BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004E16

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011039915.1|  PREDICTED: eukaryotic translation initiation...    109   6e-27   Populus euphratica
ref|XP_011093891.1|  PREDICTED: eukaryotic translation initiation...    109   6e-27   Sesamum indicum [beniseed]
ref|XP_011078150.1|  PREDICTED: eukaryotic translation initiation...    108   8e-27   Sesamum indicum [beniseed]
ref|XP_006381562.1|  Eukaryotic translation initiation factor 3 s...    107   3e-26   Populus trichocarpa [western balsam poplar]
gb|EYU25804.1|  hypothetical protein MIMGU_mgv1a012800mg                105   4e-26   Erythranthe guttata [common monkey flower]
gb|EYU25802.1|  hypothetical protein MIMGU_mgv1a012800mg                105   1e-25   Erythranthe guttata [common monkey flower]
gb|EYU28299.1|  hypothetical protein MIMGU_mgv1a0225571mg               102   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_009786273.1|  PREDICTED: eukaryotic translation initiation...    105   2e-25   Nicotiana sylvestris
gb|KJB54543.1|  hypothetical protein B456_009G038100                    105   3e-25   Gossypium raimondii
ref|XP_006353763.1|  PREDICTED: eukaryotic translation initiation...    104   5e-25   Solanum tuberosum [potatoes]
ref|XP_009618431.1|  PREDICTED: eukaryotic translation initiation...    104   5e-25   Nicotiana tomentosiformis
gb|KHG02857.1|  Eukaryotic translation initiation factor 3 subunit K    104   7e-25   Gossypium arboreum [tree cotton]
gb|KDP33976.1|  hypothetical protein JCGZ_07547                         103   8e-25   Jatropha curcas
ref|XP_010273905.1|  PREDICTED: eukaryotic translation initiation...    102   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007012542.1|  Eukaryotic translation initiation factor 3 s...    102   2e-24   
ref|XP_011010966.1|  PREDICTED: eukaryotic translation initiation...    102   2e-24   Populus euphratica
ref|XP_002516208.1|  Eukaryotic translation initiation factor 3 s...    102   2e-24   Ricinus communis
ref|XP_011010964.1|  PREDICTED: eukaryotic translation initiation...    102   2e-24   Populus euphratica
ref|XP_004243678.1|  PREDICTED: eukaryotic translation initiation...    102   3e-24   Solanum lycopersicum
ref|XP_008391834.1|  PREDICTED: eukaryotic translation initiation...    102   3e-24   
ref|XP_009369722.1|  PREDICTED: eukaryotic translation initiation...    102   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_006600127.1|  PREDICTED: uncharacterized protein LOC100306...    102   3e-24   
ref|XP_009343352.1|  PREDICTED: eukaryotic translation initiation...    102   3e-24   Pyrus x bretschneideri [bai li]
gb|AGL09429.1|  eukaryotic initiation factor 3 subunit K                102   3e-24   Hydnora visseri
ref|XP_006452893.1|  hypothetical protein CICLE_v10009369mg             101   6e-24   Citrus clementina [clementine]
ref|XP_008337806.1|  PREDICTED: eukaryotic translation initiation...    100   8e-24   Malus domestica [apple tree]
ref|XP_010526137.1|  PREDICTED: eukaryotic translation initiation...    100   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_009359690.1|  PREDICTED: eukaryotic translation initiation...    100   8e-24   Pyrus x bretschneideri [bai li]
ref|XP_009123672.1|  PREDICTED: eukaryotic translation initiation...    100   8e-24   Brassica rapa
ref|XP_006284473.1|  hypothetical protein CARUB_v10005658mg             100   8e-24   Capsella rubella
emb|CDY28288.1|  BnaC03g66710D                                          100   9e-24   Brassica napus [oilseed rape]
ref|XP_009388189.1|  PREDICTED: eukaryotic translation initiation...    100   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144055.1|  PREDICTED: eukaryotic translation initiation...    100   1e-23   Cucumis sativus [cucumbers]
ref|XP_008450972.1|  PREDICTED: eukaryotic translation initiation...    100   1e-23   Cucumis melo [Oriental melon]
ref|XP_006412374.1|  hypothetical protein EUTSA_v10026154mg             100   1e-23   Eutrema salsugineum [saltwater cress]
emb|CDP03033.1|  unnamed protein product                                100   1e-23   Coffea canephora [robusta coffee]
ref|XP_009414831.1|  PREDICTED: eukaryotic translation initiation...    100   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235156.1|  uncharacterized protein LOC100306445             99.8    1e-23   
ref|XP_008783088.1|  PREDICTED: eukaryotic translation initiation...    100   1e-23   Phoenix dactylifera
ref|XP_006838090.1|  hypothetical protein AMTR_s00106p00025830          100   2e-23   Amborella trichopoda
gb|KFK29935.1|  hypothetical protein AALP_AA7G197500                  99.8    2e-23   Arabis alpina [alpine rockcress]
ref|XP_009108810.1|  PREDICTED: eukaryotic translation initiation...  99.4    3e-23   Brassica rapa
ref|XP_010049324.1|  PREDICTED: eukaryotic translation initiation...  99.0    4e-23   Eucalyptus grandis [rose gum]
ref|XP_010937279.1|  PREDICTED: eukaryotic translation initiation...  99.0    5e-23   Elaeis guineensis
ref|XP_004287671.1|  PREDICTED: eukaryotic translation initiation...  99.0    6e-23   Fragaria vesca subsp. vesca
gb|AFK42050.1|  unknown                                               98.6    6e-23   Lotus japonicus
ref|XP_010437785.1|  PREDICTED: eukaryotic translation initiation...  98.6    7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002324723.2|  Eukaryotic translation initiation factor 3 s...  98.6    8e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010447265.1|  PREDICTED: eukaryotic translation initiation...  98.2    8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002867191.1|  hypothetical protein ARALYDRAFT_913095           97.4    2e-22   Arabidopsis lyrata subsp. lyrata
emb|CDX68959.1|  BnaC01g04940D                                        97.1    2e-22   
emb|CDX75342.1|  BnaA01g03600D                                        97.1    2e-22   
emb|CDX72396.1|  BnaC07g44180D                                        97.1    2e-22   
ref|XP_007154541.1|  hypothetical protein PHAVU_003G127300g           97.1    2e-22   Phaseolus vulgaris [French bean]
ref|XP_003542381.1|  PREDICTED: eukaryotic translation initiation...  96.7    3e-22   Glycine max [soybeans]
emb|CDY45034.1|  BnaA08g11850D                                        95.9    6e-22   Brassica napus [oilseed rape]
ref|XP_002274986.1|  PREDICTED: eukaryotic translation initiation...  95.9    6e-22   Vitis vinifera
gb|AFK42537.1|  unknown                                               95.9    7e-22   Lotus japonicus
ref|XP_008242295.1|  PREDICTED: eukaryotic translation initiation...  95.1    1e-21   Prunus mume [ume]
ref|XP_007202515.1|  hypothetical protein PRUPE_ppa010881mg           95.1    1e-21   Prunus persica
emb|CDY46124.1|  BnaA03g52440D                                        98.2    2e-21   Brassica napus [oilseed rape]
ref|XP_003609944.1|  Eukaryotic translation initiation factor 3 s...  94.4    3e-21   Medicago truncatula
gb|AFK49177.1|  unknown                                               94.4    3e-21   Medicago truncatula
ref|XP_009138176.1|  PREDICTED: eukaryotic translation initiation...  94.0    3e-21   Brassica rapa
gb|ACJ83269.1|  unknown                                               92.8    1e-20   Medicago truncatula
ref|XP_010687584.1|  PREDICTED: eukaryotic translation initiation...  91.7    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004508038.1|  PREDICTED: eukaryotic translation initiation...  91.3    4e-20   Cicer arietinum [garbanzo]
gb|AHN93214.1|  eukaryotic translation initiation factor 3 subuni...  88.2    6e-20   Phyllostachys edulis [kikko-chiku]
ref|XP_010107076.1|  Eukaryotic translation initiation factor 3 s...  90.5    7e-20   Morus notabilis
ref|XP_003558656.1|  PREDICTED: eukaryotic translation initiation...  90.1    8e-20   Brachypodium distachyon [annual false brome]
gb|AHN93215.1|  eukaryotic translation initiation factor 3 subuni...  86.7    2e-19   Phyllostachys nidularia [broom bamboo]
ref|XP_006649509.1|  PREDICTED: eukaryotic translation initiation...  89.4    2e-19   Oryza brachyantha
gb|AHN93217.1|  eukaryotic translation initiation factor 3 subuni...  87.0    2e-19   Phyllostachys nigra var. henonis
ref|XP_008658292.1|  PREDICTED: uncharacterized protein LOC100273...  88.6    2e-19   Zea mays [maize]
gb|EMS59325.1|  Eukaryotic translation initiation factor 3 subunit K  88.6    3e-19   Triticum urartu
ref|XP_002465750.1|  hypothetical protein SORBIDRAFT_01g045090        88.6    3e-19   Sorghum bicolor [broomcorn]
ref|NP_001049175.2|  Os03g0182700                                     88.6    4e-19   
gb|EAY88800.1|  hypothetical protein OsI_10273                        88.6    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004985473.1|  PREDICTED: eukaryotic translation initiation...  88.2    4e-19   Setaria italica
ref|NP_001141773.1|  uncharacterized protein LOC100273909             88.2    4e-19   Zea mays [maize]
dbj|BAK07576.1|  predicted protein                                    87.4    9e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25828.1|  Eukaryotic translation initiation factor 3 subunit K  87.0    1e-18   
gb|ABK24382.1|  unknown                                               87.0    1e-18   Picea sitchensis
ref|XP_001752173.1|  predicted protein                                86.7    1e-18   
gb|AGL09428.1|  eukaryotic initiation factor 3 subunit K              85.5    2e-18   Hernandia nymphaeifolia [kayu jambu hutan]
gb|AGL09430.1|  eukaryotic initiation factor 3 subunit K              85.1    2e-18   Xymalos monospora
ref|XP_008664442.1|  PREDICTED: uncharacterized protein LOC100194...  86.3    2e-18   Zea mays [maize]
ref|NP_195051.1|  translation initiation factor 3 subunit K           85.5    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67709.1|  hypothetical protein M569_07065                       84.0    4e-18   Genlisea aurea
gb|AGL09427.1|  eukaryotic initiation factor 3 subunit K              82.8    7e-18   Chloranthus fortunei
ref|XP_001773783.1|  predicted protein                                84.7    1e-17   
ref|XP_002981969.1|  hypothetical protein SELMODRAFT_154794           83.6    2e-17   Selaginella moellendorffii
gb|AHN93216.1|  eukaryotic translation initiation factor 3 subuni...  79.3    7e-17   Phyllostachys nidularia [broom bamboo]
ref|XP_008347893.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  82.8    2e-16   
gb|EYU25803.1|  hypothetical protein MIMGU_mgv1a012800mg              70.1    2e-12   Erythranthe guttata [common monkey flower]
gb|KCW44322.1|  hypothetical protein EUGRSUZ_L022301                  54.3    9e-08   Eucalyptus grandis [rose gum]
ref|XP_001703228.1|  eukaryotic initiation factor                     55.5    2e-07   Chlamydomonas reinhardtii
ref|XP_005184925.1|  PREDICTED: eukaryotic translation initiation...  52.8    3e-06   Musca domestica
ref|XP_002039803.1|  GM15855                                          52.4    3e-06   Drosophila sechellia
ref|NP_611604.1|  CG10306                                             52.4    3e-06   Drosophila melanogaster
gb|AAR09739.1|  similar to Drosophila melanogaster CG10306            51.6    4e-06   Drosophila yakuba
ref|XP_002948062.1|  eukaryotic translation initiation factor 3k      52.0    5e-06   Volvox carteri f. nagariensis
ref|XP_002091493.1|  GE12213                                          52.0    6e-06   Drosophila yakuba
ref|XP_001975094.1|  GG22131                                          51.6    6e-06   Drosophila erecta
ref|XP_001960231.1|  GF13261                                          51.6    7e-06   Drosophila ananassae
ref|XP_011207668.1|  PREDICTED: eukaryotic translation initiation...  51.6    7e-06   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002005683.1|  GI20605                                          51.6    7e-06   Drosophila mojavensis
ref|XP_004530274.1|  PREDICTED: eukaryotic translation initiation...  51.6    8e-06   Ceratitis capitata [medfly]
ref|XP_011178571.1|  PREDICTED: eukaryotic translation initiation...  51.2    8e-06   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_002048935.1|  GJ21045                                          51.2    8e-06   Drosophila virilis
ref|XP_001629066.1|  predicted protein                                51.2    9e-06   Nematostella vectensis
ref|XP_002061063.1|  GK10740                                          51.2    9e-06   Drosophila willistoni
ref|XP_004344531.1|  hypothetical protein CAOG_06910                  51.6    1e-05   Capsaspora owczarzaki ATCC 30864
ref|XP_001360371.1|  GA24496                                          51.2    1e-05   Drosophila pseudoobscura pseudoobscura
ref|XP_009061596.1|  hypothetical protein LOTGIDRAFT_194136           50.8    1e-05   Lottia gigantea
gb|ENN82173.1|  hypothetical protein YQE_01452                        50.1    2e-05   Dendroctonus ponderosae
gb|ENN79693.1|  hypothetical protein YQE_03865                        48.9    2e-05   Dendroctonus ponderosae
ref|XP_001995363.1|  GH22679                                          50.1    2e-05   Drosophila grimshawi
ref|XP_002411753.1|  conserved hypothetical protein                   49.7    3e-05   Ixodes scapularis [blacklegged tick]
gb|ERL91876.1|  hypothetical protein D910_09200                       49.7    3e-05   Dendroctonus ponderosae
gb|AEE63206.1|  unknown                                               49.7    3e-05   Dendroctonus ponderosae
ref|XP_005091207.1|  PREDICTED: eukaryotic translation initiation...  49.7    3e-05   Aplysia californica
ref|XP_002430152.1|  eukaryotic translation initiation factor 3 s...  49.3    5e-05   Pediculus humanus corporis [human body lice]
gb|KDR14617.1|  Eukaryotic translation initiation factor 3 subunit K  48.9    6e-05   Zootermopsis nevadensis
gb|AEB54635.1|  eukaryotic translation initiation factor 3 subuni...  48.9    7e-05   Procambarus clarkii
ref|XP_010777099.1|  PREDICTED: eukaryotic translation initiation...  47.4    7e-05   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001606859.1|  PREDICTED: eukaryotic translation initiation...  48.5    8e-05   Nasonia vitripennis
emb|CDS26409.1|  eukaryotic translation initiation factor 3           49.3    8e-05   Hymenolepis microstoma
gb|KCW44321.1|  hypothetical protein EUGRSUZ_L022302                  48.1    8e-05   Eucalyptus grandis [rose gum]
ref|XP_973326.1|  PREDICTED: eukaryotic translation initiation fa...  48.1    1e-04   Tribolium castaneum [rust-red flour beetle]
gb|ACG40277.1|  eukaryotic translation initiation factor 3 subuni...  47.4    1e-04   Zea mays [maize]
ref|XP_005706651.1|  translation initiation factor                    48.1    1e-04   Galdieria sulphuraria
ref|XP_004776289.1|  PREDICTED: eukaryotic translation initiation...  48.9    1e-04   
gb|ABD65308.1|  eukaryotic translation initiation factor 3 subunit k  46.6    2e-04   Penaeus vannamei [white Pacific shrimp]
gb|ACJ12081.1|  eukaryotic translation initiation factor 3 subuni...  47.8    2e-04   Bombina orientalis [Oriental fire-bellied toad]
emb|CBY09497.1|  unnamed protein product                              47.8    2e-04   Oikopleura dioica
emb|CBY34047.1|  unnamed protein product                              47.8    2e-04   Oikopleura dioica
gb|ACI69664.1|  Eukaryotic translation initiation factor 3 subunit K  47.8    2e-04   Salmo salar
emb|CBY41887.1|  unnamed protein product                              47.8    2e-04   Oikopleura dioica
gb|ACI66950.1|  Eukaryotic translation initiation factor 3 subunit K  47.8    2e-04   Salmo salar
ref|NP_001154130.1|  Eukaryotic translation initiation factor 3 s...  47.8    2e-04   Oncorhynchus mykiss
emb|CDQ67649.1|  unnamed protein product                              47.8    2e-04   Oncorhynchus mykiss
gb|ACI66240.1|  Eukaryotic translation initiation factor 3 subunit K  47.8    2e-04   Salmo salar
gb|ACI69853.1|  Eukaryotic translation initiation factor 3 subunit K  47.8    2e-04   Salmo salar
gb|ACI69427.1|  Eukaryotic translation initiation factor 3 subunit K  47.8    2e-04   Salmo salar
gb|ACI69163.1|  Eukaryotic translation initiation factor 3 subunit K  47.4    2e-04   Salmo salar
ref|XP_011391778.1|  hypothetical protein UMAG_12282                  48.1    2e-04   Ustilago maydis 521
gb|ACI69629.1|  Eukaryotic translation initiation factor 3 subunit K  47.4    2e-04   Salmo salar
gb|ACO07712.1|  Eukaryotic translation initiation factor 3 subuni...  47.4    2e-04   Oncorhynchus mykiss
emb|CAX73642.1|  Eukaryotic translation initiation factor 3 subun...  47.4    3e-04   Schistosoma japonicum
ref|XP_009233510.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  47.4    3e-04   
ref|XP_008467626.1|  PREDICTED: eukaryotic translation initiation...  47.0    3e-04   Diaphorina citri
emb|CAX69707.1|  Eukaryotic translation initiation factor 3 subun...  47.4    3e-04   Schistosoma japonicum
gb|ACO10870.1|  Eukaryotic translation initiation factor 3 subunit K  47.0    3e-04   Caligus rogercresseyi
gb|AFW89456.1|  hypothetical protein ZEAMMB73_226719                  46.6    3e-04   
ref|XP_005062917.1|  PREDICTED: eukaryotic translation initiation...  45.1    4e-04   Ficedula albicollis
ref|XP_011439558.1|  PREDICTED: eukaryotic translation initiation...  46.6    5e-04   Crassostrea gigas
emb|CCF49303.1|  uncharacterized protein UHOR_07720                   47.0    5e-04   Ustilago hordei
gb|EAW56805.1|  eukaryotic translation initiation factor 3, subun...  45.4    5e-04   Homo sapiens [man]
emb|CBQ69794.1|  conserved hypothetical protein                       47.0    5e-04   Sporisorium reilianum SRZ2
emb|CDI55871.1|  related to eIF3k-translation initiation factor 3...  47.0    6e-04   Melanopsichium pennsylvanicum 4
gb|ELV13963.1|  Eukaryotic translation initiation factor 3 subunit K  46.2    6e-04   Tupaia chinensis
ref|XP_007994893.1|  PREDICTED: eukaryotic translation initiation...  45.8    6e-04   Chlorocebus sabaeus
dbj|GAK66745.1|  ARM repeat-containing protein                        46.6    6e-04   Moesziomyces antarcticus
ref|XP_002829216.3|  PREDICTED: eukaryotic translation initiation...  45.4    6e-04   
gb|ACI67742.1|  Eukaryotic translation initiation factor 3 subunit K  46.2    6e-04   Salmo salar
ref|XP_007534514.1|  PREDICTED: eukaryotic translation initiation...  45.8    6e-04   
gb|ETS60503.1|  hypothetical protein PaG_05347                        46.6    6e-04   Moesziomyces aphidis DSM 70725
ref|NP_001287921.1|  eukaryotic translation initiation factor 3 s...  45.8    7e-04   Homo sapiens [man]
ref|XP_007129965.1|  PREDICTED: eukaryotic translation initiation...  45.4    7e-04   
ref|XP_008303056.1|  PREDICTED: eukaryotic translation initiation...  46.2    7e-04   Stegastes partitus
gb|EST08699.1|  eukaryotic translation initiation factor subunit      46.6    7e-04   Kalmanozyma brasiliensis GHG001
ref|XP_010872208.1|  PREDICTED: eukaryotic translation initiation...  46.2    7e-04   Esox lucius
ref|XP_003368176.1|  eukaryotic translation initiation factor 3 s...  45.8    7e-04   Trichinella spiralis
gb|ERE51832.1|  eukaryotic translation initiation factor 3 subuni...  44.7    7e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_008303057.1|  PREDICTED: eukaryotic translation initiation...  45.8    7e-04   Stegastes partitus
ref|XP_006801333.1|  PREDICTED: eukaryotic translation initiation...  45.4    8e-04   Neolamprologus brichardi [lyretail cichlid]
gb|EFX74786.1|  hypothetical protein DAPPUDRAFT_306983                45.8    8e-04   Daphnia pulex
ref|XP_003968750.1|  PREDICTED: eukaryotic translation initiation...  45.8    8e-04   Takifugu rubripes [tiger puffer]
ref|NP_037366.1|  eukaryotic translation initiation factor 3 subu...  45.8    8e-04   Homo sapiens [man]
ref|XP_010961754.1|  PREDICTED: eukaryotic translation initiation...  45.8    8e-04   Camelus bactrianus [camel]
ref|XP_008544532.1|  PREDICTED: eukaryotic translation initiation...  45.8    8e-04   Microplitis demolitor
gb|AAD40193.1|  HSPC029                                               45.8    8e-04   Homo sapiens [man]
ref|XP_004441546.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   
ref|XP_002762132.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Callithrix jacchus [common marmoset]
ref|XP_003127167.2|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Sus scrofa [pigs]
ref|XP_008628370.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   
ref|XP_008072222.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Carlito syrichta
ref|XP_006871519.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Chrysochloris asiatica
ref|NP_001029661.1|  eukaryotic translation initiation factor 3 s...  45.8    9e-04   Bos taurus [bovine]
ref|XP_010993324.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  45.8    9e-04   Camelus dromedarius [camel]
ref|XP_006196078.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  45.8    9e-04   Camelus ferus
ref|XP_004388196.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Trichechus manatus latirostris
ref|XP_003420815.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Loxodonta africana [African bush elephant]
ref|XP_004441547.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006941361.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Felis catus [cat]
ref|XP_008137858.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Eptesicus fuscus
ref|XP_002711547.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006899758.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004715829.1|  PREDICTED: eukaryotic translation initiation...  45.8    9e-04   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_008686895.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  45.8    0.001   Ursus maritimus [white bear]
ref|XP_003467292.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Cavia porcellus [guinea pig]
ref|XP_004595137.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Ochotona princeps [southern American pika]
gb|EAW56804.1|  eukaryotic translation initiation factor 3, subun...  44.7    0.001   Homo sapiens [man]
ref|XP_006161788.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  45.8    0.001   Tupaia chinensis
gb|ELK12859.1|  Eukaryotic translation initiation factor 3 subunit K  45.8    0.001   Pteropus alecto
ref|NP_082935.1|  eukaryotic translation initiation factor 3 subu...  45.8    0.001   Mus musculus [mouse]
ref|XP_005860680.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   
ref|XP_007068346.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   
ref|XP_004877152.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   
ref|XP_008852140.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Nannospalax galili
ref|XP_004481485.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Dasypus novemcinctus
ref|XP_008986198.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   
ref|XP_004600816.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Sorex araneus [Eurasian shrew]
ref|XP_003796205.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Otolemur garnettii
ref|XP_002925888.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   Ailuropoda melanoleuca
ref|XP_005910211.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   Bos mutus
dbj|BAH14715.1|  unnamed protein product                              45.4    0.001   Homo sapiens [man]
ref|XP_006982045.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   Peromyscus maniculatus bairdii
ref|XP_008986196.1|  PREDICTED: eukaryotic translation initiation...  45.8    0.001   
ref|XP_006228777.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   Rattus norvegicus [brown rat]
ref|XP_006265001.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   
ref|XP_005311518.1|  PREDICTED: eukaryotic translation initiation...  45.4    0.001   Chrysemys picta bellii



>ref|XP_011039915.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Populus euphratica]
Length=235

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 2/66 (3%)
 Frame = +2

Query  86   MGRE--VAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE  V  +++  A+SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLR
Sbjct  1    MGREREVPNKSEKEAISYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLR  60

Query  260  LYQFEP  277
            LYQFEP
Sbjct  61   LYQFEP  66



>ref|XP_011093891.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Sesamum indicum]
Length=237

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAG----QNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            MGRE++     Q Q SA+S+TVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+L+ANLCL
Sbjct  1    MGREMSNSTTNQTQQSAMSHTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLNANLCL  60

Query  254  LRLYQFEP  277
            LRLYQFEP
Sbjct  61   LRLYQFEP  68



>ref|XP_011078150.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Sesamum indicum]
Length=237

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAG----QNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            MGRE++     QNQ S+LS+TVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+L+ANLCL
Sbjct  1    MGREMSNAATNQNQQSSLSHTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLNANLCL  60

Query  254  LRLYQFEP  277
            +RLYQFEP
Sbjct  61   VRLYQFEP  68



>ref|XP_006381562.1| Eukaryotic translation initiation factor 3 subunit 11 family 
protein [Populus trichocarpa]
 gb|ABK95900.1| unknown [Populus trichocarpa]
 gb|ERP59359.1| Eukaryotic translation initiation factor 3 subunit 11 family 
protein [Populus trichocarpa]
Length=235

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 2/66 (3%)
 Frame = +2

Query  86   MGRE--VAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE  V  +++   +SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLR
Sbjct  1    MGREREVPNKSEKEVISYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLR  60

Query  260  LYQFEP  277
            LYQFEP
Sbjct  61   LYQFEP  66



>gb|EYU25804.1| hypothetical protein MIMGU_mgv1a012800mg [Erythranthe guttata]
Length=168

 Score =   105 bits (262),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 6/70 (9%)
 Frame = +2

Query  86   MGREV------AGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANL  247
            MGRE+      A Q Q S  SYTVEQL+ VNPYNPDILPDLENYVNEQVS+QTY+L+ANL
Sbjct  1    MGREITNSAAAANQKQQSTTSYTVEQLVAVNPYNPDILPDLENYVNEQVSTQTYSLNANL  60

Query  248  CLLRLYQFEP  277
            CLLRLYQ EP
Sbjct  61   CLLRLYQVEP  70



>gb|EYU25802.1| hypothetical protein MIMGU_mgv1a012800mg [Erythranthe guttata]
Length=239

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 6/70 (9%)
 Frame = +2

Query  86   MGREV------AGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANL  247
            MGRE+      A Q Q S  SYTVEQL+ VNPYNPDILPDLENYVNEQVS+QTY+L+ANL
Sbjct  1    MGREITNSAAAANQKQQSTTSYTVEQLVAVNPYNPDILPDLENYVNEQVSTQTYSLNANL  60

Query  248  CLLRLYQFEP  277
            CLLRLYQ EP
Sbjct  61   CLLRLYQVEP  70



>gb|EYU28299.1| hypothetical protein MIMGU_mgv1a0225571mg, partial [Erythranthe 
guttata]
Length=120

 Score =   102 bits (254),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  101  AGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            A Q Q S+LSYTVEQL+ VNPYNPDILPD+ENYVNEQVSSQTY+L+ANLCLLRLYQ EP
Sbjct  10   ANQKQQSSLSYTVEQLVAVNPYNPDILPDIENYVNEQVSSQTYSLNANLCLLRLYQVEP  68



>ref|XP_009786273.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Nicotiana sylvestris]
Length=231

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E     Q S L+ TVEQLI VNPYNPDILPDLENYVNEQVS+QTYNLDANLCLLRLY
Sbjct  1    MGKE--ETTQKSQLAVTVEQLIAVNPYNPDILPDLENYVNEQVSTQTYNLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>gb|KJB54543.1| hypothetical protein B456_009G038100 [Gossypium raimondii]
Length=233

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M RE     Q   +SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MVRERETPKQQQQVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_006353763.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Solanum tuberosum]
Length=234

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  104  GQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            G  + S L+ TVEQLI VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP
Sbjct  8    GGAEKSQLAITVEQLIAVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  65



>ref|XP_009618431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K {ECO:0000255|HAMAP-Rule:MF_03010} [Nicotiana tomentosiformis]
Length=231

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
             Q S L+ TVEQLI VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP
Sbjct  7    TQKSQLAVTVEQLIAVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  62



>gb|KHG02857.1| Eukaryotic translation initiation factor 3 subunit K [Gossypium 
arboreum]
Length=271

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M RE     Q   +SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MVRERETPKQQQQVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>gb|KDP33976.1| hypothetical protein JCGZ_07547 [Jatropha curcas]
Length=235

 Score =   103 bits (257),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +2

Query  86   MGREVAGQN--QPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE   Q   Q   +SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLR
Sbjct  1    MGREREPQKLQQQQQVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLR  60

Query  260  LYQFEP  277
            LYQFEP
Sbjct  61   LYQFEP  66



>ref|XP_010273905.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Nelumbo nucifera]
Length=232

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     Q   +SYTVEQL+ +NPYNPDILPDLEN+VNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREREAPKQ-QQVSYTVEQLVALNPYNPDILPDLENFVNEQVSSQTYSLDANLCLLRLY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>ref|XP_007012542.1| Eukaryotic translation initiation factor 3 subunit K isoform 
1 [Theobroma cacao]
 gb|EOY30161.1| Eukaryotic translation initiation factor 3 subunit K isoform 
1 [Theobroma cacao]
Length=235

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +2

Query  86   MGREV--AGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE     Q Q   +SYTVEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLR
Sbjct  1    MGRETPKQQQQQQQQVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLR  60

Query  260  LYQFEP  277
            LYQFEP
Sbjct  61   LYQFEP  66



>ref|XP_011010966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like isoform X2 [Populus euphratica]
Length=236

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  86   MGREVAGQNQPS---ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLL  256
            MGRE     +P     +SYTVEQL+ VNPYNPDILPDLENYVNEQVSS TY+LDANLCLL
Sbjct  1    MGREREAPQRPQQQQEVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSLTYSLDANLCLL  60

Query  257  RLYQFEP  277
            RLYQFEP
Sbjct  61   RLYQFEP  67



>ref|XP_002516208.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF46210.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=236

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  86   MGREVAGQNQPSA---LSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLL  256
            MGRE   Q        +SYTVEQL+ VNPYNPD+LPDLENYVN+QVSSQTY+LDANLCLL
Sbjct  1    MGRERETQKSQQQQQQVSYTVEQLVAVNPYNPDVLPDLENYVNKQVSSQTYSLDANLCLL  60

Query  257  RLYQFEP  277
            RLYQFEP
Sbjct  61   RLYQFEP  67



>ref|XP_011010964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like isoform X1 [Populus euphratica]
 ref|XP_011010965.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like isoform X1 [Populus euphratica]
Length=241

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  86   MGREVAGQNQPS---ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLL  256
            MGRE     +P     +SYTVEQL+ VNPYNPDILPDLENYVNEQVSS TY+LDANLCLL
Sbjct  1    MGREREAPQRPQQQQEVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSLTYSLDANLCLL  60

Query  257  RLYQFEP  277
            RLYQFEP
Sbjct  61   RLYQFEP  67



>ref|XP_004243678.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Solanum lycopersicum]
Length=234

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  104  GQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            G ++ S L+ TVEQLI VNPYNPDILPDLENYVNEQV SQTYNLDANLCLLRLYQFEP
Sbjct  8    GGSEKSQLAITVEQLIAVNPYNPDILPDLENYVNEQVLSQTYNLDANLCLLRLYQFEP  65



>ref|XP_008391834.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Malus domestica]
Length=233

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREVPQQQQQQQVALAVEQLLAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_009369722.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Pyrus x bretschneideri]
Length=233

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREVPQQQQQQQVALAVEQLLAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_006600127.1| PREDICTED: uncharacterized protein LOC100306445 isoform X1 [Glycine 
max]
 gb|KHN17758.1| Eukaryotic translation initiation factor 3 subunit K [Glycine 
soja]
Length=229

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + ++YTVEQL+  NPYNPDILPDLENYVN+QVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE----KETTKVAYTVEQLVAFNPYNPDILPDLENYVNDQVSSQTYSLDANLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>ref|XP_009343352.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Pyrus x bretschneideri]
Length=233

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VEQL+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREVPQQQQQQQVALAVEQLLAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>gb|AGL09429.1| eukaryotic initiation factor 3 subunit K, partial [Hydnora visseri]
Length=231

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE   +  P  +SYTVEQL+ VNPYNPDILPDLENYV+EQVSSQTY+LDANLCLLR Y
Sbjct  1    MGRE--RELLPQQVSYTVEQLVAVNPYNPDILPDLENYVHEQVSSQTYSLDANLCLLRFY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_006452893.1| hypothetical protein CICLE_v10009369mg [Citrus clementina]
 ref|XP_006474578.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Citrus sinensis]
 gb|ESR66133.1| hypothetical protein CICLE_v10009369mg [Citrus clementina]
Length=232

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE A Q Q   +S+TVEQL+ VNPYNPDILPDLENYVNEQV SQTY+LDANLCLLRLY
Sbjct  1    MGRE-AQQQQQQQVSFTVEQLVAVNPYNPDILPDLENYVNEQVLSQTYSLDANLCLLRLY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>ref|XP_008337806.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Malus domestica]
Length=233

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VE+L+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREVLQQQQQQQVASAVEELLAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_010526137.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Tarenaya hassleriana]
Length=228

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q    SYTVEQLI +NPYNP+ILPDLENYVNEQV+SQTY+L+A LCLLRLY
Sbjct  1    MGREVQPQQQQG--SYTVEQLIALNPYNPEILPDLENYVNEQVASQTYSLEAALCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_009359690.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Pyrus x bretschneideri]
Length=233

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VE+L+ VNPYNPDILPDLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGREVLQQQQQQQVASAVEELLAVNPYNPDILPDLENYVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_009123672.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Brassica rapa]
Length=228

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLY
Sbjct  1    MGKEMESPKEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_006284473.1| hypothetical protein CARUB_v10005658mg [Capsella rubella]
 gb|EOA17371.1| hypothetical protein CARUB_v10005658mg [Capsella rubella]
Length=229

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+L+ANLCLLRLY
Sbjct  1    MGREIQSPQEQSE-SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLEANLCLLRLY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>emb|CDY28288.1| BnaC03g66710D [Brassica napus]
Length=229

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLY
Sbjct  1    MGKEMESPKEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_009388189.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K {ECO:0000255|HAMAP-Rule:MF_03010}-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 5/64 (8%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE   Q Q +A  YTVEQL+ VNPYNPDIL DLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE---QQQQAA--YTVEQLVAVNPYNPDILTDLENYVNEQVSSQTYSLDANLCLLRLY  55

Query  266  QFEP  277
            QFEP
Sbjct  56   QFEP  59



>ref|XP_004144055.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Cucumis sativus]
 ref|XP_004166101.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Cucumis sativus]
 gb|KGN66334.1| hypothetical protein Csa_1G597810 [Cucumis sativus]
Length=231

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE+  Q Q   ++  VEQL+ VNPYNPDILPDLENYVNEQVSS+TY+LDANLCLLRLY
Sbjct  1    MGRELQKQPQ-QEMASAVEQLLAVNPYNPDILPDLENYVNEQVSSETYSLDANLCLLRLY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>ref|XP_008450972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Cucumis melo]
Length=231

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE+  Q Q   ++  VEQL+ VNPYNPDILPDLENYVNEQVSS+TY+LDANLCLLRLY
Sbjct  1    MGRELQKQPQ-QEMASAVEQLLAVNPYNPDILPDLENYVNEQVSSETYSLDANLCLLRLY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>ref|XP_006412374.1| hypothetical protein EUTSA_v10026154mg [Eutrema salsugineum]
 gb|ESQ53827.1| hypothetical protein EUTSA_v10026154mg [Eutrema salsugineum]
Length=228

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+S+TY+LDANLCLLRLY
Sbjct  1    MGKEIESPKEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSKTYSLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>emb|CDP03033.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 6/70 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALS------YTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANL  247
            MGRE++   Q S+ S      YTVEQL+ VNPYNPDILPDLEN+VNEQVSSQTYNLDANL
Sbjct  1    MGREISSGGQKSSSSSSAGMSYTVEQLVAVNPYNPDILPDLENFVNEQVSSQTYNLDANL  60

Query  248  CLLRLYQFEP  277
            CLLRLYQFEP
Sbjct  61   CLLRLYQFEP  70



>ref|XP_009414831.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K {ECO:0000255|HAMAP-Rule:MF_03010}-like [Musa acuminata subsp. 
malaccensis]
Length=227

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 6/64 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE   Q Q   +SYTVEQL+ VNPYNPDIL DLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE---QQQ---VSYTVEQLVSVNPYNPDILTDLENYVNEQVSSQTYSLDANLCLLRLY  54

Query  266  QFEP  277
            QFEP
Sbjct  55   QFEP  58



>ref|NP_001235156.1| uncharacterized protein LOC100306445 [Glycine max]
 gb|ACU14626.1| unknown [Glycine max]
Length=199

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + ++YTVEQL+  NPYNPDILPDLENYVN+QVSSQTY+LDANLCLL LY
Sbjct  1    MGRE----KETTKVAYTVEQLVAFNPYNPDILPDLENYVNDQVSSQTYSLDANLCLLHLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>ref|XP_008783088.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Phoenix dactylifera]
Length=231

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M RE   Q Q   +SYTVEQL+ VNPYNPDIL DLENYVNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MVRERESQQQ--QVSYTVEQLVAVNPYNPDILTDLENYVNEQVSSQTYSLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_006838090.1| hypothetical protein AMTR_s00106p00025830 [Amborella trichopoda]
 gb|ERN00659.1| hypothetical protein AMTR_s00106p00025830 [Amborella trichopoda]
Length=231

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     Q   + YTVEQLI VNPYNPDILPDLE Y++EQVSSQTYNLDANLCLLRLY
Sbjct  1    MGRERETPRQ--QVPYTVEQLIAVNPYNPDILPDLEAYIHEQVSSQTYNLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>gb|KFK29935.1| hypothetical protein AALP_AA7G197500 [Arabis alpina]
Length=228

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+L+ANLCLLRLY
Sbjct  1    MGKEIESPQEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLEANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_009108810.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Brassica rapa]
Length=229

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+  NP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLY
Sbjct  1    MGKEMESPKEQS--SYTVEQLVAANPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_010049324.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Eucalyptus grandis]
 ref|XP_010041498.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Eucalyptus grandis]
 gb|KCW81846.1| hypothetical protein EUGRSUZ_C03197 [Eucalyptus grandis]
Length=225

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 8/64 (13%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE         +SYTVEQL+ +NPYNPD+LPDLEN+VNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE--------QVSYTVEQLVALNPYNPDMLPDLENHVNEQVSSQTYSLDANLCLLRLY  52

Query  266  QFEP  277
            QFEP
Sbjct  53   QFEP  56



>ref|XP_010937279.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Elaeis guineensis]
Length=233

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M RE   Q Q   +SYTVEQL+ VNPYNPDIL DLEN+VNEQVSSQTY+LDANLCLLRLY
Sbjct  1    MVRERESQQQQQQVSYTVEQLVAVNPYNPDILTDLENHVNEQVSSQTYSLDANLCLLRLY  60

Query  266  QFEP  277
            QFEP
Sbjct  61   QFEP  64



>ref|XP_004287671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Fragaria vesca subsp. vesca]
Length=232

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  125  LSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +S+TVEQL+ VNPYNPDILPDLE+YVNEQVSSQTY+LDANLCLLRLYQFEP
Sbjct  13   VSFTVEQLVAVNPYNPDILPDLESYVNEQVSSQTYSLDANLCLLRLYQFEP  63



>gb|AFK42050.1| unknown [Lotus japonicus]
Length=229

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + + Y VEQL+ +NPYNPDILPDLENYVN+QVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE----REQAQVGYAVEQLLALNPYNPDILPDLENYVNDQVSSQTYSLDANLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>ref|XP_010437785.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Camelina sativa]
Length=228

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLEN+VNEQV+SQTY+L+ANLCLLRLY
Sbjct  1    MGKEIESPQEQS--SYTVEQLVAVNPFNPEILPDLENHVNEQVTSQTYSLEANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_002324723.2| Eukaryotic translation initiation factor 3 subunit 11 family 
protein [Populus trichocarpa]
 gb|ABK93965.1| unknown [Populus trichocarpa]
 gb|EEF03288.2| Eukaryotic translation initiation factor 3 subunit 11 family 
protein [Populus trichocarpa]
Length=238

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 55/69 (80%), Gaps = 5/69 (7%)
 Frame = +2

Query  86   MGREVAGQNQPS-----ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLC  250
            MGRE     +P       +SYTVEQL+ VNPYNPDILPDLENYVNEQVSS TY+LDANLC
Sbjct  1    MGREREAPQKPQQQQEEVVSYTVEQLVAVNPYNPDILPDLENYVNEQVSSLTYSLDANLC  60

Query  251  LLRLYQFEP  277
            LLRLYQFEP
Sbjct  61   LLRLYQFEP  69



>ref|XP_010447265.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Camelina sativa]
Length=228

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG+E+    + S  SYTVEQL+ VNP+NP+ILPDLEN+VNEQV+SQTY+L+ANLCLLRLY
Sbjct  1    MGKEIESPQEQS--SYTVEQLVAVNPFNPEILPDLENHVNEQVTSQTYSLEANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_002867191.1| hypothetical protein ARALYDRAFT_913095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43450.1| hypothetical protein ARALYDRAFT_913095 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+L+ANLCLLRLY
Sbjct  1    MGVEIQSPQEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLEANLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>emb|CDX68959.1| BnaC01g04940D [Brassica napus]
Length=224

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLYQFEP
Sbjct  9    SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLYQFEP  58



>emb|CDX75342.1| BnaA01g03600D [Brassica napus]
Length=224

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLYQFEP
Sbjct  9    SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLYQFEP  58



>emb|CDX72396.1| BnaC07g44180D [Brassica napus]
Length=219

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG E+    + S  SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LD+NLCLLRLY
Sbjct  1    MGLEMESPKEQS--SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDSNLCLLRLY  58

Query  266  QFEP  277
            QFEP
Sbjct  59   QFEP  62



>ref|XP_007154541.1| hypothetical protein PHAVU_003G127300g [Phaseolus vulgaris]
 gb|ESW26535.1| hypothetical protein PHAVU_003G127300g [Phaseolus vulgaris]
Length=229

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + ++YTVEQL+  N YNPDILPDLENYVN+QVSSQTY+L+ANLCLLRLY
Sbjct  1    MGRE----KETTKVAYTVEQLVAFNRYNPDILPDLENYVNDQVSSQTYSLEANLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>ref|XP_003542381.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Glycine max]
 gb|KHN45050.1| Eukaryotic translation initiation factor 3 subunit K [Glycine 
soja]
Length=229

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + ++Y VEQL+  N YNPDILPDLENYVN+QVSSQTY+LDANLCLLRLY
Sbjct  1    MGRE----KETTKVAYAVEQLVAFNRYNPDILPDLENYVNDQVSSQTYSLDANLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>emb|CDY45034.1| BnaA08g11850D [Brassica napus]
Length=225

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ VNP+NP+ILPDLENYVNEQV++QTY+LDANLCLLRLYQFEP
Sbjct  9    SYTVEQLVAVNPFNPEILPDLENYVNEQVTTQTYSLDANLCLLRLYQFEP  58



>ref|XP_002274986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Vitis vinifera]
 emb|CBI27753.3| unnamed protein product [Vitis vinifera]
Length=229

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  YTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            YTVEQL+ +NPYNPDILPDLEN+VNEQVSSQTY+LDANLCLLRLYQFEP
Sbjct  12   YTVEQLLALNPYNPDILPDLENFVNEQVSSQTYSLDANLCLLRLYQFEP  60



>gb|AFK42537.1| unknown [Lotus japonicus]
Length=229

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGRE     + + + Y VEQL+ +NPYNPDILPDLENYVN+QV SQTY+LDANLCLLRLY
Sbjct  1    MGRE----REQAQVGYAVEQLLALNPYNPDILPDLENYVNDQVLSQTYSLDANLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>ref|XP_008242295.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Prunus mume]
Length=232

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VEQL+ VNPYNPD+L DLENYVNEQVSSQTYNLDANLCLLR+Y
Sbjct  1    MGREVPQQQQ-QQVALAVEQLLAVNPYNPDMLSDLENYVNEQVSSQTYNLDANLCLLRIY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>ref|XP_007202515.1| hypothetical protein PRUPE_ppa010881mg [Prunus persica]
 gb|EMJ03714.1| hypothetical protein PRUPE_ppa010881mg [Prunus persica]
Length=232

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MGREV  Q Q   ++  VEQL+ VNPYNPD+L DLENYVNEQVSSQTYNLDANLCLLR+Y
Sbjct  1    MGREVPQQQQ-QQVALAVEQLLAVNPYNPDMLSDLENYVNEQVSSQTYNLDANLCLLRIY  59

Query  266  QFEP  277
            QFEP
Sbjct  60   QFEP  63



>emb|CDY46124.1| BnaA03g52440D [Brassica napus]
Length=620

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ VNP+NP+ILPDLENYVNEQV+SQTY+LDANLCLLRLYQFEP
Sbjct  405  SYTVEQLVAVNPFNPEILPDLENYVNEQVTSQTYSLDANLCLLRLYQFEP  454



>ref|XP_003609944.1| Eukaryotic translation initiation factor 3 subunit K [Medicago 
truncatula]
 gb|AES92141.1| eukaryotic translation initiation factor 3 subunit 12 [Medicago 
truncatula]
Length=235

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  86   MGREVAGQNQPS--ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE A   +      +YTVEQL+  N YNPDILPDLENYVN+QVSSQTY+L++NLCLLR
Sbjct  1    MGREAAAAAEKGQGGTAYTVEQLVAFNRYNPDILPDLENYVNDQVSSQTYSLESNLCLLR  60

Query  260  LYQFE  274
            LYQFE
Sbjct  61   LYQFE  65



>gb|AFK49177.1| unknown [Medicago truncatula]
Length=235

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  86   MGREVAGQNQPS--ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE A   +      +YTVEQL+  N YNPDILPDLENYVN+QVSSQTY+L++NLCLLR
Sbjct  1    MGREAAAAAEKGQGGTAYTVEQLVAFNRYNPDILPDLENYVNDQVSSQTYSLESNLCLLR  60

Query  260  LYQFE  274
            LYQFE
Sbjct  61   LYQFE  65



>ref|XP_009138176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Brassica rapa]
Length=224

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ VNP+NP+ILPDLENYVNEQV+ QTY+LDANLCLLRLYQFEP
Sbjct  9    SYTVEQLVAVNPFNPEILPDLENYVNEQVTLQTYSLDANLCLLRLYQFEP  58



>gb|ACJ83269.1| unknown [Medicago truncatula]
Length=235

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  86   MGREVAGQNQPS--ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE A   +      +YTVEQL+  N YNPDILPDLENYV++QVSSQTY+L++NLCLLR
Sbjct  1    MGREAAAAAEKGQGGTAYTVEQLVAFNRYNPDILPDLENYVSDQVSSQTYSLESNLCLLR  60

Query  260  LYQFE  274
            LYQFE
Sbjct  61   LYQFE  65



>ref|XP_010687584.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Beta vulgaris subsp. vulgaris]
Length=237

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  128  SYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            SYTVEQL+ +NPYNPDILPDLENYVNEQV + +Y+LD NLCLLRLYQFEP
Sbjct  19   SYTVEQLVALNPYNPDILPDLENYVNEQVMTGSYSLDTNLCLLRLYQFEP  68



>ref|XP_004508038.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Cicer arietinum]
Length=235

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +2

Query  86   MGREVAG--QNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLR  259
            MGRE     Q Q  A  YTVEQL+  N YNPDILPDLENYVN+QVSSQTY+L++NLCLLR
Sbjct  1    MGREAVKPQQQQGQAAGYTVEQLVAFNRYNPDILPDLENYVNDQVSSQTYSLESNLCLLR  60

Query  260  LYQFEP  277
            LYQFEP
Sbjct  61   LYQFEP  66



>gb|AHN93214.1| eukaryotic translation initiation factor 3 subunit 12, partial 
[Phyllostachys edulis]
Length=118

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  92   REVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQF  271
            +  A  N+  A +YTVE+L+ VNPYNPDIL DLE +VNEQVSSQTYNLDANL LL LYQF
Sbjct  5    KPAAMANEQPAENYTVEELVAVNPYNPDILNDLEGFVNEQVSSQTYNLDANLSLLHLYQF  64

Query  272  EP  277
            EP
Sbjct  65   EP  66



>ref|XP_010107076.1| Eukaryotic translation initiation factor 3 subunit K [Morus notabilis]
 gb|EXC13597.1| Eukaryotic translation initiation factor 3 subunit K [Morus notabilis]
Length=240

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 7/71 (10%)
 Frame = +2

Query  86   MGRE------VAGQNQPSA-LSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDAN  244
            MGRE      V  Q  P   +S  VEQL+ VNPYNP+IL +LENYVNEQVSSQTY+LDAN
Sbjct  1    MGRERDAVVPVPKQAPPQQQVSQMVEQLLAVNPYNPEILSELENYVNEQVSSQTYSLDAN  60

Query  245  LCLLRLYQFEP  277
            LCLLRLYQFEP
Sbjct  61   LCLLRLYQFEP  71



>ref|XP_003558656.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Brachypodium distachyon]
Length=226

 Score = 90.1 bits (222),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            N+ +A +YTVE+L+ VNPYNPDIL DLE +VNEQVSSQTYNLDANL LLRLYQFEP
Sbjct  3    NEQAAETYTVEELVSVNPYNPDILNDLEIFVNEQVSSQTYNLDANLSLLRLYQFEP  58



>gb|AHN93215.1| eukaryotic translation initiation factor 3 subunit 12, partial 
[Phyllostachys nidularia]
Length=98

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  92   REVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQF  271
            +  A  N+  A +YTVE+L+ VNPYNPDIL DLE +VNEQVSSQTYNL+ NL LLRLYQF
Sbjct  2    KPAAMANEQPAENYTVEELVAVNPYNPDILNDLEGFVNEQVSSQTYNLETNLSLLRLYQF  61

Query  272  EP  277
            EP
Sbjct  62   EP  63



>ref|XP_006649509.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Oryza brachyantha]
Length=226

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  107  QNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +N+  A SYTVE+L+ VNPYNPDIL DLE +VN+QVS+QTYNLDANL LLRLYQFEP
Sbjct  2    ENEQPAESYTVEELVAVNPYNPDILNDLEGFVNDQVSNQTYNLDANLSLLRLYQFEP  58



>gb|AHN93217.1| eukaryotic translation initiation factor 3 subunit 12, partial 
[Phyllostachys nigra var. henonis]
Length=125

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  92   REVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQF  271
            +  A  N+  A +YTVE+L+ VNPYNPDIL DLE +VNEQVSSQTYNL+ NL LLRLYQF
Sbjct  4    KPAAMANEQPAENYTVEELVAVNPYNPDILNDLEGFVNEQVSSQTYNLETNLSLLRLYQF  63

Query  272  EP  277
            EP
Sbjct  64   EP  65



>ref|XP_008658292.1| PREDICTED: uncharacterized protein LOC100273909 isoform X1 [Zea 
mays]
 gb|ACG48806.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays]
 gb|AFW89445.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays]
Length=205

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M  E A +N      YTVE L+ +NPYNPDIL DLE +VNEQVSSQTYNLDANL LLRLY
Sbjct  1    MATEQAAEN------YTVEDLVALNPYNPDILNDLEKFVNEQVSSQTYNLDANLSLLRLY  54

Query  266  QFEP  277
            QFEP
Sbjct  55   QFEP  58



>gb|EMS59325.1| Eukaryotic translation initiation factor 3 subunit K [Triticum 
urartu]
Length=226

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            N+  A +YTVE+L+ VNPYNPDIL DLE +VNEQVSS+TYNLDANL LLRLYQFEP
Sbjct  3    NEQPAETYTVEELVAVNPYNPDILNDLEVFVNEQVSSKTYNLDANLSLLRLYQFEP  58



>ref|XP_002465750.1| hypothetical protein SORBIDRAFT_01g045090 [Sorghum bicolor]
 gb|EER92748.1| hypothetical protein SORBIDRAFT_01g045090 [Sorghum bicolor]
Length=226

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M  E A +N      YTVE L+ +NPYNPDIL DLE +VNEQVSSQTYNLDANL LLRLY
Sbjct  1    MATEQAAEN------YTVEDLVALNPYNPDILNDLEKFVNEQVSSQTYNLDANLSLLRLY  54

Query  266  QFEP  277
            QFEP
Sbjct  55   QFEP  58



>ref|NP_001049175.2| Os03g0182700 [Oryza sativa Japonica Group]
 sp|Q94HF1.1|EIF3K_ORYSJ RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Oryza sativa Japonica 
Group]
 gb|AAK92637.1|AC079633_17 Unknown protein [Oryza sativa Japonica Group]
 gb|ABF94327.1| Eukaryotic translation initiation factor 3 subunit 11 family 
protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG93382.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58443.1| hypothetical protein OsJ_09669 [Oryza sativa Japonica Group]
 dbj|BAF11089.2| Os03g0182700 [Oryza sativa Japonica Group]
Length=226

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ +A SYTVE+L+ VNPYNPDIL DLE +VN+QVS+QTYNLDANL LLRLYQFEP
Sbjct  3    SEQAAESYTVEELVAVNPYNPDILNDLEGFVNDQVSNQTYNLDANLSLLRLYQFEP  58



>gb|EAY88800.1| hypothetical protein OsI_10273 [Oryza sativa Indica Group]
Length=226

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ +A SYTVE+L+ VNPYNPDIL DLE +VN+QVS+QTYNLDANL LLRLYQFEP
Sbjct  3    SEQAAESYTVEELVAVNPYNPDILNDLEGFVNDQVSNQTYNLDANLSLLRLYQFEP  58



>ref|XP_004985473.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Setaria italica]
Length=226

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M  E A +N      YTVE L+ +NPYNPDIL DLE +VNEQVSSQTYNLDANL LLRLY
Sbjct  1    MATEQAAEN------YTVEDLVALNPYNPDILNDLEKFVNEQVSSQTYNLDANLSLLRLY  54

Query  266  QFEP  277
            QFEP
Sbjct  55   QFEP  58



>ref|NP_001141773.1| uncharacterized protein LOC100273909 [Zea mays]
 gb|ACF82828.1| unknown [Zea mays]
 gb|AFW89443.1| hypothetical protein ZEAMMB73_634183 [Zea mays]
 gb|AFW89444.1| hypothetical protein ZEAMMB73_634183 [Zea mays]
Length=226

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            M  E A +N      YTVE L+ +NPYNPDIL DLE +VNEQVSSQTYNLDANL LLRLY
Sbjct  1    MATEQAAEN------YTVEDLVALNPYNPDILNDLEKFVNEQVSSQTYNLDANLSLLRLY  54

Query  266  QFEP  277
            QFEP
Sbjct  55   QFEP  58



>dbj|BAK07576.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +2

Query  104  GQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
               QP A +YTVE+L+ VNPYNPDIL DLE +VNEQVSS+TYNLDANL LLRLYQFEP
Sbjct  2    ASEQP-AETYTVEELVAVNPYNPDILNDLELFVNEQVSSKTYNLDANLSLLRLYQFEP  58



>gb|EMT25828.1| Eukaryotic translation initiation factor 3 subunit K [Aegilops 
tauschii]
Length=209

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  110  NQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            N+  A +YTVE+L+ VNPYNPDIL DLE +VN+QVSS+TYNLDANL LLRLYQFEP
Sbjct  3    NEQPAETYTVEELVAVNPYNPDILNDLEVFVNDQVSSKTYNLDANLSLLRLYQFEP  58



>gb|ABK24382.1| unknown [Picea sitchensis]
Length=234

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  YTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            YTV QL+ VNPYNPD+LPDLE YV EQV S TYNLDANLCLLRLYQFEP
Sbjct  17   YTVVQLMAVNPYNPDLLPDLEAYVQEQVMSNTYNLDANLCLLRLYQFEP  65



>ref|XP_001752173.1| predicted protein [Physcomitrella patens]
 gb|EDQ82906.1| predicted protein [Physcomitrella patens]
Length=225

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  YTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +T+EQL+ +NPYNPDILPDLE+YV EQV++QTY+LD NLCLLRLYQF+P
Sbjct  11   FTIEQLVALNPYNPDILPDLESYVEEQVATQTYSLDCNLCLLRLYQFQP  59



>gb|AGL09428.1| eukaryotic initiation factor 3 subunit K, partial [Hernandia 
nymphaeifolia]
Length=155

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            VNPYNPDILPDLENYV+EQVSSQTYNLDANLCLLR YQFEP
Sbjct  1    VNPYNPDILPDLENYVHEQVSSQTYNLDANLCLLRFYQFEP  41



>gb|AGL09430.1| eukaryotic initiation factor 3 subunit K, partial [Xymalos monospora]
Length=155

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            VNPYNPDILPDLENYV+EQVSSQTY+LDANLCLLRLYQFEP
Sbjct  1    VNPYNPDILPDLENYVHEQVSSQTYSLDANLCLLRLYQFEP  41



>ref|XP_008664442.1| PREDICTED: uncharacterized protein LOC100194334 isoform X1 [Zea 
mays]
 gb|ACG43013.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays]
 gb|ACN25870.1| unknown [Zea mays]
 tpg|DAA43722.1| TPA: eukaryotic translation initiation factor 3 subunit 12 [Zea 
mays]
Length=226

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  122  ALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            A +YTVE L+ +NPYNPDIL DLE +VNEQV+SQTYNLDANL LLRLYQFEP
Sbjct  7    AENYTVEDLVALNPYNPDILNDLEKFVNEQVASQTYNLDANLSLLRLYQFEP  58



>ref|NP_195051.1| translation initiation factor 3 subunit K [Arabidopsis thaliana]
 sp|Q9SZA3.1|EIF3K_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Arabidopsis thaliana]
 gb|AAG53637.1|AF291713_1 initiation factor 3k [Arabidopsis thaliana]
 emb|CAB38783.1| putative protein [Arabidopsis thaliana]
 emb|CAB80042.1| putative protein [Arabidopsis thaliana]
 gb|AAK59776.1| AT4g33250/F17M5_10 [Arabidopsis thaliana]
 gb|AAK93605.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10269.1| AT4g33250/F17M5_10 [Arabidopsis thaliana]
 gb|AAM14103.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86197.1| translation initiation factor 3 subunit K [Arabidopsis thaliana]
Length=226

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 4/64 (6%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLY  265
            MG E+    + S  SYTVEQL+ +NP+NP+ILPDLENYVN  V+SQTY+L+ NLCLLRLY
Sbjct  1    MGVEIQSPQEQS--SYTVEQLVALNPFNPEILPDLENYVN--VTSQTYSLEVNLCLLRLY  56

Query  266  QFEP  277
            QFEP
Sbjct  57   QFEP  60



>gb|EPS67709.1| hypothetical protein M569_07065, partial [Genlisea aurea]
Length=136

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +2

Query  113  QPSALSYTVEQLIVVNPYNPDILPDLENYVNEQ-VSSQTYNLDANLCLLRLYQ  268
            QPSA +YTVEQLI  NPYNP+ILPD+ENYVNEQ V+SQTY+L+ANL LLRLYQ
Sbjct  5    QPSAAAYTVEQLIAFNPYNPEILPDIENYVNEQVVASQTYSLNANLSLLRLYQ  57



>gb|AGL09427.1| eukaryotic initiation factor 3 subunit K, partial [Chloranthus 
fortunei]
Length=111

 Score = 82.8 bits (203),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            VNPYNPDILPDLE YV+EQVSSQTY+LDANLCLLRLYQFEP
Sbjct  1    VNPYNPDILPDLEAYVHEQVSSQTYSLDANLCLLRLYQFEP  41



>ref|XP_001773783.1| predicted protein [Physcomitrella patens]
 gb|EDQ61400.1| predicted protein [Physcomitrella patens]
Length=234

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  YTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +T+EQL+ +NPYNPDILPDLE+YV EQV++QTY+LD NLCLLRLYQF P
Sbjct  11   FTIEQLVALNPYNPDILPDLESYVEEQVATQTYSLDCNLCLLRLYQFYP  59



>ref|XP_002981969.1| hypothetical protein SELMODRAFT_154794 [Selaginella moellendorffii]
 ref|XP_002982949.1| hypothetical protein SELMODRAFT_155471 [Selaginella moellendorffii]
 gb|EFJ16194.1| hypothetical protein SELMODRAFT_155471 [Selaginella moellendorffii]
 gb|EFJ17062.1| hypothetical protein SELMODRAFT_154794 [Selaginella moellendorffii]
Length=231

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 3/57 (5%)
 Frame = +2

Query  107  QNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            Q QP     T+EQL+ +NPYNPDILPDLE YV EQV+++TY+ D+NLCLLRLYQFEP
Sbjct  9    QEQPQ---LTMEQLVALNPYNPDILPDLEAYVQEQVATETYSFDSNLCLLRLYQFEP  62



>gb|AHN93216.1| eukaryotic translation initiation factor 3 subunit 12, partial 
[Phyllostachys nidularia]
Length=82

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  137  VEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            VE+L+ VNPYNPDIL DLE +VNEQVSSQTYNL+ NL LLRLYQFEP
Sbjct  1    VEELVAVNPYNPDILNDLEGFVNEQVSSQTYNLETNLSLLRLYQFEP  47



>ref|XP_008347893.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
13-like [Malus domestica]
Length=465

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  125  LSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQF  271
            ++  VEQL+ VN YNPDILP+LENYVN QVSSQTYNLDANLCLL LYQF
Sbjct  326  VALAVEQLLAVNSYNPDILPNLENYVNGQVSSQTYNLDANLCLLSLYQF  374



>gb|EYU25803.1| hypothetical protein MIMGU_mgv1a012800mg [Erythranthe guttata]
Length=220

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 37/49 (76%), Gaps = 6/49 (12%)
 Frame = +2

Query  86   MGREV------AGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQV  214
            MGRE+      A Q Q S  SYTVEQL+ VNPYNPDILPDLENYVNEQV
Sbjct  1    MGREITNSAAAANQKQQSTTSYTVEQLVAVNPYNPDILPDLENYVNEQV  49



>gb|KCW44322.1| hypothetical protein EUGRSUZ_L022301, partial [Eucalyptus grandis]
Length=34

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 8/42 (19%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQ  211
            MGRE         +SYTVEQL+ +NPYNPD+LPDLEN+VNEQ
Sbjct  1    MGRE--------QVSYTVEQLVALNPYNPDMLPDLENHVNEQ  34



>ref|XP_001703228.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDO96524.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=219

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  146  LIVVNP--YNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            LIV     Y+PD LP LE YV+EQV++++++LDAN+ LLR YQF P
Sbjct  3    LIVTGADRYSPDKLPQLEAYVDEQVANRSWSLDANVTLLRFYQFSP  48



>ref|XP_005184925.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Musca domestica]
 ref|XP_011293096.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Musca domestica]
Length=221

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV EQ  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVEEQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_002039803.1| GM15855 [Drosophila sechellia]
 sp|B4I7U3.1|EIF3K_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila sechellia]
 gb|EDW56668.1| GM15855 [Drosophila sechellia]
Length=222

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE+YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLESYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|NP_611604.1| CG10306 [Drosophila melanogaster]
 sp|Q9W2D9.1|EIF3K_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila melanogaster]
 gb|AAF46753.1| CG10306 [Drosophila melanogaster]
 gb|AAL28616.1| LD03569p [Drosophila melanogaster]
Length=222

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE+YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLESYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>gb|AAR09739.1| similar to Drosophila melanogaster CG10306, partial [Drosophila 
yakuba]
Length=185

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_002948062.1| eukaryotic translation initiation factor 3k [Volvox carteri f. 
nagariensis]
 gb|EFJ51050.1| eukaryotic translation initiation factor 3k [Volvox carteri f. 
nagariensis]
Length=221

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  164  YNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            Y+P+ LP LE  V+EQV+++T+NLDAN+ LLR YQF P
Sbjct  13   YSPEKLPVLEQNVDEQVANRTWNLDANVTLLRFYQFSP  50



>ref|XP_002091493.1| GE12213 [Drosophila yakuba]
 sp|B4P8V1.1|EIF3K_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila yakuba]
 gb|EDW91205.1| GE12213 [Drosophila yakuba]
Length=222

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_001975094.1| GG22131 [Drosophila erecta]
 sp|B3NN00.1|EIF3K_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila erecta]
 gb|EDV55494.1| GG22131 [Drosophila erecta]
Length=222

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_001960231.1| GF13261 [Drosophila ananassae]
 sp|B3MIY7.1|EIF3K_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila ananassae]
 gb|EDV37053.1| GF13261 [Drosophila ananassae]
Length=222

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_011207668.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Bactrocera dorsalis]
Length=221

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVEDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_002005683.1| GI20605 [Drosophila mojavensis]
 sp|B4KTN5.1|EIF3K_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila mojavensis]
 gb|EDW09618.1| GI20605 [Drosophila mojavensis]
Length=222

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE+YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKILESYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_004530274.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Ceratitis capitata]
Length=221

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVEDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_011178571.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Bactrocera cucurbitae]
Length=221

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKTLEAYVEDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_002048935.1| GJ21045 [Drosophila virilis]
 sp|B4LNQ8.1|EIF3K_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila virilis]
 gb|EDW60128.1| GJ21045 [Drosophila virilis]
Length=222

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE+YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKILESYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_001629066.1| predicted protein [Nematostella vectensis]
 sp|A7SGZ5.1|EIF3K_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Nematostella vectensis]
 gb|EDO37003.1| predicted protein [Nematostella vectensis]
Length=216

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  116  PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
             + +  TV QL+  ++ YNP+ L  LE+YV+ QV    Y+LDANL +L+LYQF P
Sbjct  2    AAEMRVTVSQLLKGIDRYNPENLKVLEHYVHLQVHENAYDLDANLAVLKLYQFNP  56



>ref|XP_002061063.1| GK10740 [Drosophila willistoni]
 sp|B4MIW0.1|EIF3K_DROWI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila willistoni]
 gb|EDW72049.1| GK10740 [Drosophila willistoni]
Length=222

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +2

Query  128  SYTVEQLI-VVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            S T+++++  +  YNPD L  LE+YV +Q  + TY+L+ANL +L+LYQF P
Sbjct  12   SQTIQEMLGCIERYNPDHLKILESYVQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_004344531.1| hypothetical protein CAOG_06910 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96610.1| hypothetical protein CAOG_006910 [Capsaspora owczarzaki ATCC 
30864]
Length=247

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  116  PSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            P+  +   E L   + YNP  +  LE Y+ EQV+  TY+ ++NL LLRLYQF P
Sbjct  34   PAGAADLRELLKGTDRYNPTHIERLEKYIQEQVTDGTYDFESNLALLRLYQFHP  87



>ref|XP_001360371.1| GA24496 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002015838.1| GL10802 [Drosophila persimilis]
 sp|Q292B6.1|EIF3K_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila pseudoobscura 
pseudoobscura]
 sp|B4G9X6.1|EIF3K_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila persimilis]
 gb|EAL24946.1| GA24496 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW31728.1| GL10802 [Drosophila persimilis]
Length=222

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  128  SYTVEQLI-VVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            S T+++++  +  YNPD L  LE Y+ +Q  + TY+L+ANL +L+LYQF P
Sbjct  12   SQTIQEMLGCIERYNPDHLKTLEAYIQDQAKNNTYDLEANLAVLKLYQFNP  62



>ref|XP_009061596.1| hypothetical protein LOTGIDRAFT_194136 [Lottia gigantea]
 gb|ESO87700.1| hypothetical protein LOTGIDRAFT_194136 [Lottia gigantea]
Length=216

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  116  PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
              A+  +V QL+  ++ YNP+ L  LE YV  QV   TY+L+ANL +L+LYQF P
Sbjct  2    AEAMRASVGQLLKGIDRYNPENLATLERYVEMQVRENTYDLEANLAILKLYQFNP  56



>gb|ENN82173.1| hypothetical protein YQE_01452, partial [Dendroctonus ponderosae]
Length=183

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD LP LE YV  Q    TY+L+ANL +L+LYQF P
Sbjct  16   IERYNPDNLPTLERYVEMQSKENTYDLEANLAVLKLYQFNP  56



>gb|ENN79693.1| hypothetical protein YQE_03865, partial [Dendroctonus ponderosae]
Length=91

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD LP LE YV  Q    TY+L+ANL +L+LYQF P
Sbjct  16   IERYNPDNLPTLERYVEMQSKENTYDLEANLAVLKLYQFNP  56



>ref|XP_001995363.1| GH22679 [Drosophila grimshawi]
 sp|B4JVG7.1|EIF3K_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Drosophila grimshawi]
 gb|EDV98435.1| GH22679 [Drosophila grimshawi]
Length=222

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  +  YNPD L  LE+YV +Q  + +Y+L+ANL +L+LYQF P
Sbjct  17   EMLGCIERYNPDHLKILESYVQDQAKNNSYDLEANLAVLKLYQFNP  62



>ref|XP_002411753.1| conserved hypothetical protein [Ixodes scapularis]
 gb|EEC14082.1| conserved hypothetical protein [Ixodes scapularis]
Length=217

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  104  GQNQPSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            G   P ++   V Q++  ++ YNP+ L  LENYV  Q +   Y+L+ANL +L+LYQF P
Sbjct  12   GMTNPESMRMQVAQMLKGIDRYNPENLIKLENYVQIQATENMYDLEANLAVLKLYQFNP  70



>gb|ERL91876.1| hypothetical protein D910_09200 [Dendroctonus ponderosae]
Length=216

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD LP LE YV  Q    TY+L+ANL +L+LYQF P
Sbjct  16   IERYNPDNLPTLERYVEMQSKENTYDLEANLAVLKLYQFNP  56



>gb|AEE63206.1| unknown [Dendroctonus ponderosae]
 gb|ENN82283.1| hypothetical protein YQE_01342, partial [Dendroctonus ponderosae]
Length=216

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD LP LE YV  Q    TY+L+ANL +L+LYQF P
Sbjct  16   IERYNPDNLPTLERYVEMQSKENTYDLEANLAVLKLYQFNP  56



>ref|XP_005091207.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Aplysia californica]
Length=216

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +2

Query  122  ALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            A+  TV  L+  ++ YNP+ L  LE YV  Q S  TY+L+ANL +L+LYQF P
Sbjct  4    AMQATVASLLKGIDRYNPENLQTLERYVAMQASENTYDLEANLAVLKLYQFNP  56



>ref|XP_002430152.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
 gb|EEB17414.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
Length=215

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNP+ LP LENYV  Q    +Y+L+ANL +L+LYQF P
Sbjct  16   IERYNPENLPTLENYVERQAVENSYDLEANLAVLKLYQFNP  56



>gb|KDR14617.1| Eukaryotic translation initiation factor 3 subunit K [Zootermopsis 
nevadensis]
Length=216

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +2

Query  122  ALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            A+  TV +++  +  YNPD L  LE+YV  Q    TY+L+ANL +L+LYQF P
Sbjct  4    AMRQTVAKMLTGIERYNPDNLQTLESYVEYQSRENTYDLEANLAVLKLYQFNP  56



>gb|AEB54635.1| eukaryotic translation initiation factor 3 subunit 12 [Procambarus 
clarkii]
Length=219

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  113  QPSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            Q  A+  TV  ++  +  YNP+ +  LE YV  Q    TY+L+ANL LL+LYQF P
Sbjct  4    QAEAMRATVASMLRGIERYNPENISTLERYVELQARENTYDLEANLALLKLYQFNP  59



>ref|XP_010777099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Notothenia coriiceps]
Length=103

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ LP LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLPTLERYVETQAKENAYDLEANLAVLKLYQFNP  59



>ref|XP_001606859.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Nasonia vitripennis]
 ref|XP_008217769.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Nasonia vitripennis]
Length=219

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  137  VEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            V+ L  +  YNPD L  LE YV+ QV+   Y+LDANL +L+LYQ  P
Sbjct  10   VDMLKGIERYNPDNLKTLEKYVDIQVTENAYDLDANLAVLKLYQLNP  56



>emb|CDS26409.1| eukaryotic translation initiation factor 3 [Hymenolepis microstoma]
Length=284

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD LP+LE +++ QV+   Y+ +ANL +LR+YQF P
Sbjct  34   IEAYNPDHLPELEKHLSWQVTENDYDFEANLIMLRMYQFCP  74



>gb|KCW44321.1| hypothetical protein EUGRSUZ_L022302, partial [Eucalyptus grandis]
Length=191

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  212  VSSQTYNLDANLCLLRLYQFEP  277
            VSSQTY+LDANLCLLRLYQFEP
Sbjct  1    VSSQTYSLDANLCLLRLYQFEP  22



>ref|XP_973326.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Tribolium castaneum]
 gb|EFA01611.1| hypothetical protein TcasGA2_TC007178 [Tribolium castaneum]
Length=215

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +2

Query  122  ALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            A+  TV  ++  +  YNPD LP LE+YV  Q     Y+L+ANL +L+LYQF P
Sbjct  4    AMKQTVAAMLKGIERYNPDNLPTLEHYVEIQSRENAYDLEANLAVLKLYQFNP  56



>gb|ACG40277.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays]
 gb|AFW89446.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays]
Length=169

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 10/66 (15%)
 Frame = +2

Query  86   MGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYN----LDANLCL  253
            M  E A +N      YTVE L+ +NPYNPDIL DLE +VNEQ   + +     L   L  
Sbjct  1    MATEQAAEN------YTVEDLVALNPYNPDILNDLEKFVNEQQMEEQFKVLIVLSHYLET  54

Query  254  LRLYQF  271
             R  QF
Sbjct  55   ARFSQF  60



>ref|XP_005706651.1| translation initiation factor [Galdieria sulphuraria]
 gb|EME30131.1| translation initiation factor [Galdieria sulphuraria]
Length=217

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  125  LSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            LS  V  L+    Y+PDIL DLE YV  Q     Y+ DANL  L+LYQF P
Sbjct  4    LSQQVNDLLQSRRYDPDILIDLERYVEAQCLEGAYDGDANLACLKLYQFYP  54



>ref|XP_004776289.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Mustela putorius furo]
 ref|XP_004810353.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Mustela putorius furo]
Length=391

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>gb|ABD65308.1| eukaryotic translation initiation factor 3 subunit k [Litopenaeus 
vannamei]
Length=151

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +2

Query  113  QPSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            Q  A+  TV  +   +  YNP+ +  LE YV  Q    TY+L+ANL LL+LYQF P
Sbjct  14   QAEAMRSTVAPMFRGIERYNPENISTLERYVELQARENTYDLEANLALLKLYQFNP  69



>gb|ACJ12081.1| eukaryotic translation initiation factor 3 subunit 12 [Bombina 
orientalis]
Length=218

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV+ Q    TY+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVDTQAKENTYDLEANLAVLKLYQFNP  58



>emb|CBY09497.1| unnamed protein product [Oikopleura dioica]
Length=227

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++L  +N YNP+  P LE YV +QV    Y+LDAN+ LL+LYQF P
Sbjct  16   DRLKDMNRYNPENQPILEEYVLQQVREGEYDLDANMALLKLYQFYP  61



>emb|CBY34047.1| unnamed protein product [Oikopleura dioica]
Length=227

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++L  +N YNP+  P LE YV +QV    Y+LDAN+ LL+LYQF P
Sbjct  16   DRLKDMNRYNPENQPILEEYVLQQVREGEYDLDANMALLKLYQFYP  61



>gb|ACI69664.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=218

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYQFNP  59



>emb|CBY41887.1| unnamed protein product [Oikopleura dioica]
Length=218

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++L  +N YNP+  P LE YV +QV    Y+LDAN+ LL+LYQF P
Sbjct  16   DRLKDMNRYNPENQPILEEYVLQQVREGEYDLDANMALLKLYQFYP  61



>gb|ACI66950.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=218

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYQFNP  59



>ref|NP_001154130.1| Eukaryotic translation initiation factor 3 subunit 12 [Oncorhynchus 
mykiss]
 gb|ACO07985.1| Eukaryotic translation initiation factor 3 subunit 12 [Oncorhynchus 
mykiss]
Length=220

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYQFNP  59



>emb|CDQ67649.1| unnamed protein product [Oncorhynchus mykiss]
Length=220

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYQFNP  59



>gb|ACI66240.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
 gb|ACI66422.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
 gb|ACM08342.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
 gb|ACO08413.1| Eukaryotic translation initiation factor 3 subunit 12 [Oncorhynchus 
mykiss]
 emb|CDQ73242.1| unnamed protein product [Oncorhynchus mykiss]
Length=220

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYQFNP  59



>gb|ACI69853.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=218

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKDNAYDLEANLAILKLYQFNP  59



>gb|ACI69427.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=220

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKDNAYDLEANLAILKLYQFNP  59



>gb|ACI69163.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=220

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVKDNAYDLEANLAILKLYQFNP  59



>ref|XP_011391778.1| hypothetical protein UMAG_12282 [Ustilago maydis 521]
 sp|Q4P4X6.2|EIF3K_USTMA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=eIF-3 p25 [Ustilago maydis 
521]
 gb|KIS66775.1| hypothetical protein UMAG_12282 [Ustilago maydis 521]
Length=283

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS+    +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASETASASQWVSPSSRPQHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>gb|ACI69629.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=220

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQVRENAYDLEANLAILKLYQFNP  59



>gb|ACO07712.1| Eukaryotic translation initiation factor 3 subunit 12 [Oncorhynchus 
mykiss]
Length=220

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLAALERYVETQVKENAYDLEANLAILKLYQFNP  59



>emb|CAX73642.1| Eukaryotic translation initiation factor 3 subunit 12 [Schistosoma 
japonicum]
Length=233

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E+L  +  YNP  +P LE ++  Q+++  Y+ +ANL LLRLYQF P
Sbjct  9    EKLQGIESYNPGHIPTLEEHLTWQITNNEYDFEANLALLRLYQFNP  54



>ref|XP_009233510.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit K-like [Pongo abelii]
Length=218

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNPD L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPDNLATLERYVEMQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008467626.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Diaphorina citri]
Length=217

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  113  QPSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFE  274
            Q   +  +V+QL+V +  YNP+ L  LE YV  Q +   Y+L+ANL +L+LYQF 
Sbjct  3    QAELMKGSVDQLLVGIERYNPEHLSTLEKYVEVQCAENVYDLEANLAVLKLYQFH  57



>emb|CAX69707.1| Eukaryotic translation initiation factor 3 subunit 12 [Schistosoma 
japonicum]
Length=233

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E+L  +  YNP  +P LE ++  Q+++  Y+ +ANL LLRLYQF P
Sbjct  9    EKLQGIESYNPGHIPTLEEHLTWQITNNEYDFEANLALLRLYQFNP  54



>gb|ACO10870.1| Eukaryotic translation initiation factor 3 subunit K [Caligus 
rogercresseyi]
Length=218

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +N YNP+ +P LE YV+ Q    TY+L+ANL LL+LYQ +P
Sbjct  18   INRYNPENIPTLEYYVDLQSKEDTYDLEANLTLLKLYQSDP  58



>gb|AFW89456.1| hypothetical protein ZEAMMB73_226719 [Zea mays]
Length=194

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  200  VNEQVSSQTYNLDANLCLLRLYQFEP  277
            + + VSSQTYNLDANL LLRLYQFEP
Sbjct  1    MKQMVSSQTYNLDANLSLLRLYQFEP  26



>ref|XP_005062917.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K, partial [Ficedula albicollis]
Length=103

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_011439558.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Crassostrea gigas]
 gb|EKC20375.1| Eukaryotic translation initiation factor 3 subunit K [Crassostrea 
gigas]
Length=216

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE Y++ Q    TY+L+ANL +L+LYQF P
Sbjct  16   IDRYNPENLGTLEKYIHMQAQEGTYDLEANLAVLKLYQFNP  56



>emb|CCF49303.1| uncharacterized protein UHOR_07720 [Ustilago hordei]
Length=280

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS+    +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASESASASQWLSPSSRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>gb|EAW56805.1| eukaryotic translation initiation factor 3, subunit 12, isoform 
CRA_c [Homo sapiens]
Length=154

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>emb|CBQ69794.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=285

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS+    +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASESASASQWVSPSSRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>emb|CDI55871.1| related to eIF3k-translation initiation factor 3 subunit K [Melanopsichium 
pennsylvanicum 4]
Length=280

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS+    +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASESASASQWVSPSSRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>gb|ELV13963.1| Eukaryotic translation initiation factor 3 subunit K [Tupaia 
chinensis]
Length=216

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  16   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  56



>ref|XP_007994893.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Chlorocebus sabaeus]
Length=176

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>dbj|GAK66745.1| ARM repeat-containing protein [Pseudozyma antarctica]
Length=280

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS     +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASESASASQWVSPSTRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>ref|XP_002829216.3| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Pongo abelii]
Length=168

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>gb|ACI67742.1| Eukaryotic translation initiation factor 3 subunit K [Salmo salar]
Length=220

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  QV    Y+L+ANL +L+LY+F P
Sbjct  19   IDRYNPENLATLERYVETQVKENAYDLEANLAILKLYRFNP  59



>ref|XP_007534514.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Erinaceus europaeus]
Length=193

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>gb|ETS60503.1| hypothetical protein PaG_05347 [Pseudozyma aphidis DSM 70725]
Length=280

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS     +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MASESASASQWVSPSTRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAI  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>ref|NP_001287921.1| eukaryotic translation initiation factor 3 subunit K isoform 
2 [Homo sapiens]
 ref|XP_008962920.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Pan paniscus]
 ref|XP_009433815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K {ECO:0000255|HAMAP-Rule:MF_03010} isoform X2 [Pan troglodytes]
 gb|EAW56808.1| eukaryotic translation initiation factor 3, subunit 12, isoform 
CRA_f [Homo sapiens]
Length=192

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_007129965.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X3 [Physeter catodon]
Length=177

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008303056.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Stegastes partitus]
Length=220

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q    +Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQARENSYDLEANLAVLKLYQFNP  59



>gb|EST08699.1| eukaryotic translation initiation factor subunit [Pseudozyma 
brasiliensis GHG001]
Length=281

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  86   MGREVAGQNQ---PSALSYTVEQLIV-VNPYNPDILPDLENYVNEQVSSQTYNLDANLCL  253
            M  E A  +Q   PS+    +EQLI  V+ YNP  L  L +Y+ +Q+   +Y+L ANL +
Sbjct  1    MATESASASQWVSPSSRPEHIEQLISGVDRYNPQNLDVLHDYLAQQLDDGSYDLLANLAV  60

Query  254  LRLYQFEP  277
            L+LYQF P
Sbjct  61   LKLYQFNP  68



>ref|XP_010872208.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Esox lucius]
Length=220

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQAKENAYDLEANLAILKLYQFNP  59



>ref|XP_003368176.1| eukaryotic translation initiation factor 3 subunit K [Trichinella 
spiralis]
 gb|EFV49022.1| eukaryotic translation initiation factor 3 subunit K [Trichinella 
spiralis]
Length=207

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            VN YNPD +  LE YV EQ   Q  +++ANL LL+LYQ  P
Sbjct  15   VNRYNPDNVEFLEKYVREQCDKQGVDMEANLTLLKLYQLNP  55



>gb|ERE51832.1| eukaryotic translation initiation factor 3 subunit K-like protein 
[Cricetulus griseus]
Length=125

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  16   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  56



>ref|XP_008303057.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Stegastes partitus]
Length=219

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q    +Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQARENSYDLEANLAVLKLYQFNP  59



>ref|XP_006801333.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Neolamprologus brichardi]
Length=178

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  19   IDRYNPENLATLERYVETQARENAYDLEANLAVLKLYQFNP  59



>gb|EFX74786.1| hypothetical protein DAPPUDRAFT_306983 [Daphnia pulex]
Length=216

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            +  YNPD L  LE YV  Q     Y+L+ANL +LRLYQF P
Sbjct  16   IERYNPDNLQKLERYVELQAQENMYDLEANLSVLRLYQFGP  56



>ref|XP_003968750.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K-like [Takifugu rubripes]
Length=218

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E L  ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  13   ELLRGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|NP_037366.1| eukaryotic translation initiation factor 3 subunit K isoform 
1 [Homo sapiens]
 ref|NP_001244620.1| eukaryotic translation initiation factor 3 subunit K [Macaca 
mulatta]
 ref|XP_512639.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K {ECO:0000255|HAMAP-Rule:MF_03010} isoform X1 [Pan troglodytes]
 ref|XP_003252702.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Nomascus leucogenys]
 ref|XP_003915526.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Papio anubis]
 ref|XP_005589177.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Macaca fascicularis]
 ref|XP_007994892.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Chlorocebus sabaeus]
 ref|XP_008962918.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Pan paniscus]
 ref|XP_010384030.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Rhinopithecus roxellana]
 sp|Q9UBQ5.1|EIF3K_HUMAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 12; AltName: Full=Muscle-specific gene 
M9 protein; AltName: Full=PLAC-24; AltName: Full=eIF-3 p25; 
AltName: Full=eIF-3 p28 [Homo sapiens]
 gb|AAD27784.1|AF077051_1 PTD001 [Homo sapiens]
 gb|AAQ13503.1|AF109355_1 MSTP001 [Homo sapiens]
 dbj|BAA76626.1| M9 [Homo sapiens]
 gb|AAH01031.1| Eukaryotic translation initiation factor 3, subunit K [Homo sapiens]
 gb|AAK01365.1| ARG134 protein [Homo sapiens]
 gb|AAH07559.1| Eukaryotic translation initiation factor 3, subunit K [Homo sapiens]
 gb|AAP22070.1| eukaryotic translation initiation factor 3 subunit k [Homo sapiens]
 gb|EAW56807.1| eukaryotic translation initiation factor 3, subunit 12, isoform 
CRA_e [Homo sapiens]
 dbj|BAF82243.1| unnamed protein product [Homo sapiens]
 gb|ADQ31730.1| eukaryotic translation initiation factor 3, subunit 12 [synthetic 
construct]
 gb|EHH30007.1| hypothetical protein EGK_10573 [Macaca mulatta]
 gb|EHH62632.1| hypothetical protein EGM_21023 [Macaca fascicularis]
 gb|AIC51222.1| EIF3K, partial [synthetic construct]
Length=218

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_010961754.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Camelus bactrianus]
Length=218

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008544532.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Microplitis demolitor]
Length=218

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +2

Query  140  EQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            E +  +  YNPD LP LE YV  Q     Y+L+ANL +L+LYQ  P
Sbjct  11   EMIKGIERYNPDHLPTLEQYVEVQTRENAYDLEANLTVLKLYQLNP  56



>gb|AAD40193.1| HSPC029 [Homo sapiens]
Length=218

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004441546.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform 1 [Ceratotherium simum simum]
Length=231

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_002762132.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X3 [Callithrix jacchus]
 ref|XP_003937499.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Saimiri boliviensis boliviensis]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_003127167.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Sus scrofa]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008628370.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Corvus brachyrhynchos]
Length=221

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  134  TVEQLIVVNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            TV+  +    YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  40   TVQGGVPCARYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  87



>ref|XP_008072222.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Tarsius syrichta]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006871519.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Chrysochloris asiatica]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|NP_001029661.1| eukaryotic translation initiation factor 3 subunit K [Bos taurus]
 ref|XP_533679.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform 1 [Canis lupus familiaris]
 ref|XP_001497262.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Equus caballus]
 ref|XP_003997878.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Felis catus]
 ref|XP_004015279.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Ovis aries]
 ref|XP_004396473.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Odobenus rosmarus divergens]
 ref|XP_004659945.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Jaculus jaculus]
 ref|XP_004776290.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Mustela putorius furo]
 ref|XP_004810354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Mustela putorius furo]
 ref|XP_005692433.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Capra hircus]
 ref|XP_005860679.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Myotis brandtii]
 ref|XP_006096729.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Myotis lucifugus]
 ref|XP_006215120.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Vicugna pacos]
 ref|XP_006761501.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Myotis davidii]
 ref|XP_006739439.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Leptonychotes weddellii]
 ref|XP_006911770.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Pteropus alecto]
 ref|XP_007096946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Panthera tigris altaica]
 ref|XP_008505698.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Equus przewalskii]
 ref|XP_010847497.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Bison bison bison]
 ref|XP_011370569.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Pteropus vampyrus]
 sp|Q3T0V3.1|EIF3K_BOVIN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 12; AltName: Full=eIF-3 p25 [Bos taurus]
 gb|AAI02251.1| Eukaryotic translation initiation factor 3, subunit K [Bos taurus]
 tpg|DAA19932.1| TPA: eukaryotic translation initiation factor 3 subunit K [Bos 
taurus]
 gb|ELK32019.1| Eukaryotic translation initiation factor 3 subunit K [Myotis 
davidii]
 gb|EPQ04187.1| Eukaryotic translation initiation factor 3 subunit K [Myotis 
brandtii]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_010993324.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit K [Camelus dromedarius]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006196078.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3, subunit K [Camelus ferus]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004388196.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Trichechus manatus latirostris]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_003420815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Loxodonta africana]
 ref|XP_004284300.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform 2 [Orcinus orca]
 ref|XP_004318571.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform 2 [Tursiops truncatus]
 ref|XP_007129964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Physeter catodon]
 ref|XP_007180081.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Balaenoptera acutorostrata scammoni]
 ref|XP_007471139.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Lipotes vexillifer]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004441547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform 2 [Ceratotherium simum simum]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006941361.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Felis catus]
Length=220

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008137858.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Eptesicus fuscus]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_002711547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Oryctolagus cuniculus]
 ref|XP_006068766.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Bubalus bubalis]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006899758.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Elephantulus edwardii]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004715829.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Echinops telfairi]
Length=218

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008686895.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit K [Ursus maritimus]
Length=215

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_003467292.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Cavia porcellus]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004595137.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Ochotona princeps]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>gb|EAW56804.1| eukaryotic translation initiation factor 3, subunit 12, isoform 
CRA_b [Homo sapiens]
Length=161

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  12   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  52



>ref|XP_006161788.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit K [Tupaia chinensis]
Length=219

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>gb|ELK12859.1| Eukaryotic translation initiation factor 3 subunit K [Pteropus 
alecto]
Length=216

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  16   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  56



>ref|NP_082935.1| eukaryotic translation initiation factor 3 subunit K isoform 
1 [Mus musculus]
 sp|Q9DBZ5.1|EIF3K_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
K; Short=eIF3k; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 12; AltName: Full=eIF-3 p25 [Mus musculus]
 dbj|BAB23454.1| unnamed protein product [Mus musculus]
 gb|AAH91749.1| Eukaryotic translation initiation factor 3, subunit K [Mus musculus]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_005860680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Myotis brandtii]
Length=207

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_007068346.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Chelonia mydas]
Length=239

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (49%), Gaps = 16/76 (21%)
 Frame = +2

Query  50   PAGVACLNKLQKMGREVAGQNQPSALSYTVEQLIVVNPYNPDILPDLENYVNEQVSSQTY  229
            P G +C +  +  G+ V+G                +  YNP+ L  LE YV  Q     Y
Sbjct  20   PEGESCRHVGRHSGQLVSG----------------IEWYNPENLATLERYVETQAKENAY  63

Query  230  NLDANLCLLRLYQFEP  277
            +L+ANL +L+LYQF P
Sbjct  64   DLEANLAVLKLYQFNP  79



>ref|XP_004877152.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Heterocephalus glaber]
 gb|EHA98171.1| Eukaryotic translation initiation factor 3 subunit K [Heterocephalus 
glaber]
Length=213

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008852140.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Nannospalax galili]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004481485.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Dasypus novemcinctus]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008986198.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X4 [Callithrix jacchus]
Length=216

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_004600816.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Sorex araneus]
 ref|XP_005371311.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Microtus ochrogaster]
 ref|XP_005340558.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Ictidomys tridecemlineatus]
 ref|XP_007642576.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Cricetulus griseus]
 ref|XP_007625302.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X2 [Cricetulus griseus]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_003796205.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Otolemur garnettii]
 ref|XP_004636840.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Octodon degus]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_002925888.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Ailuropoda melanoleuca]
Length=218

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_005910211.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Bos mutus]
Length=216

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>dbj|BAH14715.1| unnamed protein product [Homo sapiens]
Length=211

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006982045.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Peromyscus maniculatus bairdii]
Length=218

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_008986196.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Callithrix jacchus]
Length=236

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006228777.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K isoform X1 [Rattus norvegicus]
 gb|EDM07860.1| eukaryotic translation initiation factor 3, subunit 12 (predicted), 
isoform CRA_a [Rattus norvegicus]
Length=218

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_006265001.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Alligator mississippiensis]
Length=218

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



>ref|XP_005311518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
K [Chrysemys picta bellii]
Length=218

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  VNPYNPDILPDLENYVNEQVSSQTYNLDANLCLLRLYQFEP  277
            ++ YNP+ L  LE YV  Q     Y+L+ANL +L+LYQF P
Sbjct  18   IDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNP  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557915310750