uncharacterized protein LOC100279386             57.0    4e-07   
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  57.0    4e-07   
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2           57.0    4e-07   Zea mays [maize]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    4e-07   Populus euphratica
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    5e-07   Populus euphratica
gb|KDP38692.1|  hypothetical protein JCGZ_04045                       57.0    5e-07   Jatropha curcas
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640        57.0    5e-07   Sorghum bicolor [broomcorn]
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  57.0    5e-07   
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  57.0    5e-07   Morus notabilis
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    5e-07   Solanum lycopersicum
ref|XP_007149785.1|  hypothetical protein PHAVU_005G0986000g          53.1    6e-07   Phaseolus vulgaris [French bean]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...  56.6    6e-07   Panicum virgatum
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg           56.6    6e-07   Capsella rubella
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  56.2    7e-07   
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg           56.2    8e-07   Capsella rubella
emb|CDY22880.1|  BnaA01g18180D                                        56.2    8e-07   Brassica napus [oilseed rape]
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    8e-07   Brassica rapa
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase         56.2    8e-07   Medicago truncatula
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           56.2    9e-07   Prunus persica
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  56.2    9e-07   Leucaena leucocephala [cassie]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  56.2    9e-07   
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           55.8    1e-06   Capsella rubella
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  55.8    1e-06   
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g           55.8    1e-06   
gb|AFS68800.1|  hydroxycinnamoyl transferase                          55.8    1e-06   Lonicera japonica [Japanese honeysuckle]
gb|KJB71590.1|  hypothetical protein B456_011G1315001                 55.5    1e-06   Gossypium raimondii
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  55.5    1e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    1e-06   
dbj|BAF49305.1|  putative acyltransferase                             55.5    1e-06   Clitoria ternatea
ref|XP_007149778.1|  hypothetical protein PHAVU_005G098400g           53.1    1e-06   Phaseolus vulgaris [French bean]
gb|ADG46003.1|  hydroxycinnamoyl transferase                          55.5    1e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  55.5    1e-06   Ricinus communis
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...  55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    2e-06   Oryza brachyantha
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    2e-06   Phoenix dactylifera
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    2e-06   Sesamum indicum [beniseed]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    2e-06   Camelina sativa [gold-of-pleasure]
gb|KJB71596.1|  hypothetical protein B456_011G132100                  55.1    2e-06   Gossypium raimondii
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  55.1    2e-06   
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.3    3e-06   
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    3e-06   Brachypodium distachyon [annual false brome]
emb|CBI83579.1|  hydroxycinnamoyl transferase                         54.7    3e-06   Plectranthus scutellarioides
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  54.7    3e-06   
ref|XP_010481008.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    3e-06   
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g           54.7    3e-06   Populus trichocarpa [western balsam poplar]
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  54.7    3e-06   Glechoma hederacea [gill-over-the-ground]
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g           54.7    3e-06   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  54.3    3e-06   Glechoma hederacea [gill-over-the-ground]
ref|XP_002866234.1|  transferase family protein                       54.3    4e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.3    4e-06   Camelina sativa [gold-of-pleasure]
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  54.3    4e-06   Gossypium arboreum [tree cotton]
emb|CDX88644.1|  BnaA03g10050D                                        53.9    5e-06   
gb|KJB68220.1|  hypothetical protein B456_010G233100                  52.0    5e-06   Gossypium raimondii
gb|EAY94737.1|  hypothetical protein OsI_16513                        51.6    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg           53.9    6e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006648830.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.4    6e-06   
ref|XP_001756433.1|  predicted protein                                53.5    6e-06   
emb|CDY11845.1|  BnaC03g12710D                                        54.3    6e-06   Brassica napus [oilseed rape]
gb|KJB71577.1|  hypothetical protein B456_011G130700                  53.5    6e-06   Gossypium raimondii
ref|XP_007149776.1|  hypothetical protein PHAVU_005G098200g           50.4    6e-06   Phaseolus vulgaris [French bean]
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  53.5    6e-06   Morus notabilis
dbj|BAJ91003.1|  predicted protein                                    51.2    6e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             52.8    6e-06   Erythranthe guttata [common monkey flower]
gb|KJB71578.1|  hypothetical protein B456_011G130700                  53.1    7e-06   Gossypium raimondii
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  53.5    7e-06   
emb|CDY44162.1|  BnaC01g22120D                                        53.1    8e-06   Brassica napus [oilseed rape]
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    8e-06   Eucalyptus grandis [rose gum]
gb|KJB71580.1|  hypothetical protein B456_011G130700                  52.8    8e-06   Gossypium raimondii
gb|KJB71581.1|  hypothetical protein B456_011G130700                  52.8    8e-06   Gossypium raimondii
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g           53.1    8e-06   Phaseolus vulgaris [French bean]
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    8e-06   Populus euphratica
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    9e-06   
ref|NP_001053225.1|  Os04g0500700                                     52.8    1e-05   
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                  52.8    1e-05   Arabis alpina [alpine rockcress]
emb|CAE01635.3|  OSJNBa0029H02.19                                     52.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.4    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g           52.4    2e-05   Phaseolus vulgaris [French bean]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase               52.4    2e-05   Phaseolus vulgaris [French bean]
gb|EPS58183.1|  hypothetical protein M569_16633                       50.1    2e-05   Genlisea aurea
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                  52.0    2e-05   Arabis alpina [alpine rockcress]
dbj|BAJ95750.1|  predicted protein                                    52.0    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    2e-05   Camelina sativa [gold-of-pleasure]
dbj|BAJ93247.1|  predicted protein                                    52.0    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    2e-05   Prunus mume [ume]
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg              52.0    2e-05   Erythranthe guttata [common monkey flower]
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  51.6    3e-05   Gossypium arboreum [tree cotton]
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg           52.0    3e-05   
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    3e-05   
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.6    3e-05   Sesamum indicum [beniseed]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                   51.6    3e-05   Eucalyptus grandis [rose gum]
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.6    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.6    3e-05   
ref|XP_007149789.1|  hypothetical protein PHAVU_005G0988000g          49.7    3e-05   Phaseolus vulgaris [French bean]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           51.6    3e-05   Cynara cardunculus var. scolymus [artichoke]
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.6    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    4e-05   Nelumbo nucifera [Indian lotus]
ref|NP_001047408.1|  Os02g0611800                                     51.2    4e-05   
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            51.2    4e-05   Cynara cardunculus var. scolymus [artichoke]
gb|EAZ23787.1|  hypothetical protein OsJ_07497                        51.2    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    4e-05   Vitis vinifera
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    51.2    4e-05   Cynara cardunculus var. scolymus [artichoke]
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    4e-05   Camelina sativa [gold-of-pleasure]
gb|KJB54981.1|  hypothetical protein B456_009G057200                  50.8    5e-05   Gossypium raimondii
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.8    5e-05   
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.8    5e-05   Brassica rapa
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2    50.8    5e-05   Avena sativa [cultivated oat]
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg              50.4    6e-05   Erythranthe guttata [common monkey flower]
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.4    6e-05   
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.4    7e-05   Eucalyptus grandis [rose gum]
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.4    7e-05   Glycine max [soybeans]
gb|EPS67512.1|  hypothetical protein M569_07262                       50.4    8e-05   Genlisea aurea
ref|XP_007216080.1|  hypothetical protein PRUPE_ppa018070mg           47.8    8e-05   
gb|AGH61997.1|  rosmarinic acid synthase                              50.4    8e-05   Perilla frutescens [beefsteak-mint]
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.1    9e-05   Phoenix dactylifera
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  50.1    1e-04   
gb|KJB68229.1|  hypothetical protein B456_010G233600                  50.1    1e-04   Gossypium raimondii
gb|KJB68227.1|  hypothetical protein B456_010G233600                  49.7    1e-04   Gossypium raimondii
ref|XP_006427033.1|  hypothetical protein CICLE_v10026791mg           47.4    1e-04   
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    1e-04   Populus euphratica
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    1e-04   Prunus mume [ume]
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    1e-04   Fragaria vesca subsp. vesca
gb|EMS50893.1|  Anthranilate N-benzoyltransferase protein 1           47.4    1e-04   Triticum urartu
gb|AFW72297.1|  hypothetical protein ZEAMMB73_779483                  47.8    1e-04   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           49.7    1e-04   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3    49.7    1e-04   Avena sativa [cultivated oat]
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1    49.7    1e-04   Avena sativa [cultivated oat]
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Prunus mume [ume]
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  49.3    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           49.3    2e-04   Prunus persica
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Eucalyptus grandis [rose gum]
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Prunus mume [ume]
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Glycine max [soybeans]
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  49.7    2e-04   
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  49.3    2e-04   Gossypium arboreum [tree cotton]
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Setaria italica
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Glycine max [soybeans]
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    2e-04   Setaria italica
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase         48.9    2e-04   Medicago truncatula
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.9    2e-04   
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.9    2e-04   Elaeis guineensis
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg              48.9    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760        48.9    2e-04   Amborella trichopoda
gb|EMT09895.1|  Anthranilate N-benzoyltransferase protein 1           48.9    2e-04   
gb|EMT01178.1|  hypothetical protein F775_42912                       45.8    3e-04   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  48.5    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.5    3e-04   Pyrus x bretschneideri [bai li]
gb|KJB54946.1|  hypothetical protein B456_009G055900                  48.5    3e-04   Gossypium raimondii
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.5    3e-04   
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg           48.5    3e-04   Prunus persica
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.5    3e-04   
ref|XP_004973560.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.5    3e-04   Setaria italica
gb|ABI48360.1|  putative alcohol acyltransferase 1                    48.5    3e-04   Lavandula angustifolia [lavender]
dbj|BAF49306.1|  putative acyltransferase                             48.5    3e-04   Clitoria ternatea
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.5    4e-04   Tarenaya hassleriana [spider flower]
gb|AEA36976.1|  rosmarinic acid synthase                              48.1    4e-04   
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1           48.1    4e-04   
emb|CDX88645.1|  BnaA03g10040D                                        48.1    4e-04   
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.1    5e-04   
dbj|BAK06288.1|  predicted protein                                    47.8    5e-04   
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg           47.8    5e-04   
dbj|BAJ91746.1|  predicted protein                                    47.8    6e-04   
gb|KJB54948.1|  hypothetical protein B456_009G055900                  47.8    6e-04   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg           47.4    7e-04   
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg          47.4    8e-04   
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              47.0    0.001   
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               47.0    0.001   



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            MASEK +I IKE+TMVKPAKPTP+K+LW SN+DL+VGRIHLL VYFYRP
Sbjct  1    MASEKFKISIKESTMVKPAKPTPAKRLWNSNLDLIVGRIHLLTVYFYRP  49



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK+ +I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKP  50



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKIMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKP  50



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKVMKINIKESTLVKPSKPTPTKRLWNSNLDLIVGRIHLLTVYFYKP  50



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKP  50



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKP  50



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKP  50



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+P
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKP  50



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  180  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ SEK++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+P
Sbjct  49   SVGSEKMKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKP  98



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            M SEK ++I +KE+TMV PAK TPS+KLW SN+DLVVGRIH+L VYFYRP
Sbjct  1    MGSEKKMKIKVKESTMVCPAKATPSEKLWNSNLDLVVGRIHILTVYFYRP  50



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +RI IKE+ MVKP+KPTPSK+LW SN+D++VGRIHLL VYFY+P
Sbjct  1    MRINIKESIMVKPSKPTPSKRLWNSNLDVIVGRIHLLTVYFYKP  44



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I IKE+ MVKP+KPTPSK+LW SN+DL+VGRIHLL VYFY+P
Sbjct  1    MKIDIKESIMVKPSKPTPSKRLWNSNLDLIVGRIHLLTVYFYKP  44



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRP
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRP  44



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRP
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRP  44



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRP
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRP  44



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+P
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKP  44



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+P
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKP  44



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+P
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKP  44



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L +YFY+P
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTIYFYKP  44



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +3

Query  183  MASEK----LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            M SE     + I +K+++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR
Sbjct  1    MGSEGSVKTMNITVKDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYR  52



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +3

Query  183  MASEK----LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            M SE     + I +++++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR
Sbjct  1    MGSEGSVKTMNITVRDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYR  52



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRP
Sbjct  18   MNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRP  61



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRP
Sbjct  1    MNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRP  44



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  192  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +K+ I ++ +TMVKPAK TP + LW SNVDLVV RIH   VYFYRP
Sbjct  3    KKMIINVRNSTMVKPAKETPQRSLWNSNVDLVVPRIHTPSVYFYRP  48



>gb|AFR40289.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40290.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40299.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40300.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40301.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40302.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40303.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40304.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40307.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40308.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40309.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40310.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40311.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40312.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40313.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=111

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40306.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=94

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40293.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40297.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRP  44



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRP  44



>gb|AFR40292.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=102

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40286.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40287.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40288.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40296.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40298.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40294.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=104

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40273.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=74

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40280.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40285.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRP  44



>gb|AFR40282.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40284.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40291.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40266.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40267.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40268.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40269.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40270.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40274.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40275.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40276.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40278.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40279.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40281.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40283.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40272.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=109

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40277.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=110

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|ABR14148.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=84

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIKVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|AFR40271.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=106

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP
Sbjct  3    ITVKNSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRP  44



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP
Sbjct  3    ISVKESTMVRPAQETPQRSLWNSNVDLVVPRMHTPSVYFYRP  44



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP ++LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRRLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFR40305.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=88

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW  NVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPQRGLWNXNVDLVVPRFHTPSVYFYRP  44



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP
Sbjct  3    VNVIMRESTMVKPAEETPKKTLWNSNVDLVIPSIHTASVYFYRP  46



>emb|CAT00088.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=232

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP
Sbjct  3    VNVTVRESTMVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRP  46



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVKPAAETPQQRLWNSNVDLVVPNFHTPSVYFYRP  44



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  186  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  49



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  186  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  49



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRP  44



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  44



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  3    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  46



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_009399564.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=444

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I ++ +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP
Sbjct  2    VEINVRRSTMVRPAEPTPRRQLWNSNLDLVVPRFHTPSVYFYRP  45



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP  +LW SNVDLVV   H   VYFYRP
Sbjct  1    MKISVKESTMVRPAEETPRIRLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVKPATETPQQRLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  171  FNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ ++   K+ I IK++TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  13   YHCDLEGRKMIINIKQSTMVRPAEETPRRPLWNSNVDLVVPNFHTPSVYFYRP  65



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRP  44



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  5    VKESTMVRPAEETPRQSLWNSNVDLVVPRFHTPSVYFYRP  44



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRP  44



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            IKE+T+V+PA+ TP+ +L  SN+DL+V RIHLL VYFY+P
Sbjct  3    IKESTIVRPARETPTTRLQSSNLDLLVARIHLLTVYFYKP  42



>gb|AFR40295.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA   P + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAXXXPQRGLWNSNVDLVVPRFHTPSVYFYRP  44



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + ++ETT+VKPA  TP K LW SNVDLV+  IH   VYFYRP
Sbjct  3    VNVSVRETTLVKPAAETPRKALWNSNVDLVIPSIHTPSVYFYRP  46



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++E+TMVKPA+ TP K LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRESTMVKPAEETPIKTLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMV+PA  TP + LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVRPAHETPRRNLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRP  44



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  213  KETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP
Sbjct  6    RRSTMVRPAEPTPRRRLWNSNLDLVVPRFHTPSVYFYRP  44



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRP  44



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLVIPRFHTPSVYFYRP  44



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRP  44



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRP  44



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP
Sbjct  8    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRP  51



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +++TTMV+PA+ TP ++LW SN+DLVV R H   VYFYRP
Sbjct  4    INLRQTTMVRPAEQTPRRRLWNSNLDLVVPRFHTPSVYFYRP  45



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + ++E+T+VKPA+ TP K LW SNVDLV+  IH   VYFYRP
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRP  46



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+TMVKPA  TP   LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKESTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TPS  LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLIIPRFHTPSVYFYRP  44



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+T+VKPA+ TP + LW +NVDLVV R H   VYFYRP
Sbjct  3    ITVKESTLVKPAEETPRRGLWNANVDLVVPRFHTPSVYFYRP  44



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++E+TMV+PAK TP   LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRESTMVRPAKETPRINLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_006826659.1| hypothetical protein AMTR_s00137p00027820 [Amborella trichopoda]
 gb|ERM93896.1| hypothetical protein AMTR_s00137p00027820 [Amborella trichopoda]
Length=143

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K +TMV+PA+ TP   LW SNVDLVV R+H   VYFYRP
Sbjct  3    ITVKGSTMVRPAQQTPRIALWNSNVDLVVPRMHTPSVYFYRP  44



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVQPAGETPRRSLWNANVDLVVPRFHTPSVYFYRP  44



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP
Sbjct  5    VKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRP  44



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP
Sbjct  5    VKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRP  44



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K++TMV PA+ TP K LW SNVDLVV  +H   VYFYRP
Sbjct  3    ITVKDSTMVTPAEETPHKSLWNSNVDLVVPSMHTPSVYFYRP  44



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLVIPRFHTPSVYFYRP  44



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRP  44



>ref|XP_008461189.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
melo]
Length=150

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP
Sbjct  3    ITVKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRP  44



>ref|XP_007027324.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07826.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + +KE+TMV PA+ TP+++LW SN+DLVV R H+  VYFY+P
Sbjct  1    MEVTMKESTMVCPAEETPNQRLWVSNLDLVVTRYHICTVYFYKP  44



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRP  44



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I IK++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP
Sbjct  3    ITIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRP  44



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I IK++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP
Sbjct  3    ITIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRP  44



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +RI +KE+TMV+PA+  P + LW SNVDLVV   H   VYFY P
Sbjct  1    MRISVKESTMVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNP  44



>ref|XP_007099552.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20480.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=224

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+P
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKP  44



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++E+TMV+PA  TP  +LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRESTMVQPATETPQIRLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +   TMV+PA+ TP + LW SNVDLV+ RIH   VYFYRP
Sbjct  1    MEINVVRETMVRPAEATPQRVLWNSNVDLVIPRIHTASVYFYRP  44



>gb|KDO55352.1| hypothetical protein CISIN_1g014116mg [Citrus sinensis]
Length=149

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRP  44



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP
Sbjct  3    INLKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRP  44



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+T+V+PA+ TP K LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKESTVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRP  44



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPLTNLWNSNVDLIIPRFHTPSVYFYRP  44



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRP  44



>ref|XP_007099550.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20478.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=339

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+P
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKP  44



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I ++ +TMV+PA+PT  ++LW SN+DLVV R H   VYFYRP
Sbjct  4    INVRRSTMVRPAEPTQRRRLWNSNLDLVVPRFHTPSVYFYRP  45



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP
Sbjct  73   VKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRP  112



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++E+TMV+PA+ TP   LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRESTMVRPAEETPRINLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I +KE+TMV+PA  TP   LW SNVDLV+   H+  VYFYR
Sbjct  1    MKIVVKESTMVRPAAETPRVSLWNSNVDLVMNNFHITSVYFYR  43



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++TMV+PA  TP  +LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKKSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_006427659.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
 gb|ESR40899.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
Length=189

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRP  44



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +   TMV+PA  TP + LW SNVDLV+ RIH   VYFYRP
Sbjct  1    MEINVVRETMVRPAGATPQRVLWNSNVDLVIPRIHTASVYFYRP  44



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +3

Query  153  HKKDYCFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            H     F  N     ++I I+++T+++PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  27   HSIKLFFACNNPYATMKINIRDSTIIRPAAETPVTNLWNSNVDLIIPRFHTPSVYFYRP  85



>gb|EPS58233.1| hypothetical protein M569_16582, partial [Genlisea aurea]
Length=137

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +  +TMV+PA  TP   LW SNVDLV+   ++L VYFYRP
Sbjct  1    MKIDVISSTMVQPAAETPRHSLWMSNVDLVIPNAYMLTVYFYRP  44



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_007099551.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20479.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=368

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+TMV PA+ TPS+KLW SN+DLV+   H+  VY YRP
Sbjct  1    MEIAVKESTMVCPAEETPSRKLWVSNLDLVMTIYHISTVYCYRP  44



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  192  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            EK+++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+P
Sbjct  7    EKMKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKP  52



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ I +KE+T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P
Sbjct  3    RVEIRMKESTIVRPAEDTPEKSLWSSNLDLLVPSVHIPTIYFYKP  47



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            MA ++++I +KE+++V PAK TP   +W SN+DL+V  IH+  VYFY+P
Sbjct  1    MALKEMKISVKESSIVLPAKDTPRTSIWTSNLDLLVPTIHIPTVYFYKP  49



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR
Sbjct  3    ITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP + +W SN+DLVV  +H   VYFYRP
Sbjct  1    MKIIVKKRTIVKPAEETPRRSIWNSNLDLVVSNMHTPSVYFYRP  44



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP + +W SN+DLVV  +H   VYFYRP
Sbjct  1    MKIIVKKRTIVKPAEETPRRSIWNSNLDLVVSNMHTPSVYFYRP  44



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K +TMV+PA  TP  +LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVKNSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_007149785.1| hypothetical protein PHAVU_005G0986000g, partial [Phaseolus vulgaris]
 gb|ESW21779.1| hypothetical protein PHAVU_005G0986000g, partial [Phaseolus vulgaris]
Length=64

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+ MV+PA+ TP K LW S++DL+ G  H+  +YFY P
Sbjct  1    MTISVKESIMVQPAEATPRKVLWNSDLDLLAGNYHIPTLYFYNP  44



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  3    INIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRP  44



>ref|XP_010452842.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=443

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I IK+TT+VKPAK TP+  LW SN+DL+  R H+  +YF+ P
Sbjct  1    MKIWIKQTTIVKPAKETPTHSLWLSNLDLIQVRFHMGTLYFFNP  44



>ref|XP_007027325.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07827.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=393

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+TMV PA+ TP+++LW SN+DLV+   H+  VYFYRP
Sbjct  1    MEIAVKESTMVCPAEETPNRRLWVSNLDLVMTIYHVPTVYFYRP  44



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++TMV+PA  TP   LW SNVDL++ + H   VYFYRP
Sbjct  1    MKIKIQDSTMVRPAAETPITSLWNSNVDLIMAKYHTPSVYFYRP  44



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRP  44



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRP  44



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + ++E+T+V+PA  TP   LW SNVDLV+  IH   VYFYRP
Sbjct  3    VNVSVRESTLVRPAAETPKHALWNSNVDLVIPSIHTPSVYFYRP  46



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +K +TMV+PA+ TP + LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKASTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            I +KE+TMV+PA+ TP + LW SN DLVV R H  +VYF+R
Sbjct  3    INMKESTMVRPAESTPEQTLWISNADLVVRRSHTPIVYFFR  43



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRP
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTIVRPAGETPITSLWNSNVDLIIPRFHTPSVYFYRP  44



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+T+V+PA+ TP ++LW S++DLVV  +H   VYFYRP
Sbjct  16   INVKESTLVRPAEETPRRRLWNSSLDLVVPSVHTPSVYFYRP  57



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +++ +K++TMV+P++ TP++ LW SN+DL+V   H+  VYFY+P
Sbjct  1    MKVDVKQSTMVRPSRETPNRSLWSSNLDLLVPMFHVQTVYFYKP  44



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +RI +KE+T V+PA+  P + LW SNVDLVV   H   VYFY P
Sbjct  1    MRISVKESTTVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNP  44



>gb|KJB71590.1| hypothetical protein B456_011G1315001, partial [Gossypium raimondii]
Length=350

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMTRYHIPTVYYYKP  44



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + + ++E+T+VKPA+ TP K LW  NVDLV+  IH   VYFYR
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNXNVDLVIPSIHTPSVYFYR  45



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE++MV+PA+ TP++ LW SNVDLVV   H   VYFY P
Sbjct  3    IKVKESSMVRPAEETPTRALWNSNVDLVVPNFHTPSVYFYTP  44



>ref|XP_007149778.1| hypothetical protein PHAVU_005G098400g [Phaseolus vulgaris]
 gb|ESW21772.1| hypothetical protein PHAVU_005G098400g [Phaseolus vulgaris]
Length=141

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+ MV+PA+ TP K LW S++DL+ G  H+  +YFY P
Sbjct  1    MTISVKESIMVQPAEATPRKVLWNSDLDLLAGNYHIPTLYFYNP  44



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_010545447.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=441

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++T+VKPAK TP   LW SN+DL+  R+H+  ++FY+P
Sbjct  1    MKIRVKQSTIVKPAKETPRHSLWLSNIDLIQVRLHMGTLHFYKP  44



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+T+V P++ TP   LW SNVDLVV R H   VYFYRP
Sbjct  3    INVKESTLVPPSEETPRVGLWNSNVDLVVPRFHTPSVYFYRP  44



>ref|NP_200592.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK95303.1|AF410317_1 AT5g57840/MTI20_9 [Arabidopsis thaliana]
 dbj|BAB08854.1| N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis thaliana]
 gb|AAN31075.1| At5g57840/MTI20_9 [Arabidopsis thaliana]
 gb|AED96958.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
Length=443

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R+H+  +YFY+P
Sbjct  1    MKIRVKQATIVKPAEETPTHNLWLSNLDLIQVRLHMGTLYFYKP  44



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA  TP ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAGETPRQRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  213  KETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + +T+V PA+PTP ++LW S++DLVV R H   VYFYRP
Sbjct  6    RRSTLVGPAEPTPRRRLWNSSLDLVVPRFHTPSVYFYRP  44



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++T+V+PA  TP   LW SN+DLVV   H   VYFYRP
Sbjct  1    MKINVKDSTLVRPAAATPMVSLWNSNIDLVVPNFHTPSVYFYRP  44



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP
Sbjct  1    MKINIRDSTVVRPAAETPVINLWNSNVDLIIPRFHTPSVYFYRP  44



>gb|KJB71596.1| hypothetical protein B456_011G132100 [Gossypium raimondii]
Length=437

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R HL  +Y+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMTRYHLPTIYYYKP  44



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY  323
            ++I I  +TMV+PA+ TP+++LW SN+DLV+ R H+ +VYF+
Sbjct  1    MKITINGSTMVRPARDTPNRRLWNSNLDLVISRYHVALVYFF  42



>ref|XP_008370591.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=332

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            MA + +++ ++++TMVKP +  P + LW SN+DLV    H+  VYFYRP
Sbjct  1    MAEKVMKVSVRDSTMVKPVEEMPPRALWLSNLDLVRRVNHMPSVYFYRP  49



>ref|XP_003580078.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010240077.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=443

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I +K +TMV+PA  TP  +LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVKRSTMVRPAGETPRVRLWNSNLDLVVPRFHTPSVYFYR  43



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_007033659.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007033660.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033661.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033662.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033663.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033664.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033665.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033666.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033667.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04585.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY04586.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04587.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04588.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04589.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04590.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04591.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04592.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04593.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=433

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+TMV+PA+ TP++ LW SN+D +V R H+  VYFY P
Sbjct  1    MEISIKESTMVRPAQETPNQWLWMSNMDEIVIRSHIPTVYFYIP  44



>ref|XP_010481008.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=143

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++T+V+PA  TP  +LW S+VDL++ + H   VYFYRP
Sbjct  1    MKINIRDSTIVRPAAETPVTELWNSHVDLIIAKYHSPTVYFYRP  44



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ I  K++T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P
Sbjct  3    RVEIRTKQSTIVRPAEDTPEKSLWSSNLDLLVPMVHIPTIYFYKP  47



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            K+ I IKE+ +V+PA+ TP K +W SN+DL+V  +H+  +YFY+P
Sbjct  3    KVDIRIKESAIVRPAEETPKKSIWSSNLDLLVPIVHVPTIYFYKP  47



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIEVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRP  44



>ref|XP_002866234.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42493.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R H+  +YFY P
Sbjct  1    MKIQVKQATIVKPAEETPTHNLWLSNLDLIQVRFHMGTLYFYNP  44



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I+++T+V+PA  TP  KLW S+VDL+  + H   VYFYRP
Sbjct  1    MKINIRDSTIVRPAAETPVTKLWNSHVDLIDAKYHTPTVYFYRP  44



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRNLWNSNLDIVMIRYHIPTVYYYKP  44



>emb|CDX88644.1| BnaA03g10050D [Brassica napus]
Length=444

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP   LW SN+DL+  R H+ ++YFY P
Sbjct  1    MKIHVKQATIVKPAEETPRHSLWLSNLDLIQVRFHMGILYFYNP  44



>gb|KJB68220.1| hypothetical protein B456_010G233100 [Gossypium raimondii]
Length=182

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+T+V+PA+  TP   +W SN+DL++ R H+  VYFY+P
Sbjct  1    MEISIKESTIVRPAEEHTPKGSIWNSNLDLLISRYHVSTVYFYKP  45



>gb|EAY94737.1| hypothetical protein OsI_16513 [Oryza sativa Indica Group]
Length=155

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_006401163.1| hypothetical protein EUTSA_v10013552mg [Eutrema salsugineum]
 gb|ESQ42616.1| hypothetical protein EUTSA_v10013552mg [Eutrema salsugineum]
Length=443

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R H+ ++YFY P
Sbjct  1    MKIRVKQATVVKPAEETPTHSLWLSNLDLIQVRFHMGMLYFYNP  44



>ref|XP_006648830.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=216

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +TMV+PA+ TP ++LW S++DLVV R H   VYF+R
Sbjct  1    MKISVRGSTMVRPAEETPRQRLWNSSLDLVVPRFHTPSVYFFR  43



>ref|XP_001756433.1| predicted protein [Physcomitrella patens]
 gb|EDQ78829.1| predicted protein [Physcomitrella patens]
Length=410

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY  323
            +L + I++ +MV+P++PTP + LW S +DLV+ RIH   VYFY
Sbjct  8    QLDVTIRKQSMVRPSEPTPERILWNSGLDLVIPRIHTQSVYFY  50



>emb|CDY11845.1| BnaC03g12710D [Brassica napus]
Length=951

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  165  YCFN-TNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +C +   + ++ ++I +K+ T+VKPA+ TP   LW SN+DL+  R H+ ++YFY P
Sbjct  499  FCLSKVEVVTKVMKIHVKQATIVKPAEETPRHGLWLSNLDLIQVRFHMGILYFYNP  554


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKPA+ TP   LW SN+DL+  R H+ ++YFY P
Sbjct  1    MKIHVKQATIVKPAEETPIHSLWLSNLDLIQVRFHMGILYFYNP  44



>gb|KJB71577.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
 gb|KJB71579.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=436

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKP  44



>ref|XP_007149776.1| hypothetical protein PHAVU_005G098200g, partial [Phaseolus vulgaris]
 gb|ESW21770.1| hypothetical protein PHAVU_005G098200g, partial [Phaseolus vulgaris]
Length=83

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+ MV+ A+ TP K LW S++DL+VG  H   VYFY P
Sbjct  1    MTIIVKESIMVQSAEATPRKVLWNSDLDLLVGNYHTPTVYFYNP  44



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I +KE T+V+PA+ TP + LW S++DL+VG  H+  VYFYR
Sbjct  2    IKIEVKEATVVRPAEETPRRVLWSSSLDLLVGSNHVPTVYFYR  44



>dbj|BAJ91003.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYR  43



>gb|EYU24586.1| hypothetical protein MIMGU_mgv1a0064641mg, partial [Erythranthe 
guttata]
Length=269

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K + +V+PA  TP+  LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIDVKRSALVRPAAATPAVSLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|KJB71578.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=315

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKP  44



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+T+V PA+ TP+++LW SN DLV+   H+  VYFY+P
Sbjct  1    MEIAVKESTIVCPAEETPNRRLWVSNFDLVMIMYHISTVYFYKP  44



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I I+   MV+PA  TPS  LW SNVDL++ R H   VYFYR
Sbjct  1    MKINIRNAAMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYR  43



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ I +K TTMV+PA+ TP   LW +N+DLVV  +H   VYFYRP
Sbjct  7    RMIINVKGTTMVRPAEDTPRCTLWNANLDLVVPSMHTPSVYFYRP  51



>gb|KJB71580.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=306

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKP  44



>gb|KJB71581.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=324

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+P
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKP  44



>ref|XP_007156887.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
 gb|ESW28881.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
Length=424

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+TMV+PA+ TP K LW SN+DL+    H   VYFY+P
Sbjct  1    MTITVKESTMVQPAEGTPRKVLWISNLDLLARDYHSPTVYFYKP  44



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+P
Sbjct  1    MKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKP  44



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ I +K +TMV+PA+ TP   LW +NVDLVV  +H   VYFYRP
Sbjct  7    RMIINVKGSTMVRPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRP  51



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYR  43



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  225  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            MV+PA  TPS  LW SNVDLV+ R H   VYFYRP
Sbjct  1    MVRPASETPSTYLWNSNVDLVIPRFHTPSVYFYRP  35



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I ++T+V+PA  TP+  LW S+VDL++ + H   VYFYRP
Sbjct  1    MKINILDSTIVRPAAETPTTNLWNSHVDLIIAKYHTPSVYFYRP  44



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRP
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRP
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|EPS58183.1| hypothetical protein M569_16633, partial [Genlisea aurea]
Length=142

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +  +TMV P+  TP   LW SNVDLVV   H   VYFYRP
Sbjct  1    MKIAVIGSTMVPPSSETPKVSLWNSNVDLVVPNFHTPSVYFYRP  44



>gb|KFK27325.1| hypothetical protein AALP_AA8G368300 [Arabis alpina]
Length=444

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ T+VKP++ TP   LW SN+DL+  R H+ ++YFY P
Sbjct  1    MKIRVKQETVVKPSEETPKHSLWLSNLDLIQVRFHMGILYFYNP  44



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I I++ T+V+PA  TP   LW S+VDL++ + H   VYFYRP
Sbjct  1    MKINIRDFTIVRPAAETPVTNLWNSHVDLIIAKYHTPSVYFYRP  44



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYR  43



>ref|XP_008223321.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=441

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +EK+ + ++E+TMVKPA+  TP   LW SN DL+    H+  VYFYRP
Sbjct  2    AEKVTVRVRESTMVKPAEESTPRSPLWLSNSDLMFPPFHISTVYFYRP  49



>gb|EYU24606.1| hypothetical protein MIMGU_mgv1a005249mg [Erythranthe guttata]
Length=492

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = +3

Query  168  CFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRI-HLLVVYFYR  326
            CF        ++I +K++TMV P   TPS KLW SNVDLV     H   VYFYR
Sbjct  42   CFFPAEKVNHMKITVKKSTMVAPNAATPSGKLWLSNVDLVTATTYHTRSVYFYR  95



>gb|KHG19404.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Gossypium arboreum]
Length=433

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RP
Sbjct  1    MEITIKESSMVHPAEETPKHRLWSSNLELLMTLHHVPTVYFFRP  44



>ref|XP_006280408.1| hypothetical protein CARUB_v10026341mg, partial [Capsella rubella]
 gb|EOA13306.1| hypothetical protein CARUB_v10026341mg, partial [Capsella rubella]
Length=472

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY  323
            +++I +K+ T+VKPAK TP+  LW SN+DL+  R H+  +YFY
Sbjct  29   QMKIRVKQATIVKPAKETPTHSLWLSNLDLIQVRFHMGKLYFY  71



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + ++E+TMV+PA  T    LW SNVDLVV  +H   VYFYRP
Sbjct  61   VSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRP  102



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +KE+ +V PA  TP   LW SNVDLVV  IH+  VYFY P
Sbjct  1    MKIYVKESALVLPAAVTPCVTLWNSNVDLVVCNIHIPTVYFYGP  44



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + ++E+TMV+PA  T    LW SNVDLVV  +H   VYFYRP
Sbjct  66   VSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRP  107



>ref|XP_009366046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=440

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            +++ ++++TMVKPA+  P + LW SN+DLV    H+  VYFY+P
Sbjct  5    MKVSVRDSTMVKPAEEMPPRALWLSNLDLVRRVNHMSSVYFYKP  48



>ref|XP_009132100.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=448

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ ++VKPA+ TP   LW SN+DL+  R H+ ++YFY P
Sbjct  4    MKIRVKQASIVKPAEETPIHSLWLSNLDLIQVRFHMGILYFYNP  47



>ref|XP_007149789.1| hypothetical protein PHAVU_005G0988000g, partial [Phaseolus vulgaris]
 gb|ESW21783.1| hypothetical protein PHAVU_005G0988000g, partial [Phaseolus vulgaris]
Length=185

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I +KE+ MV+PA+ TP K LW SN+DL+    H   VYFY P
Sbjct  1    MTIIVKESIMVQPAEATPRKVLWMSNMDLLARNYHSPSVYFYNP  44



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRP
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRP  54



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +T+V+PA+ TP  +LW +N DLVV R H   VYFYR
Sbjct  1    MKITVRGSTVVRPAEETPRMRLWNANPDLVVPRFHTPSVYFYR  43



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY  323
            K+ I +KE+T V PA+PTP + LW SN D +V R H+  VYF+
Sbjct  8    KMIINVKESTTVGPAEPTPERTLWISNADQLVRRAHIPTVYFF  50



>ref|NP_001047408.1| Os02g0611800 [Oryza sativa Japonica Group]
 dbj|BAD19683.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 3 [Oryza 
sativa Japonica Group]
 dbj|BAF09322.1| Os02g0611800 [Oryza sativa Japonica Group]
 gb|EAY86657.1| hypothetical protein OsI_08038 [Oryza sativa Indica Group]
 dbj|BAG96596.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +TMV+PA+ TP  +LW S++DLVV R H   VYF+R
Sbjct  1    MKINVRGSTMVRPAEETPRVRLWNSSLDLVVPRFHTPSVYFFR  43



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRP
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRP  54



>gb|EAZ23787.1| hypothetical protein OsJ_07497 [Oryza sativa Japonica Group]
Length=463

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +TMV+PA+ TP  +LW S++DLVV R H   VYF+R
Sbjct  1    MKINVRGSTMVRPAEETPRVRLWNSSLDLVVPRFHTPSVYFFR  43



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K+ +MV PAK TP   LW SN+D VV RIH+  VY Y+P
Sbjct  1    MKIEVKKWSMVCPAKHTPKHTLWMSNLDSVVPRIHVPTVYLYKP  44



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRP
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRP  54



>ref|XP_010483334.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=443

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K++ +VKPAK TPS  LW SN+D +  R H+  +YF+ P
Sbjct  1    MKIWVKQSAIVKPAKETPSHSLWLSNLDQIQVRFHMGTLYFFNP  44



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RP
Sbjct  4    MEITIKESSMVYPAEETPKHRLWSSNLELLMTLHHVPTVYFFRP  47



>ref|XP_009365251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + + ++ETT+VKPA+ TP + LW SN+DLV+   H   VYFYR
Sbjct  3    VNVSMRETTIVKPAEETPKQVLWMSNLDLVILSKHTPSVYFYR  45



>ref|XP_009132104.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=443

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY  323
            ++I +K+ T+VKPA+ TP   LW SN+DL+  R H+ ++YFY
Sbjct  1    MKIHVKQATIVKPAEETPVHNLWLSNLDLIQVRFHMGILYFY  42



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ TT+V PA  TP  +LW +N DLVV R H   VYFYR
Sbjct  1    MKITVRSTTVVVPAAETPRLRLWNANPDLVVPRFHTPSVYFYR  43



>gb|EYU21745.1| hypothetical protein MIMGU_mgv1a006579mg [Erythranthe guttata]
Length=438

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            +++ +K++T+V+PA  TP   LW SN+DLV+   H+ ++YFYR
Sbjct  1    MKLYVKKSTLVRPAAETPRVSLWNSNLDLVMPNFHVPIIYFYR  43



>ref|XP_009403058.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=434

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  216  ETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            E+ MV PA+ TP+  +W SN+DL+VGR H   VYFY P
Sbjct  5    ESGMVVPAEETPTHSIWLSNLDLLVGRSHTPTVYFYPP  42



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++ I +K +TMV PAK TP    W +NVDL+V  +H   VYFYRP
Sbjct  7    RMIINVKGSTMVSPAKDTPRCTQWLANVDLMVPTLHTPSVYFYRP  51



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  168  CFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            C     +S ++ I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR
Sbjct  18   CLLCEQSSREMIINVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYR  70



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            ++I +K +T V P+  TP ++LW S++DL++   H   VYFYRP
Sbjct  1    MKIGVKSSTTVAPSAETPRRRLWNSSLDLIIPNFHTPSVYFYRP  44



>ref|XP_007216080.1| hypothetical protein PRUPE_ppa018070mg, partial [Prunus persica]
 gb|EMJ17279.1| hypothetical protein PRUPE_ppa018070mg, partial [Prunus persica]
Length=130

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++E+ +VKP + TP + LW S++D+V+ R H+  VYFYR
Sbjct  7    VRESMVVKPEEETPKRALWISDLDVVISRTHVGSVYFYR  45



>gb|AGH61997.1| rosmarinic acid synthase [Perilla frutescens]
Length=432

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYR  326
            +RI +KE+TMV+PA  TPS  +W SN+DL+     H L V+FYR
Sbjct  1    MRIEVKESTMVRPAAETPSGSVWLSNLDLLSPANYHTLSVHFYR  44



>ref|XP_008777439.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=431

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            I ET +V P+  TP  ++W SN+DL+V R H   VYFYRP
Sbjct  7    ILETGLVTPSDDTPKHEIWLSNLDLLVARGHTPTVYFYRP  46



>ref|XP_007011894.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29513.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=543

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++  I  +TMV+PA+ TP+++LW SN+DLV+ R H+  V FY+
Sbjct  1    MKTTINGSTMVRPARDTPNRRLWNSNLDLVISRYHVTSVCFYK  43



>gb|KJB68229.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=423

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+TMV PA+  TP   +W SN+D ++ R H+  VYFY+P
Sbjct  1    MEISIKESTMVHPAEEHTPKGSIWNSNLDRLISRYHVSTVYFYKP  45



>gb|KJB68227.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
 gb|KJB68228.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=422

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + I IKE+TMV PA+  TP   +W SN+D ++ R H+  VYFY+P
Sbjct  1    MEISIKESTMVHPAEEHTPKGSIWNSNLDRLISRYHVSTVYFYKP  45



>ref|XP_006427033.1| hypothetical protein CICLE_v10026791mg [Citrus clementina]
 gb|ESR40273.1| hypothetical protein CICLE_v10026791mg [Citrus clementina]
Length=118

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + I +KETT+++PA  TP   L  S +DL+V  IH+L VYFYR
Sbjct  1    MEIHVKETTIIRPAHETPKHCLKISELDLLVPSIHVLGVYFYR  43



>ref|XP_011036967.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            K+ I IKE+ +V+PA+ TP K L  SN+DL+V  +H+  +YFY+P
Sbjct  3    KVDIRIKESAIVRPAEETPKKSLRSSNLDLLVPIVHVPTIYFYKP  47



>ref|XP_008237042.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=446

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            +EK+ + IKE+TMVKPA+  TP   LW SN+DL   R     VYFYR
Sbjct  2    AEKVTVSIKESTMVKPAEESTPRGSLWLSNLDLEYSRHDTSTVYFYR  48



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS-KKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + +KE+T+VKPA+ T   + LW +NVDLV+  IH   +YFYRP
Sbjct  4    VNVTVKESTIVKPAEETTEPRSLWNANVDLVIPSIHTPSIYFYRP  48



>gb|EMS50893.1| Anthranilate N-benzoyltransferase protein 1 [Triticum urartu]
Length=142

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP  329
            + + I E+ MV P++ TP + +W SN+DL+V R H   VY YRP
Sbjct  1    MAVEILESCMVTPSEATPKQAVWLSNLDLLVARGHTPTVYIYRP  44



>gb|AFW72297.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=166

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ + MV PA  TP ++LW S  DLVV R H   VYF+R
Sbjct  1    MKITVRGSEMVYPAAETPRRRLWNSGPDLVVPRFHTPSVYFFR  43



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR
Sbjct  4    VNVSVRESTLVKPAEETPGQVLWMTNLDLVILGNHTPSVYFYR  46



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +T+V PA  TP  +LW +N DLVV R H   VYFYR
Sbjct  1    MKITVRSSTVVVPAAETPRVRLWNANPDLVVPRFHTPSVYFYR  43



>dbj|BAC78633.1| hydroxyanthranilate hydroxycinnamoyltransferase 1 [Avena sativa]
Length=441

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR  326
            ++I ++ +T+V PA  TP  +LW +N DLVV R H   VYFYR
Sbjct  1    MKITVRSSTVVVPAAETPRVRLWNANPDLVVPRFHTPSVYFYR  43



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564723838400