BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004G17

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05334.1|  unnamed protein product                                241   2e-71   Coffea canephora [robusta coffee]
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    240   2e-71   Solanum lycopersicum
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    237   2e-70   Solanum tuberosum [potatoes]
gb|AIU51149.1|  embryo yellow protein                                   232   2e-68   Lactuca sativa [cultivated lettuce]
ref|XP_006587679.1|  PREDICTED: conserved oligomeric Golgi comple...    226   3e-67   
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         227   1e-66   Jatropha curcas
gb|AIU51141.1|  embryo yellow protein                                   214   1e-66   Saruma henryi
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                226   3e-66   Erythranthe guttata [common monkey flower]
gb|AIU51131.1|  embryo yellow protein                                   226   3e-66   Manihot esculenta [manioc]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    226   4e-66   Glycine max [soybeans]
gb|AIU51119.1|  embryo yellow protein                                   226   4e-66   Glycine max [soybeans]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            226   4e-66   Glycine soja [wild soybean]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    224   2e-65   Nicotiana sylvestris
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            224   2e-65   Glycine soja [wild soybean]
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    223   3e-65   Eucalyptus grandis [rose gum]
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    223   6e-65   Citrus sinensis [apfelsine]
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    222   7e-65   Cicer arietinum [garbanzo]
ref|XP_002510953.1|  conserved hypothetical protein                     222   9e-65   Ricinus communis
gb|KEH17632.1|  oligomeric component-related/COG complex component      222   1e-64   Medicago truncatula
emb|CAN76413.1|  hypothetical protein VITISV_043812                     215   1e-64   Vitis vinifera
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             221   1e-64   Citrus clementina [clementine]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   221   2e-64   Citrus sinensis [apfelsine]
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    221   2e-64   Populus euphratica
gb|AIU51115.1|  embryo yellow protein                                   221   2e-64   Carica papaya [mamon]
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    220   4e-64   Sesamum indicum [beniseed]
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    220   5e-64   Nicotiana tomentosiformis
gb|AIU51140.1|  embryo yellow protein                                   220   5e-64   Ricinus communis
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    219   8e-64   Cucumis melo [Oriental melon]
gb|AIU51114.1|  embryo yellow protein                                   219   1e-63   Gossypium raimondii
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    219   1e-63   
gb|AIU51121.1|  embryo yellow protein                                   218   2e-63   Buxus sinica
gb|AIU51138.1|  embryo yellow protein                                   218   2e-63   Phaseolus vulgaris [French bean]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             218   2e-63   Phaseolus vulgaris [French bean]
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    218   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    218   3e-63   Pyrus x bretschneideri [bai li]
gb|EPS73811.1|  hypothetical protein M569_00940                         218   4e-63   Genlisea aurea
gb|AIU51110.1|  embryo yellow protein                                   217   4e-63   Theobroma cacao [chocolate]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    217   4e-63   
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    217   4e-63   
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    217   7e-63   Cucumis sativus [cucumbers]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    217   7e-63   
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    217   7e-63   Prunus mume [ume]
gb|AIU51152.1|  embryo yellow protein                                   216   9e-63   Platanus x hispanica [London plane tree]
ref|XP_010089680.1|  hypothetical protein L484_001268                   216   1e-62   Morus notabilis
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    215   3e-62   Nelumbo nucifera [Indian lotus]
gb|AIU51136.1|  embryo yellow protein                                   215   3e-62   Prunus persica
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             215   3e-62   Prunus persica
gb|AIU51120.1|  embryo yellow protein                                   213   4e-62   Illicium henryi
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    214   5e-62   Vitis vinifera
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          214   8e-62   Amborella trichopoda
emb|CDX99921.1|  BnaC09g27840D                                          211   9e-62   
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    211   1e-61   
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    213   1e-61   
gb|AIU51151.1|  embryo yellow protein                                   213   2e-61   Cinnamomum camphora
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             212   3e-61   Eutrema salsugineum [saltwater cress]
gb|AIU51147.1|  embryo yellow protein                                   212   4e-61   Schrenkiella parvula
ref|XP_010442641.1|  PREDICTED: conserved oligomeric Golgi comple...    207   5e-61   Camelina sativa [gold-of-pleasure]
emb|CDY00475.1|  BnaA10g07980D                                          211   5e-61   
gb|AIU51106.1|  embryo yellow protein                                   210   1e-60   Magnolia denudata [haku-mokuren]
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             210   2e-60   Capsella rubella
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    210   2e-60   Tarenaya hassleriana [spider flower]
gb|AIU51116.1|  embryo yellow protein                                   210   2e-60   Capsella rubella
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    209   3e-60   Camelina sativa [gold-of-pleasure]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    209   3e-60   Arabis alpina [alpine rockcress]
gb|AIU51102.1|  embryo yellow protein                                   209   3e-60   Aquilegia coerulea [Rocky Mountain columbine]
emb|CDY56655.1|  BnaA02g11250D                                          208   7e-60   Brassica napus [oilseed rape]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             208   7e-60   
gb|AIU51103.1|  embryo yellow protein                                   208   7e-60   Arabidopsis lyrata [lyrate rockcress]
ref|NP_199956.1|  COG7-like protein EYE                                 208   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51104.1|  embryo yellow protein                                   208   8e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    208   8e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00649.1|  hypothetical protein                                   208   8e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51112.1|  embryo yellow protein                                   208   1e-59   Sarcandra glabra
gb|AIU51154.1|  embryo yellow protein                                   207   1e-59   Houttuynia cordata [chameleon-plant]
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    207   1e-59   Camelina sativa [gold-of-pleasure]
gb|AIU51125.1|  embryo yellow protein                                   206   3e-59   Chimonanthus praecox [wintersweet]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    206   4e-59   Brassica rapa
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    206   4e-59   Fragaria vesca subsp. vesca
emb|CDX91578.1|  BnaC02g15820D                                          202   6e-58   
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         202   2e-57   Medicago truncatula
gb|AIU51129.1|  embryo yellow protein                                   201   2e-57   Medicago truncatula
gb|AIU51150.1|  embryo yellow protein                                   201   2e-57   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51124.1|  embryo yellow protein                                   201   2e-57   Ceratophyllum demersum [hornwort]
gb|AIU51128.1|  embryo yellow protein                                   196   2e-55   Aristolochia tagala
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    194   2e-55   
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    188   1e-52   Elaeis guineensis
gb|AIU51143.1|  embryo yellow protein                                   187   2e-52   Yucca filamentosa [Adam's-needle]
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    187   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001770876.1|  predicted protein                                  186   5e-52   
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    186   7e-52   Phoenix dactylifera
gb|AIU51157.1|  embryo yellow protein                                   185   1e-51   Trachycarpus fortunei
gb|AIU51127.1|  embryo yellow protein                                   182   2e-50   Asparagus officinalis
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         180   5e-50   
gb|AIU51107.1|  embryo yellow protein                                   176   2e-48   Musa acuminata [banana]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    176   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51156.1|  embryo yellow protein                                   176   4e-48   Alisma plantago-aquatica
gb|AIU51153.1|  embryo yellow protein                                   168   1e-45   Ginkgo biloba [ginkgo]
gb|AIU51142.1|  embryo yellow protein                                   168   2e-45   Dioscorea oppositifolia
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             167   2e-45   
gb|AIU51108.1|  embryo yellow protein                                   166   1e-44   Pinellia ternata
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             165   2e-44   
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    154   2e-40   Oryza brachyantha
gb|EEC81147.1|  hypothetical protein OsI_24056                          154   3e-40   Oryza sativa Indica Group [Indian rice]
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        154   3e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AIU51109.1|  embryo yellow protein                                   153   4e-40   Brachypodium distachyon [annual false brome]
gb|AIU51144.1|  embryo yellow protein                                   153   6e-40   Setaria italica
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    153   6e-40   Setaria italica
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    153   7e-40   
gb|AIU51130.1|  embryo yellow protein                                   152   1e-39   Canna indica [canna]
gb|AIU51155.1|  embryo yellow protein                                   152   1e-39   Zea mays [maize]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    152   2e-39   
dbj|BAJ95800.1|  predicted protein                                      152   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94393.1|  predicted protein                                      152   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          152   2e-39   Sorghum bicolor [broomcorn]
gb|AIU51146.1|  embryo yellow protein                                   151   2e-39   Sorghum bicolor [broomcorn]
gb|AIU51158.1|  embryo yellow protein                                   145   3e-37   Cabomba caroliniana
gb|AIU51137.1|  embryo yellow protein                                   145   3e-37   Panicum virgatum
gb|AIU51111.1|  embryo yellow protein                                   141   7e-36   Acorus calamus [flagroot]
ref|XP_003055554.1|  predicted protein                                  120   3e-28   Micromonas pusilla CCMP1545
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             112   2e-25   Chlorella variabilis
ref|XP_002503576.1|  predicted protein                                  102   4e-22   Micromonas commoda
gb|EEE66191.1|  hypothetical protein OsJ_22310                        96.3    7e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            95.1    2e-19   Coccomyxa subellipsoidea C-169
ref|XP_002953697.1|  component of oligomeric golgi complex 7          95.5    2e-19   Volvox carteri f. nagariensis
ref|XP_001628559.1|  predicted protein                                94.7    2e-19   Nematostella vectensis
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7         89.7    1e-17   Ostreococcus tauri
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  89.0    2e-17   Apis dorsata [rock honeybee]
ref|XP_007903980.1|  PREDICTED: conserved oligomeric Golgi comple...  89.0    2e-17   Callorhinchus milii [Australian ghost shark]
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  88.6    3e-17   Callorhinchus milii [Australian ghost shark]
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  88.6    3e-17   
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  88.6    3e-17   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  88.6    3e-17   Apis dorsata [rock honeybee]
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  87.8    5e-17   
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          87.8    6e-17   Crassostrea gigas
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  87.4    7e-17   Xiphophorus maculatus
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    1e-16   Bombus terrestris [large earth bumblebee]
emb|CAG04322.1|  unnamed protein product                              85.5    2e-16   Tetraodon nigroviridis
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    2e-16   Lepisosteus oculatus
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          86.3    2e-16   Zootermopsis nevadensis
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    3e-16   
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    3e-16   Acromyrmex echinatior
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    3e-16   Harpegnathos saltator
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    3e-16   Oryzias latipes [Japanese rice fish]
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    4e-16   
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    4e-16   Takifugu rubripes [tiger puffer]
emb|CBN81326.1|  Conserved oligomeric Golgi complex subunit 7         84.0    4e-16   Dicentrarchus labrax [European sea bass]
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    5e-16   
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    5e-16   
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    5e-16   Chrysemys picta bellii
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    5e-16   Notothenia coriiceps [yellowbelly rockcod]
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          84.7    7e-16   Acromyrmex echinatior
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    8e-16   Solenopsis invicta [imported red fire ant]
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    9e-16   Stegastes partitus
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    9e-16   Poecilia formosa
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    9e-16   Poecilia reticulata
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  84.3    9e-16   Poecilia formosa
ref|XP_001701937.1|  component of oligomeric golgi complex 7          84.0    1e-15   Chlamydomonas reinhardtii
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    2e-15   Oreochromis niloticus
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    2e-15   Chelonia mydas [green seaturtle]
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    2e-15   
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    2e-15   Pundamilia nyererei
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    2e-15   Maylandia zebra
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    2e-15   Haplochromis burtoni
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  83.2    2e-15   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    2e-15   Crassostrea gigas
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  82.8    3e-15   Monodelphis domestica
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...  82.8    3e-15   Anolis carolinensis [Carolina anole]
ref|XP_006825808.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    5e-15   Saccoglossus kowalevskii
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    7e-15   Ciona intestinalis [sea vase]
ref|XP_008536012.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    8e-15   Equus przewalskii [Przewalski horse]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    1e-14   
ref|XP_010568819.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   Haliaeetus leucocephalus
ref|XP_010568818.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   Haliaeetus leucocephalus
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   Alligator sinensis
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   Haliaeetus leucocephalus
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            80.9    1e-14   Trichoplax adhaerens
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  80.9    1e-14   
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-14   Struthio camelus australis
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-14   
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   Haliaeetus leucocephalus
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   Microtus ochrogaster [prairie voles]
ref|NP_001085832.1|  component of oligomeric golgi complex 7          80.5    2e-14   Xenopus laevis [clawed frog]
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7          80.5    2e-14   Struthio camelus australis
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   Struthio camelus australis
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     80.1    2e-14   Gallus gallus [bantam]
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     79.7    3e-14   Danio rerio [leopard danio]
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Ficedula albicollis
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Esox lucius
ref|NP_001015714.1|  component of oligomeric golgi complex 7          79.3    4e-14   Xenopus tropicalis [western clawed frog]
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Corvus cornix cornix
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Orycteropus afer afer
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7          79.3    5e-14   Tinamus guttatus
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                79.3    5e-14   Capitella teleta
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  79.3    5e-14   Cuculus canorus
emb|CDQ66102.1|  unnamed protein product                              79.3    5e-14   Oncorhynchus mykiss
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    5e-14   
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  79.3    5e-14   Tinamus guttatus
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  79.0    6e-14   Tribolium castaneum [rust-red flour beetle]
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    6e-14   Charadrius vociferus
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    6e-14   Balearica regulorum gibbericeps
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    6e-14   
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    7e-14   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    7e-14   Mesitornis unicolor
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    7e-14   Fopius arisanus
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    7e-14   Columba livia [carrier pigeon]
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           78.6    7e-14   Lottia gigantea
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    7e-14   Calypte anna
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    7e-14   Falco peregrinus [peregrine]
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    7e-14   Echinops telfairi [lesser hedgehog tenrec]
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7          78.6    8e-14   Calypte anna
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    8e-14   Latimeria chalumnae
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    9e-14   Fopius arisanus
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  78.6    1e-13   
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Meleagris gallopavo [common turkey]
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7          78.2    1e-13   Tupaia chinensis
ref|XP_005656829.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Sorex araneus [Eurasian shrew]
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Dasypus novemcinctus
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Felis catus [cat]
ref|XP_003795774.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    2e-13   Cricetulus griseus [Chinese hamsters]
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    2e-13   
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    2e-13   Chrysochloris asiatica
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Leptonychotes weddellii
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  77.4    2e-13   Ursus maritimus [white bear]
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Mustela putorius furo [black ferret]
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Ictidomys tridecemlineatus
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Tupaia chinensis
ref|XP_004332588.1|  PREDICTED: LOW QUALITY PROTEIN: component of...  77.4    2e-13   
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Bison bison bison
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Odobenus rosmarus divergens
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Otolemur garnettii
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Fukomys damarensis [Damara mole rat]
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Camelus ferus
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...  77.4    2e-13   Camelus ferus
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Lipotes vexillifer [baiji]
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Capra hircus [domestic goat]
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Condylura cristata
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Orcinus orca [Orca]
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7     77.4    2e-13   Bos taurus [bovine]
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Camelus bactrianus [camel]
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Physeter catodon
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Vicugna pacos
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  77.4    2e-13   Balaenoptera acutorostrata scammoni
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Loxodonta africana [African bush elephant]
gb|KFM79728.1|  Conserved oligomeric Golgi complex subunit 7          73.6    2e-13   Stegodyphus mimosarum
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    2e-13   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    2e-13   
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    3e-13   Ailuropoda melanoleuca
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    3e-13   Eptesicus fuscus
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    3e-13   Bos mutus
dbj|BAE37211.1|  unnamed protein product                              76.6    3e-13   Mus musculus [mouse]
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    3e-13   Trichechus manatus latirostris
gb|EDL17254.1|  component of oligomeric golgi complex 7               76.6    4e-13   Mus musculus [mouse]
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...  76.6    4e-13   Mus musculus [mouse]
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7     76.6    4e-13   Rattus norvegicus [brown rat]
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7     76.6    4e-13   Mus musculus [mouse]
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   
ref|XP_006507763.2|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   Mus musculus [mouse]
ref|XP_006507762.2|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   Mus musculus [mouse]
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7          76.3    5e-13   Bos mutus
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    6e-13   Carlito syrichta
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    7e-13   
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...  75.9    7e-13   Homo sapiens [man]
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    8e-13   Saimiri boliviensis boliviensis
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...  75.5    8e-13   Pan troglodytes
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   Callithrix jacchus [common marmoset]
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7        75.5    8e-13   Homo sapiens [man]
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    8e-13   
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    9e-13   
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    9e-13   
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    9e-13   
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    1e-12   
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    1e-12   
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    1e-12   
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    1e-12   
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     75.5    1e-12   
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    1e-12   
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    1e-12   
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    1e-12   
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    1e-12   
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          75.1    1e-12   
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    1e-12   
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    2e-12   
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  73.6    4e-12   
ref|XP_009024750.1|  hypothetical protein HELRODRAFT_178406           73.2    4e-12   
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    4e-12   
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  73.6    4e-12   
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    5e-12   
ref|XP_008474492.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    2e-11   
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    3e-11   
ref|XP_011399022.1|  Conserved oligomeric Golgi complex subunit 7     70.5    3e-11   
ref|XP_007513783.1|  predicted protein                                71.2    3e-11   
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          70.5    5e-11   
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    1e-10   
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    1e-10   
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    2e-10   
gb|EEZ99445.1|  hypothetical protein TcasGA2_TC030721                 67.4    5e-10   
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    5e-10   
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    6e-10   
ref|XP_007433967.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    6e-10   
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    7e-10   
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               66.6    9e-10   
dbj|GAN08447.1|  hypothetical protein MAM1_0205d07959                 62.8    5e-09   
gb|ETN63528.1|  hypothetical protein AND_004755                       64.3    5e-09   
gb|EFA86654.1|  oligomeric Golgi complex component                    63.9    7e-09   
emb|CDH53396.1|  mitogen-activated protein kinase kinase              63.9    9e-09   
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    1e-08   
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          63.2    1e-08   
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      62.8    1e-08   
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          62.4    2e-08   
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    2e-08   
emb|CBY32864.1|  unnamed protein product                              61.6    2e-08   
gb|EIE91469.1|  hypothetical protein RO3G_16180                       62.4    2e-08   
ref|XP_004360949.1|  oligomeric Golgi complex component               61.6    4e-08   
emb|CBY21571.1|  unnamed protein product                              61.6    4e-08   
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    5e-08   
ref|XP_002431030.1|  conserved hypothetical protein                   60.8    7e-08   
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 60.5    8e-08   
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    60.8    8e-08   
gb|ESA17025.1|  hypothetical protein GLOINDRAFT_345271                60.5    9e-08   
emb|CEG65284.1|  hypothetical protein RMATCC62417_02093               58.2    9e-08   
gb|EFZ22757.1|  hypothetical protein SINV_01051                       59.7    2e-07   
gb|EXX54575.1|  hypothetical protein RirG_233350                      59.7    2e-07   
ref|XP_637633.1|  oligomeric Golgi complex component                  59.7    2e-07   
gb|KFB52038.1|  AGAP004439-PA-like protein                            59.3    2e-07   
gb|EPB83904.1|  hypothetical protein HMPREF1544_09358                 57.8    3e-07   
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    3e-07   
emb|CEI98246.1|  hypothetical protein RMCBS344292_12361               55.8    5e-07   
ref|XP_001418731.1|  predicted protein                                57.4    8e-07   
dbj|BAB63059.1|  hypothetical protein                                 57.0    1e-06   
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    1e-06   
ref|XP_001357618.1|  GA15960                                          56.6    1e-06   
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    2e-06   
ref|XP_004347003.2|  hypothetical protein CAOG_05318                  56.2    2e-06   
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  55.5    4e-06   
emb|CBK24341.2|  unnamed protein product                              54.3    5e-06   
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  55.1    5e-06   
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  55.1    6e-06   
ref|XP_002911600.1|  hypothetical protein CC1G_14133                  54.7    7e-06   
ref|XP_002073360.1|  GK14089                                          54.3    9e-06   
ref|XP_313727.3|  AGAP004439-PA                                       54.3    1e-05   
ref|XP_009167964.1|  hypothetical protein T265_13613                  54.3    1e-05   
ref|XP_007323090.1|  hypothetical protein SERLADRAFT_418038           53.5    2e-05   
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    2e-05   
ref|XP_002058398.1|  GJ14333                                          53.1    2e-05   
ref|XP_004925156.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    2e-05   
gb|EPS95322.1|  hypothetical protein FOMPIDRAFT_20550                 53.1    3e-05   
emb|CEP06989.1|  hypothetical protein                                 52.8    3e-05   
gb|KJE94721.1|  hypothetical protein CAOG_009840                      52.8    3e-05   
gb|KIM77400.1|  hypothetical protein PILCRDRAFT_91140                 52.4    4e-05   
gb|KIK67210.1|  hypothetical protein GYMLUDRAFT_857700                52.0    5e-05   
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  51.6    6e-05   
emb|CBH12050.1|  hypothetical protein, conserved                      51.6    7e-05   
ref|XP_845669.1|  hypothetical protein                                51.6    7e-05   
gb|KDR75221.1|  hypothetical protein GALMADRAFT_122928                51.2    8e-05   
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  50.8    1e-04   
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  50.4    2e-04   
gb|EJU00574.1|  hypothetical protein DACRYDRAFT_80789                 50.1    2e-04   
gb|KGB34884.1|  Conserved oligomeric Golgi complex subunit 7          49.3    3e-04   
gb|KJA20734.1|  hypothetical protein HYPSUDRAFT_55890                 49.7    3e-04   
ref|XP_001993908.1|  GH22206                                          49.3    4e-04   
ref|XP_003030457.1|  hypothetical protein SCHCODRAFT_57227            48.9    5e-04   
gb|KIK39828.1|  hypothetical protein CY34DRAFT_14142                  48.1    8e-04   
ref|XP_001981279.1|  GG11984                                          48.1    9e-04   



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLS+FSDEKFDPK+WING CQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSDEKFDPKRWINGVCQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDALSLRSSV+SILQKL KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDALSLRSSVASILQKLIKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLIDLEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA RDVIRLRDDALSLRSS+S+ILQKL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILQKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA RDVIRLRDDALSLRSS+S+IL KL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILLKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL SFSDEKFD K+WIN ACQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMIDLGSFSDEKFDAKKWINNACQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A+ RVPRATRDVIRLRDDALSLR SV SIL KL+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   AILRVPRATRDVIRLRDDALSLRQSVGSILLKLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006587679.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Glycine max]
Length=636

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAT  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATRDVIRLRDDALSLR+SVSSILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRATRDVIRLRDDALSLRNSVSSILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y TLQDAAGLT
Sbjct  121  YRTLQDAAGLT  131



>gb|AIU51141.1| embryo yellow protein, partial [Saruma henryi]
Length=262

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M+VDLS+FSDE FDPK+WIN ACQ RHPQDP+DKHL DLEMKLQ+ SEEI  SL+E S +
Sbjct  1    MIVDLSAFSDENFDPKRWINSACQFRHPQDPVDKHLADLEMKLQLLSEEITSSLDEQSTA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLSSFS+EKFDPK+WINGA Q RHPQDP++KHLVDLEMKLQM SEEIA SLEE S+S
Sbjct  1    MMVDLSSFSEEKFDPKRWINGAVQQRHPQDPVEKHLVDLEMKLQMVSEEIASSLEEQSSS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDV+RLRDDALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRASRDVLRLRDDALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATRDVIRLRDDA+SLR+SVS ILQKL+KAEGSSAES+A LAKVDTVK+RME A
Sbjct  61   SLLRVPRATRDVIRLRDDAVSLRNSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMETA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLSSFSDEKFDPK+WIN   QSRHPQDP+DKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINEVFQSRHPQDPVDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPR TRDV RLRDDAL+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDALTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQD L+KHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKRWINSACQARHPQDSLEKHLVDLEMKLQMTSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRD++RLRDDA+SLR SVS ILQKL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDIVRLRDDAVSLRHSVSGILQKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  FS+E FDPK+WIN ACQSRHPQ+ LDKHLVDLEMKLQM SEEI  SLEE SA+
Sbjct  1    MMVDLFPFSNENFDPKKWINSACQSRHPQESLDKHLVDLEMKLQMVSEEITASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDD++SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDSVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLS FS+E FDPK+WIN ACQSRHP++ LDKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSPFSNENFDPKKWINSACQSRHPEESLDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VS+ILQKL+KAEGSS+ES++ LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSAILQKLKKAEGSSSESISALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>emb|CAN76413.1| hypothetical protein VITISV_043812 [Vitis vinifera]
Length=444

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FSD+KFDPK+WIN AC++RHPQ+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHPQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            ETLQDAAGLT
Sbjct  121  ETLQDAAGLT  130



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD+KFDPK+W+N ACQ+RHPQD L+KH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWMNSACQARHPQDSLEKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSS+ES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSSVAGILQKLKKAEGSSSESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLS+FS+EKFDPK+WINGA Q RHPQDP++KHLVDLEM+LQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSEEKFDPKKWINGAVQQRHPQDPVEKHLVDLEMRLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDV+RLRD+ALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLRDEALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M  DLSSFSDEKFDPK+WINGACQSR+PQDP+ KHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MFGDLSSFSDEKFDPKKWINGACQSRNPQDPVVKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPR TRDV RLRDD+L+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDSLTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            ETLQDAAGLT
Sbjct  121  ETLQDAAGLT  130



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILQKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  406  YETLQDAAGL  435
            YETLQDAAGL
Sbjct  121  YETLQDAAGL  130



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RL+DDA+SLR+SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLQDDAVSLRNSVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FSDEKFD K+WIN ACQSRHPQDP +KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINAACQSRHPQDPPEKHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAMSLRNSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YDTLQDAAGLT  131



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YDTLQDAAGLT  131



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDPK W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKNWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL+SFSD+KFDPK+WINGA   RHPQDP++KHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLTSFSDDKFDPKKWINGAVNQRHPQDPVEKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A+ R+PRA+RDV+RL+DDALSLRSS++ IL  L+KAEGSSAES+ATLA+VDTVKRRMEAA
Sbjct  61   AILRIPRASRDVLRLQDDALSLRSSIAGILLFLKKAEGSSAESIATLARVDTVKRRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FSD+KFDPK+WIN AC++RH Q+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHQQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            ETLQDAAGLT
Sbjct  121  ETLQDAAGLT  130



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  406  YETLQDAAGL  435
            YETLQDAAGL
Sbjct  121  YETLQDAAGL  130



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  406  YETLQDAAGL  435
            YETLQDAAGL
Sbjct  121  YETLQDAAGL  130



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDPK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FS+EKFD K+WIN ACQSRHPQDP+++HL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSEEKFDAKKWINAACQSRHPQDPVERHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRNSVSGILLKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FS E F+PK+WIN ACQSRHP++ +DKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSGENFEPKKWINSACQSRHPEESVDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDVIRLRDDA+SLRS+V+SILQKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRSAVASILQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            ETLQDAAGLT
Sbjct  121  ETLQDAAGLT  130



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FSDEKFD K+WIN  CQSRHPQDP++KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINVVCQSRHPQDPVEKHLADLEMKLQMISEEIAASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRA+RDVIRLRDDA+SLR+SV+ IL KL+KAEGSSAESVA LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRASRDVIRLRDDAISLRNSVTGILLKLKKAEGSSAESVAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL +FS+EKFDPK+WINGACQ+R PQDPLDKHL D+EMKLQ+ SEEI+ SL+E S +
Sbjct  1    MMIDLGAFSEEKFDPKKWINGACQARDPQDPLDKHLADMEMKLQLLSEEISSSLDEQSTA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRD+A+SLRSS+S ILQ+L+KAEG SAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSLSGILQRLKKAEGCSAESIAALSKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FS+EKFDPK+WIN ACQ++HPQD +DKHL +LEMKLQ+ SEEI+ SL+ELSAS
Sbjct  1    MMIDLGPFSEEKFDPKKWINAACQAKHPQDSMDKHLAELEMKLQVISEEISSSLDELSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL R+PRA+RDV+RLRDDA+SLRS++S ILQKL KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRIPRASRDVVRLRDDAISLRSAISGILQKLEKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  FSDE+FD K+W+N  CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEEFDAKRWVNSTCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPRKWVNSACQTRHTQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YET QDAAGLT
Sbjct  121  YETSQDAAGLT  131



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FSDEKFDPK+WIN A  SRHPQDP+DKHL DLEMKLQ+ +EEIA SL+E S +
Sbjct  1    MMVDLGTFSDEKFDPKKWINAASLSRHPQDPIDKHLADLEMKLQVLAEEIASSLDEQSNA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRD+A+SLRSSVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_010442641.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Camelina sativa]
Length=491

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A L++VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALSRVDSVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDA GLT
Sbjct  121  YKTLQDADGLT  131



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            MVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S SA
Sbjct  1    MVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGSA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            +TLQDAAGLT
Sbjct  121  KTLQDAAGLT  130



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FSDEKFDPK+WIN ACQSRH Q+ +D+HL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMVDLGAFSDEKFDPKKWINAACQSRHHQESIDRHLADLEMKLQLLSEEISSSLDEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            ALHRVPRA+RDV+RLRDDA+SLRS+VS IL KL+KAEG+S+ESVA LAKVDTVK+RMEAA
Sbjct  61   ALHRVPRASRDVVRLRDDAVSLRSAVSGILVKLKKAEGTSSESVAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N ACQ+RHPQD L+KHLVDLEMKLQ++SEEIA SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSACQARHPQDSLEKHLVDLEMKLQISSEEIAASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A+ RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   AILRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIATLARVDSVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDA GLT
Sbjct  121  YKTLQDADGLT  131



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQSRHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQSRHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL SF+DEKFDPK+WIN   QSRHPQD L+KHL +LEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMVDLGSFTDEKFDPKKWINSTTQSRHPQDSLEKHLSELEMKLQMISEEISASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDALS R+SVS IL KL+KAEGSSAES+  LAKVD VK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDALSFRTSVSGILLKLKKAEGSSAESIDALAKVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FSDEKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSDEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            +TLQDAAGLT
Sbjct  121  KTLQDAAGLT  130



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFDPK+WIN ACQS   QDPLDKHL DLEMKLQ+ ++EI  SL+E S +
Sbjct  1    MMIDLGPFSDEKFDPKKWINSACQSLRSQDPLDKHLADLEMKLQVMADEITSSLDEQSGA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDA+SLRSSVS IL KL+KAEGSSAESVA LAK+DTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSSVSGILLKLKKAEGSSAESVAALAKIDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  F+D+KFD K+WIN ACQ+RHPQ+  DK+L DLEMKLQ+ SEEIA SL+E SA+
Sbjct  1    MMVDLGDFADDKFDAKRWINAACQARHPQEAADKYLADLEMKLQLISEEIAASLDEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL R+PRATRDV+RLRDDALSLRS+VS+IL KL+KAEGSSAE++A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRATRDVVRLRDDALSLRSAVSAILLKLKKAEGSSAEAIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDSVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDA GLT
Sbjct  121  YKTLQDADGLT  131



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +M+DL +FSDEKFDPK+WIN ACQSRHPQ P+D+HL DLEMKLQ+ SEEI+ SL+E S+S
Sbjct  1    IMIDLGAFSDEKFDPKKWINAACQSRHPQQPIDRHLADLEMKLQVLSEEISSSLDEQSSS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL R+PRA+RDVIRLRD+A+SLRSSVSSIL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRASRDVIRLRDEAVSLRSSVSSILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL  FS+EKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSEEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  409  ETLQDAAGLT  438
            +TLQDAAGLT
Sbjct  121  KTLQDAAGLT  130



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSDE FD K+W+N ACQSRHPQD +DKHL DLEMK+QM SEEI  SLEE SAS
Sbjct  1    MMLDLGPFSDENFDRKKWVNSACQSRHPQDSVDKHLADLEMKIQMVSEEIGASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRATR+VIRLRDDA+SLRS+VSSIL KL+KAEG SAES+  LAK D VK+RMEAA
Sbjct  61   SLLRVPRATREVIRLRDDAVSLRSAVSSILDKLKKAEGLSAESIMALAKYDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FS+EKFD K+W+N +CQ+RHPQD L++ LVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSEEKFDAKRWVNSSCQARHPQDSLERQLVDLEMKLQIASEEIGASLEEQSGG  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDCVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            ++TLQDA+GLT
Sbjct  121  FKTLQDASGLT  131



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDLS+FSDEKFDPK+WIN ACQSRHPQDP+DKHL DLE+KLQ+ SEEI+ SL+E S +
Sbjct  1    MMVDLSAFSDEKFDPKKWINNACQSRHPQDPVDKHLADLELKLQLLSEEISSSLDEQSTA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDVIRLRDDA+SLRS++S IL KL+KAEGSSA ++A+LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAISGILLKLKKAEGSSAAAIASLAKVDTVKQRMEAA  120

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  121  YETLQDAAGLT  131



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 6/131 (5%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH VDLEMKLQM  EEIA SLEE SAS
Sbjct  1    MMLDLGPFSDRNFDPRKWVNSACQTRHTQDSVDKHTVDLEMKLQMVXEEIAASLEEQSAS  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRATRDV+R+RDDA      VSSIL K +KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRIRDDA------VSSILDKFKKAEGSSAESMAALAKVDIVKQRMEAA  114

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  115  YETLQDAAGLT  125



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VDL  FS+E FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVVDLGEFSEEGFDPKRWINAALESRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSIISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VDL  FSDE FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSDESFDPKRWINAALESRHPQDPLDRFLSDLEENLRSASEKISDSLERESSD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV RLR+DA+ LRS+VSSILQKL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLAVRDVARLREDAIQLRSAVSSILQKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MMVDL +FSDEKFD K+WIN A +SRHPQD L+KHLVDLEMKLQ+ SEEI+ SLEE SA+
Sbjct  1    MMVDLGAFSDEKFDAKKWINMAVKSRHPQDALEKHLVDLEMKLQLMSEEISASLEEQSAA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A+ RVPRATRDVIR+RDDA+SLRSS+SSIL K+++AEGS+A+S+A LAKVDTVK RMEAA
Sbjct  61   AILRVPRATRDVIRIRDDAVSLRSSISSILGKIKQAEGSAADSIAALAKVDTVKFRMEAA  120

Query  406  YETLQDAAGLT  438
            Y+TLQDAAGLT
Sbjct  121  YKTLQDAAGLT  131



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM+DL+SF D+KF  K W+N AC++RHP D LDK+L DLE+KLQ+ +E IA SLEE SA 
Sbjct  1    MMLDLASFGDDKFHAKSWVNAACKARHPDDSLDKYLGDLEIKLQLMAENIAASLEEQSAQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVPRA+RDV R+RDDALSLRS+VS++LQKL++AEG+SAESVA LA+VD VK+RMEAA
Sbjct  61   ALLRVPRASRDVFRVRDDALSLRSTVSAVLQKLQQAEGTSAESVAALARVDAVKQRMEAA  120

Query  406  YETL-QDAAGL  435
            +ETL QDAAGL
Sbjct  121  HETLQQDAAGL  131



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +++DL  FS+E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +++DL  FS+E FDPK+WIN A +SRHPQDPL++ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALESRHPQDPLERFLSDLEENLRAASEKIADALERESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPVACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VDL  FS+E FDPK+WIN A +SRHPQDP+D+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSEESFDPKRWINAALESRHPQDPIDRFLSDLEENLRSASEKISDSLERESSD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV RLR+DA+ LRS+V+SILQKL+KAEG+SAE +A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPAAVRDVARLREDAIQLRSAVNSILQKLKKAEGTSAEHIAALAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 5/130 (4%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M+DL SFS+  FDPK+WIN AC SRH Q     HL+DLEMKLQM SEEI+ SLEE S++A
Sbjct  3    MIDLVSFSNSNFDPKKWINTACNSRHSQ-----HLIDLEMKLQMLSEEISASLEEQSSAA  57

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L RVPRATRDVI LRDDA SL S+VS IL  L+K  GSSAES+A LAKVD VK+RME AY
Sbjct  58   LLRVPRATRDVICLRDDAGSLCSAVSVILHNLQKRNGSSAESIAALAKVDVVKQRMEVAY  117

Query  409  ETLQDAAGLT  438
            ETLQDAAGLT
Sbjct  118  ETLQDAAGLT  127



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VDL+ F+DE FDPK+WIN A  SRHPQDP+D+++ DLE  L+ ++E IA +LE  S  
Sbjct  2    VVVDLTEFADEAFDPKRWINAALDSRHPQDPIDRYISDLEENLRASAENIADALERESTD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRD+A+SLR+ VS ILQKL KA+GSSAE+++ +AK+D VK+RME+A
Sbjct  62   ALRRVPVAVRDVLRLRDEAISLRAVVSGILQKLNKADGSSAEAISAIAKIDVVKKRMESA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  121  RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSS  300
            RHP+DP++KHL DLEMKLQ+ SEEIA SL+E SA+AL RVPRA+RDVIR+RDDA++LRS+
Sbjct  1    RHPEDPVEKHLGDLEMKLQVMSEEIASSLDEQSAAALLRVPRASRDVIRVRDDAIALRSA  60

Query  301  VSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLT  438
            VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAAYETLQDAAGLT
Sbjct  61   VSGILQKLKKAEGSSAESIAALARVDTVKQRMEAAYETLQDAAGLT  106



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +++DL  F +E FD K+WINGA +SRHPQDPLD +L DLE  L+ AS++IA +L+  SA 
Sbjct  2    VVLDLGEFGEEGFDAKRWINGALESRHPQDPLDHYLADLEESLRSASDKIADALDRDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            +L R+P A RD++RLRDDA +LR  VS++L  L +AEG+SAES+AT+A++DTVKRRMEAA
Sbjct  62   SLRRLPLACRDLLRLRDDAHALRHLVSALLTNLAQAEGTSAESIATIARIDTVKRRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            MVD+++F  E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGQEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L R+PRA RDV RL DDALSLRS+VS +L KLR AEG SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAEGLSAGSVAALSRVDLVKQRMEAAH  120

Query  409  ETLQDAAGL  435
            +TL+DAAGL
Sbjct  121  KTLKDAAGL  129



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VDL  F++E FDPK+WIN + ++RHPQDPLD+++ DLE  L+ ++E IA +LE+ SA 
Sbjct  2    VVVDLGEFAEEGFDPKRWINASLEARHPQDPLDRYISDLEESLRSSAENIADTLEKESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRD+A +LRS VSSIL KL+KA  +S+ESV  L+++D VKRRMEAA
Sbjct  62   ALRRVPLAVRDVLRLRDEAHALRSVVSSILLKLKKAGETSSESVEALSRIDAVKRRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            MVD+++F +E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGEEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L R+PRA RDV RL DDALSLRS+VS +L KLR AE  SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAESLSAGSVAALSRVDLVKQRMEAAH  120

Query  409  ETLQDAAGL  435
            +TL+DAAGL
Sbjct  121  KTLKDAAGL  129



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YATLQDAAGL  131



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YATLQDAAGL  131



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YATLQDAAGL  131



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YATLQDAAGL  131



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YATLQDAAGL  131



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD+  F +E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ++++I+ +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRASADKISDALDRESAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLSLNKAEGTSAESIAAIAKIDIVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            YETLQDAAGLT
Sbjct  122  YETLQDAAGLT  132



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  DKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQK  321
            DKHL DLEMKLQ+ SEEIA SL+E S +AL RVPR+TRDV+RLRDDA SLRS+V  ILQ+
Sbjct  1    DKHLADLEMKLQLLSEEIAASLDEQSQAALLRVPRSTRDVVRLRDDASSLRSAVLLILQR  60

Query  322  LRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLT  438
            L+KAEGSSAES+  LA++D VK+RMEAAYETLQDAAGLT
Sbjct  61   LKKAEGSSAESITALAEIDMVKQRMEAAYETLQDAAGLT  99



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+E+ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAAEDAAAALERDSGD  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLNLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  122  YTTLQDAAGL  131



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +++DLS+F DE+FD K+WIN           +D+H  DLE  L  A + I+  L + ++ 
Sbjct  2    VVLDLSAFDDERFDAKRWINTQDPPSMASSAMDRHFSDLEESLHEAFDRISADLSKRTSE  61

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A+  VP A RDV RLRD+ALSLRSSVSSIL KL++AEGS+AES+A LAK+DTVK+RMEAA
Sbjct  62   AMLSVPHAARDVARLRDEALSLRSSVSSILSKLKQAEGSAAESIAVLAKIDTVKQRMEAA  121

Query  406  YETLQDAAGLT  438
            + TLQ+AAGLT
Sbjct  122  HTTLQEAAGLT  132



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M + ++ F D  FD K W+N AC      + ++K L ++EMKLQ+A+E+I+++LEE S +
Sbjct  1    MSISMADFDDPSFDVKPWVNAACAGCPDDESVEKFLAEVEMKLQLAAEDISLALEEQSNA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
             L+R+PRA  ++ R+  D  +L++ V  IL++L  AEGSS ESV  L +VD VK RMEAA
Sbjct  61   GLNRIPRAVAEIDRVEHDTKALQTRVQGILKRLNDAEGSSRESVRRLTRVDAVKGRMEAA  120

Query  406  YETLQDAAGL  435
             +TL++AAGL
Sbjct  121  RDTLREAAGL  130



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 11/141 (8%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M DL++FSD  FDPK +IN AC  +   +PL++ L +LEMKL +++E++ + L++ S  A
Sbjct  1    MTDLNAFSDAAFDPKLFINQACTGKTGDEPLERFLAELEMKLHLSAEDVGLYLQDHSGRA  60

Query  229  LHRVPRATRDVIRLR----------DDALSLRSSVSSILQKLRKA-EGSSAESVATLAKV  375
            + R+P A ++++R++          DD  +LR S ++ L++L  A  G +A  V  L  V
Sbjct  61   MQRIPAAAKELLRIKVRVRLADRNSDDVATLRGSAAAALKQLEDAGSGQAAAVVGQLQAV  120

Query  376  DTVKRRMEAAYETLQDAAGLT  438
            DTVKRRME A  TL++AAGL+
Sbjct  121  DTVKRRMEDACSTLKEAAGLS  141



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            M  + + FSD  FD K W+N AC      + ++K+L ++EMKLQ+ +E+I+++LEE S +
Sbjct  1    MSFNPAEFSDANFDVKAWVNSACAGCPRGESMEKYLSEVEMKLQLVAEDISLALEEQSVA  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
             L R+PRA  ++ R+  ++ +L++ ++ IL++L +AE  S  SV  L  +D VK RME  
Sbjct  61   GLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASVNLLRDIDAVKGRMELT  120

Query  406  YETLQDAAGL  435
             +TL +AAGL
Sbjct  121  RDTLAEAAGL  130



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 75/130 (58%), Gaps = 35/130 (27%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE     
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALE-----  56

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
                           RD A               +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  57   ---------------RDSA---------------EAEGSSAESITALARIDTVKQRMEAA  86

Query  406  YETLQDAAGL  435
            Y TLQDAAGL
Sbjct  87   YATLQDAAGL  96



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +1

Query  55   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  234
            DL++F ++ F+PK WIN AC ++  ++ L++ L DLE++L +A+E+I  +LE  S  AL 
Sbjct  6    DLAAFQEDSFEPKNWINAACDNKPSEESLERFLTDLELRLHLAAEDIDAALEIDSTRALQ  65

Query  235  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  414
            R+P A ++V  +R D   L++ VS  L  +  A  ++  +VA + +++ VK RMEAA  T
Sbjct  66   RIPAAVQEVSHVRGDVTGLKADVSRGLGTVSAAASAATGNVALIVELERVKNRMEAACST  125

Query  415  LQDAAGLT  438
            L++A  L+
Sbjct  126  LKEATELS  133



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            M D++ F+++ FDP  WIN AC SR  ++PL+K L +LEM+LQ+++E+I  +L + SA A
Sbjct  1    MADVADFAEDTFDPITWINQACGSRPVEEPLEKFLAELEMRLQLSAEDIEATLSDNSAQA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            + R+P A +++ RL+ D   ++  V  + Q +++    +  SVA ++++  VK  ME+A 
Sbjct  61   MRRIPFAIQEIYRLQGDIQGMQDQVQVMAQTVQRDATEAQSSVAHISELHRVKANMESAC  120

Query  409  ETLQDAAGLT  438
             +L+ A  L+
Sbjct  121  NSLKQATELS  130



>ref|XP_001628559.1| predicted protein [Nematostella vectensis]
 gb|EDO36496.1| predicted protein [Nematostella vectensis]
Length=713

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D S FS++ FD K+W+N A ++R  + P+D H   L MKLQ+  +E+  +LEE S  A+
Sbjct  1    MDFSKFSNDNFDVKEWVNSALRARDDKIPVDAHASTLVMKLQLFIQEVNNALEETSVQAV  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
            + +PR  R++  ++ +A  LR  +  + + ++K E ++A+S+  L ++DTVK  M+AA +
Sbjct  61   NNIPRVVREIDNVQHEASLLREQMHMVKEDIKKVEENTAQSMKMLMELDTVKSHMQAASQ  120

Query  412  TLQDAAGLT  438
             LQ+A   T
Sbjct  121  GLQEADNWT  129



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +1

Query  46   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            MM D   F  + FD  +WIN  C++R    P+++ L DLE++ Q+ SE+ A +LEE S  
Sbjct  16   MMRD---FESDGFDRARWINERCRARG-DVPVERFLSDLELQTQLVSEDAARALEERSRE  71

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            A  RVPRATR++ R+     +LR    ++L +L + E  S  SV  L ++D  KRRME+A
Sbjct  72   ATSRVPRATREIERVERRVEALREETRAMLTRLDEVEEVSRASVDALRQLDAAKRRMESA  131

Query  406  YETLQDAAGL  435
             ETLQ+  GL
Sbjct  132  KETLQETNGL  141



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +1

Query  43   KMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            K   D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S 
Sbjct  24   KYFQDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQ  83

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
            S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ 
Sbjct  84   SVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQT  143

Query  403  AYETLQDAAGLT  438
            A + L +A   T
Sbjct  144  AKQGLHEADNWT  155



>ref|XP_007903980.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Callorhinchus milii]
Length=687

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  406  YETLQDA  426
             + LQ+A
Sbjct  121  ADALQEA  127



>ref|XP_007903979.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Callorhinchus milii]
Length=766

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  406  YETLQDA  426
             + LQ+A
Sbjct  121  ADALQEA  127



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  34   DPGKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEE  213
            D   +M D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE
Sbjct  7    DGAALMQDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEE  66

Query  214  LSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRR  393
             S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  
Sbjct  67   TSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTE  126

Query  394  MEAAYETLQDAAGLT  438
            ++ A + L +A   T
Sbjct  127  LQTAKQGLHEADNWT  141



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 76/132 (58%), Gaps = 3/132 (2%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGA--CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            M+D S F D  FD K W+N A   Q   P+   D H   L MKLQ+  +E+  SLEE S 
Sbjct  1    MMDFSKFLDANFDVKDWVNAAFKAQKDSPEQK-DAHAATLVMKLQLFIQEVNNSLEETSQ  59

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT+K RM+A
Sbjct  60   QALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDTIKSRMKA  119

Query  403  AYETLQDAAGLT  438
            A + LQ+A   T
Sbjct  120  ASDALQEADNWT  131



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  412  TLQDA  426
             L +A
Sbjct  121  GLHEA  125



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = +1

Query  40   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLE  210
            GK+ +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +E
Sbjct  17   GKLKMDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIE  74

Query  211  ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  390
            E S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K 
Sbjct  75   ETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKS  134

Query  391  RMEAAYETLQDAAGLT  438
            RM +A E L++A   T
Sbjct  135  RMTSAAEALREADNWT  150



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            ALH +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALHNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQ  120

Query  412  TLQDA  426
             L +A
Sbjct  121  GLHEA  125



>emb|CAG04322.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K+W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRMVQKEAPGKADGHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+++FSD+ F+ K WIN   +S   Q+  D  +  L MKLQ+  +++  +LE+ S   L
Sbjct  1    MDVAAFSDDNFEVKNWINKTFKSAEAQENRDAFVSSLVMKLQLYVQQVNSALEDTSQQVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L  +AL LR  + S+ Q++ K E  +A+S+ TL ++D +K  ++AA E
Sbjct  61   QSLPRVMRDTEILHQEALLLRDKMHSVKQEIAKVEQDTAQSMKTLERIDRIKTELQAAKE  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  ALHEADNWT  129



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = +1

Query  40   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELS  219
            G+ + D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S
Sbjct  25   GEEVRDVSAFSEDTFDVKDWINKTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETS  84

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
             S L  +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D +K  ++
Sbjct  85   QSVLSSLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQ  144

Query  400  AAYETLQDA  426
            AA + L +A
Sbjct  145  AAKQGLHEA  153



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDNFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVSKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEAFFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 76/124 (61%), Gaps = 0/124 (0%)
 Frame = +1

Query  55   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  234
            D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  50   DVSAFSEDIFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  109

Query  235  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  414
             +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A + 
Sbjct  110  SLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQG  169

Query  415  LQDA  426
            L +A
Sbjct  170  LHEA  173



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>emb|CBN81326.1| Conserved oligomeric Golgi complex subunit 7 [Dicentrarchus labrax]
Length=445

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K+W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FSD+ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSDDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDRIKTELQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  E F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFEVKRWVNGAFRAVQQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D++FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDEFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = +1

Query  55   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  234
            D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  131  DVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  190

Query  235  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  414
             +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A + 
Sbjct  191  SLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQG  250

Query  415  LQDAAGLT  438
            L +A   T
Sbjct  251  LHEADNWT  258



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+ +FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVGAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDRIKTELQTAKQ  120

Query  412  TLQDAAGLT  438
             L +A   T
Sbjct  121  GLHEADNWT  129



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNSIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 76/125 (61%), Gaps = 0/125 (0%)
 Frame = +1

Query  64   SFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVP  243
            +F ++ FDP  WIN AC ++   +PL+K L +LEM+LQ+ +E+I  +L + SA A+ R+P
Sbjct  8    AFGEDGFDPISWINNACNNKATDEPLEKFLAELEMRLQLNAEDIEATLSDNSAQAMRRIP  67

Query  244  RATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQD  423
             A +++ RL+ D   ++  V  +   +++    +  SV  ++++  VK  ME A  +L++
Sbjct  68   FAIQEIYRLQGDIQGMQDQVQVLAGSVQRDATDARGSVEHISQLHLVKANMENACNSLKE  127

Query  424  AAGLT  438
            A  L+
Sbjct  128  ATELS  132



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  + F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLADDFEVKRWVNGAFRAVQQQDAPSKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + FD K W+NGA +    + P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLADDFDVKDWVNGAFKVAQQEAPGRADAHAATLVMKLQLFIQEVNNSIEESSIQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RD+  L+ +A  L+  ++ + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDIEALKQEASFLKDQMTMVKEDIKKFEQDTLQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 80/132 (61%), Gaps = 5/132 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +EE S 
Sbjct  1    MDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIEETSQ  58

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K RM +
Sbjct  59   QAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKSRMTS  118

Query  403  AYETLQDAAGLT  438
            A E L++A   T
Sbjct  119  AAEALREADNWT  130



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K+WINGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFKAVPKEAPGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_003230252.2| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Anolis carolinensis]
Length=768

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F +E F+ K W+NGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLEEDFEVKSWVNGAFRAMQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSQQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQSMPRVLREVEALKQEAAFLKEQMVLVREDIKKLEQDTAQSMQVLVQLDQVKSRMQMA  120

Query  406  YETLQDA  426
             ++LQ+A
Sbjct  121  ADSLQEA  127



>ref|XP_006825808.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Saccoglossus kowalevskii]
Length=207

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (57%), Gaps = 7/132 (5%)
 Frame = +1

Query  55   DLSSFSDEKFDPKQWINGACQSRH--PQ--DPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            D S F D+ FD K+W+N A +++   PQ  D L   LV    KLQ+  +E+  SLEE S 
Sbjct  10   DFSKFLDDNFDVKEWVNAAFRTQRDTPQQKDALASTLV---TKLQLFIQEVNNSLEETSQ  66

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL   PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D +K RM++
Sbjct  67   QALQNFPRVLRDVEAVRQEAAFLQEQMQMVKEDIKKVEQDTAQSMQMLLELDVIKSRMQS  126

Query  403  AYETLQDAAGLT  438
            A   L++A   T
Sbjct  127  ASSALKEADNWT  138



>ref|XP_002128341.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ciona 
intestinalis]
Length=765

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 73/125 (58%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D S FSD+ FD K+W+NG  +S+  +   + +   L  KLQ   +E+  SLEE+S  A+
Sbjct  1    MDFSKFSDDNFDVKEWVNGVFRSQKDEQQKEAYTATLVTKLQRYIQEVNRSLEEISQQAV  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RDV  L+ +A  L   +  + +++R  E  ++ S+  L K+D+V+ R+E A  
Sbjct  61   GNLPRVLRDVETLKKEATFLWQQMQQVKEEIRSVEQRTSHSMEVLVKIDSVRSRVEQASA  120

Query  412  TLQDA  426
             L++A
Sbjct  121  ALKEA  125



>ref|XP_008536012.1| PREDICTED: conserved oligomeric Golgi complex subunit 7, partial 
[Equus przewalskii]
Length=201

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQ--SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  E FD K+WIN A +  S+      D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAGSKEAAGKADGHAATLVMKLQLFIQEVNHAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010568819.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X5 [Haliaeetus leucocephalus]
Length=639

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010568818.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Haliaeetus leucocephalus]
Length=671

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_006027196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Alligator 
sinensis]
Length=769

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  SESLQEA  127



>ref|XP_010568816.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Haliaeetus leucocephalus]
Length=728

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  49   MVDLSSFSDEKFDPKQWINGACQS-RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            + D S FSD  FD K+W+N A +S + P   LD H   L MKLQ+  +E   +LEE S  
Sbjct  6    VCDFSRFSDSDFDVKKWVNAALRSNKDPNVALDAHASTLVMKLQLYIQEANNTLEEESQQ  65

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
             +  +PR  R++  +  +   L+  ++S+   + K E  ++ES+  L ++D++K RM+AA
Sbjct  66   MVQNLPRVLREIEGVYKETTLLKDQMNSVKNDIEKVEIETSESMKMLVELDSIKSRMQAA  125

Query  406  YETLQDA  426
               +Q+A
Sbjct  126  SNVIQEA  132



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM  A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMHLA  120

Query  406  YETLQDA  426
             + LQ+A
Sbjct  121  ADALQEA  127



>ref|XP_006268482.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Alligator mississippiensis]
Length=771

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_009665180.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Struthio camelus australis]
Length=644

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_003761800.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sarcophilus 
harrisii]
Length=655

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K+WINGA ++  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFRAAPKEASGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010568814.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Haliaeetus leucocephalus]
Length=769

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K WIN A ++  P+D +    D H  +L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFKAG-PKDGVAGKADGHAANLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|NP_001085832.1| component of oligomeric golgi complex 7 [Xenopus laevis]
 gb|AAH73403.1| MGC80865 protein [Xenopus laevis]
Length=768

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL--DKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K+W+N A +S     P   D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKEWVNAAFKSVQKDAPAKADAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMHVLVEMDKVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>gb|KFV72508.1| Conserved oligomeric Golgi complex subunit 7, partial [Struthio 
camelus australis]
Length=768

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_009665174.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Struthio camelus australis]
Length=769

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|NP_001264493.1| conserved oligomeric Golgi complex subunit 7 [Gallus gallus]
Length=769

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D+S F  + F+ K W+N A ++     P   D H   L MKLQ+  +E+   +EE S  
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQQDAPGQADAHASTLVMKLQVFIQEVNNVVEEASQQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|NP_001070861.1| conserved oligomeric Golgi complex subunit 7 [Danio rerio]
 gb|AAI24681.1| Component of oligomeric golgi complex 7 [Danio rerio]
 gb|AAI24605.1| Component of oligomeric golgi complex 7 [Danio rerio]
Length=767

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + FD K W+NGA +      P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLADDFDVKDWVNGAFKVAQKDAPGKADAHASTLVMKLQLFIQEVNNSIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDIEALKQEASFLKDQMILVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E LQ+A
Sbjct  121  AEALQEA  127



>ref|XP_005054658.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Ficedula albicollis]
Length=769

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 1/126 (1%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAA  120

Query  409  ETLQDA  426
            + LQ+A
Sbjct  121  DALQEA  126



>ref|NP_001015714.1| component of oligomeric golgi complex 7 [Xenopus (Silurana) tropicalis]
 gb|AAH89645.1| MGC107838 protein [Xenopus (Silurana) tropicalis]
Length=768

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A +S     P  +D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKDWVNAAFKSVQKDAPAKVDAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLA  120

Query  406  YETLQDA  426
             ++LQ+A
Sbjct  121  ADSLQEA  127



>ref|XP_010390549.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Corvus 
cornix cornix]
Length=769

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_005523167.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pseudopodoces 
humilis]
Length=769

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HLALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>gb|KGL78321.1| Conserved oligomeric Golgi complex subunit 7, partial [Tinamus 
guttatus]
Length=752

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R++  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRELEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D S F DE FD K+W+N A ++       D++   L MKLQM  +E+   +EE    ++
Sbjct  1    MDYSKFLDESFDVKEWVNAAFRANKDSSQ-DQYATTLVMKLQMFIQEVNNLIEESCLQSV  59

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
            + +PR  R++  L+ +A+ L+  +  I   ++K E  +++S+ TL K+DTVK RM+ A E
Sbjct  60   NNLPRVMRELEALKQEAVLLQDQMKMIKFDIQKVEQDTSQSMLTLLKLDTVKTRMKDASE  119

Query  412  TLQDAAGLT  438
             LQ+A   T
Sbjct  120  ALQEADNWT  128



>ref|XP_009565762.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Cuculus canorus]
Length=768

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  E F+ K W+N A ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSEDFEVKGWVNAAFRAVQHDGPAKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEVIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 1/126 (1%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  228
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDVPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  229  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  408
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAS  120

Query  409  ETLQDA  426
            + LQ+A
Sbjct  121  DALQEA  126



>ref|XP_009089982.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Serinus 
canaria]
Length=769

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010214546.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Tinamus guttatus]
Length=768

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R++  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRELEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_974190.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tribolium 
castaneum]
Length=726

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FSD+ FD K WIN   ++   QD  + + + L MKLQ+  +++  +LE+ S   L
Sbjct  1    MDISAFSDDNFDTKAWINDVLKNAETQDKKENYTMSLVMKLQLCVQQVNSALEDTSQQIL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT+K  +  A +
Sbjct  61   MSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDTIKNELNMAKQ  120

Query  412  TLQDAAGLT  438
             L ++   T
Sbjct  121  GLHESDNWT  129



>ref|XP_009893067.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Charadrius 
vociferus]
 gb|KGL86030.1| Conserved oligomeric Golgi complex subunit 7 [Charadrius vociferus]
Length=769

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_010299541.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Balearica 
regulorum gibbericeps]
 gb|KFO10285.1| Conserved oligomeric Golgi complex subunit 7 [Balearica regulorum 
gibbericeps]
Length=769

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_005054657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Ficedula albicollis]
Length=776

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_008312851.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cynoglossus 
semilaevis]
Length=769

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGA---CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  + FD K+W+NGA    Q   P  P D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLGDDFDVKEWVNGAFKVVQKDVPGKP-DTHAATLVMKLQLFIQEVNNAIEESSN  59

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  RDV  ++ +A  L+  +  + + ++K E  +  S+  L ++D +K RM+ 
Sbjct  60   QALQNMPRVLRDVDAVKQEASFLKEQMVLVKEDIQKFEQDTVRSMQVLVEIDQIKSRMQV  119

Query  403  AYETLQDA  426
            A + LQ+A
Sbjct  120  AADALQEA  127



>ref|XP_010184345.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesitornis 
unicolor]
 gb|KFQ27417.1| Conserved oligomeric Golgi complex subunit 7 [Mesitornis unicolor]
Length=769

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 76/125 (61%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  231
            +D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L
Sbjct  1    MDVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVL  60

Query  232  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  411
              +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A +
Sbjct  61   SSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQ  120

Query  412  TLQDA  426
            +L +A
Sbjct  121  SLHEA  125



>ref|XP_005505761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Columba 
livia]
Length=769

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 76/132 (58%), Gaps = 5/132 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F D+ FD K+W+N A   R+ +D     D++   L MKLQM  +E+   LEE S 
Sbjct  1    MDYSKFLDDSFDAKEWVNAA--FRNHKDTAVSKDQYATTLVMKLQMFIQEVNNILEEASQ  58

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  R++  +R +A  L+  +  + + ++K E S+A+S+  L K+D +K RM+ 
Sbjct  59   QALQNLPRVMREIDAVRQEASLLQDQMRMVKEDIQKVEQSTAQSMQVLLKLDGIKGRMKT  118

Query  403  AYETLQDAAGLT  438
              E L++A   T
Sbjct  119  TAEALKEADNWT  130



>ref|XP_008488587.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Calypte 
anna]
Length=769

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_005229099.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Falco 
peregrinus]
Length=769

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 75/128 (59%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  + FD K+WIN A ++   +  +   D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAGPKEAAVGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>gb|KFO95573.1| Conserved oligomeric Golgi complex subunit 7, partial [Calypte 
anna]
Length=768

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  405
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  406  YETLQDA  426
             E+LQ+A
Sbjct  121  AESLQEA  127



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 68/117 (58%), Gaps = 2/117 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  225
            +D S F D+ FD K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFDVKDWVNGAFKTVPKDAPGKVDGHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  226  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRM  396
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMILVEEDIKKFEQDTAQSMQVLVEIDQVKARM  117



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  55   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  234
            D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L 
Sbjct  16   DVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVLS  75

Query  235  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  414
             +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A ++
Sbjct  76   SLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQS  135

Query  415  LQDA  426
            L +A
Sbjct  136  LHEA  139



>ref|XP_002711891.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryctolagus 
cuniculus]
Length=847

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  78   MDFSKFLADDFDVKEWINAAFKAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  136

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +PR  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  137  HQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  196

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  197  LAAESLQEA  205



>ref|XP_010717801.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Meleagris 
gallopavo]
Length=769

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D+S F  + F+ K W+N A ++   QD     D H   L MKLQ+  +E+   +EE S 
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQ-QDAAGQTDAHASTLVMKLQVFIQEVNNVVEEASQ  59

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ 
Sbjct  60   QALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQL  119

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  120  AAESLQEA  127



>gb|ELW66292.1| Conserved oligomeric Golgi complex subunit 7 [Tupaia chinensis]
Length=981

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 77/133 (58%), Gaps = 5/133 (4%)
 Frame = +1

Query  40   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSL  207
            G   +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++
Sbjct  44   GGAAMDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAV  102

Query  208  EELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVK  387
            EE S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK
Sbjct  103  EETSLQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVK  162

Query  388  RRMEAAYETLQDA  426
             RM+ A E+LQ+A
Sbjct  163  SRMQLAAESLQEA  175



>ref|XP_005656829.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Sus scrofa]
Length=651

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSRFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  ++ + + +RK E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMTLVKEDIRKFEQDTSQSMKVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP----LDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P++     +D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKVDGHAATLVMKLQVFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_003998815.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Felis 
catus]
Length=770

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRT-GPKEATAGTADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_003795774.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
2 [Otolemur garnettii]
Length=684

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_003513853.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
 gb|EGV91994.1| Conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=770

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  I + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKDQMILIKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006730882.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Leptonychotes 
weddellii]
Length=731

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|XP_004778381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004819145.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004020887.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ovis 
aries]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_005323804.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ictidomys 
tridecemlineatus]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P+D      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKDSAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006148372.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tupaia 
chinensis]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004332588.1| PREDICTED: LOW QUALITY PROTEIN: component of oligomeric golgi 
complex 7 [Tursiops truncatus]
Length=685

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_010835502.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bison 
bison bison]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006071244.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bubalus 
bubalis]
Length=768

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_005975366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pantholops 
hodgsonii]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|XP_003795773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
1 [Otolemur garnettii]
Length=772

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_010621761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fukomys 
damarensis]
 gb|KFO33512.1| Conserved oligomeric Golgi complex subunit 7 [Fukomys damarensis]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE+S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEEMS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>gb|EPY74529.1| conserved oligomeric Golgi complex subunit 7-like protein [Camelus 
ferus]
Length=800

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  31   MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  89

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  90   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  149

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  150  LAAESLQEA  158



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_005697660.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Capra 
hircus]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_004691773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Condylura 
cristata]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM 
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMH  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAVESLQEA  128



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  222
            +D S F  + FD K WIN A ++   +     +D H   L MKLQ+  +E+  +LEE S 
Sbjct  1    MDFSKFLADDFDVKDWINTAFRAGSKEAAAAKVDGHAATLVMKLQLFIQEVNHALEETSH  60

Query  223  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  402
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQL  120

Query  403  AYETLQDA  426
            A E+LQ+A
Sbjct  121  AAESLQEA  128



>ref|NP_001076841.1| conserved oligomeric Golgi complex subunit 7 [Bos taurus]
 sp|A2VDR8.1|COG7_BOVIN RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Bos taurus]
 gb|AAI33372.1| COG7 protein [Bos taurus]
 tpg|DAA15508.1| TPA: conserved oligomeric Golgi complex subunit 7 [Bos taurus]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_005598907.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Equus caballus]
Length=748

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVKHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_005656828.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Sus scrofa]
Length=755

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



>ref|XP_007105719.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Physeter 
catodon]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +1

Query  52   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  219
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  220  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  399
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  400  AAYETLQDA  426
             A E+LQ+A
Sbjct  120  LAAESLQEA  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840