BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004E09

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008339515.1|  PREDICTED: importin-4                              243   8e-79   
ref|XP_011087739.1|  PREDICTED: importin-4 isoform X2                   260   1e-78   Sesamum indicum [beniseed]
ref|XP_011087737.1|  PREDICTED: importin-4 isoform X1                   261   4e-78   Sesamum indicum [beniseed]
gb|EYU26532.1|  hypothetical protein MIMGU_mgv1a000599mg                258   4e-77   Erythranthe guttata [common monkey flower]
gb|EYU26531.1|  hypothetical protein MIMGU_mgv1a000599mg                258   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_010683344.1|  PREDICTED: importin-4                              254   6e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO53025.1|  hypothetical protein CISIN_1g001584mg                   250   1e-75   Citrus sinensis [apfelsine]
gb|AES63260.2|  importin beta-4                                         253   2e-75   Medicago truncatula
ref|XP_009780008.1|  PREDICTED: importin-4                              253   2e-75   Nicotiana sylvestris
gb|KJB60880.1|  hypothetical protein B456_009G329500                    253   2e-75   Gossypium raimondii
gb|KJB60881.1|  hypothetical protein B456_009G329500                    253   2e-75   Gossypium raimondii
ref|XP_009616452.1|  PREDICTED: importin-4                              253   2e-75   Nicotiana tomentosiformis
gb|KHG04365.1|  putative importin subunit beta-4                        253   2e-75   Gossypium arboreum [tree cotton]
emb|CDO97558.1|  unnamed protein product                                253   2e-75   Coffea canephora [robusta coffee]
emb|CAN76102.1|  hypothetical protein VITISV_007422                     252   5e-75   Vitis vinifera
ref|XP_002267673.1|  PREDICTED: importin-4                              252   6e-75   Vitis vinifera
ref|XP_007045325.1|  ARM repeat superfamily protein isoform 3           250   6e-75   
gb|KDP24688.1|  hypothetical protein JCGZ_26509                         251   1e-74   Jatropha curcas
ref|XP_010268961.1|  PREDICTED: importin-4-like isoform X2              249   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_006437504.1|  hypothetical protein CICLE_v10030583mg             251   2e-74   Citrus clementina [clementine]
gb|KDO53021.1|  hypothetical protein CISIN_1g001584mg                   250   2e-74   Citrus sinensis [apfelsine]
gb|KDO53024.1|  hypothetical protein CISIN_1g001584mg                   250   2e-74   Citrus sinensis [apfelsine]
ref|XP_006484649.1|  PREDICTED: importin-4-like isoform X1              250   2e-74   Citrus sinensis [apfelsine]
gb|KDO53023.1|  hypothetical protein CISIN_1g001584mg                   250   2e-74   Citrus sinensis [apfelsine]
ref|XP_004485490.1|  PREDICTED: importin-4-like                         250   2e-74   Cicer arietinum [garbanzo]
ref|XP_010268960.1|  PREDICTED: importin-4-like isoform X1              250   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_007148515.1|  hypothetical protein PHAVU_006G215200g             249   4e-74   Phaseolus vulgaris [French bean]
ref|XP_007045323.1|  ARM repeat superfamily protein isoform 1           249   4e-74   
ref|XP_006349374.1|  PREDICTED: importin-4-like                         249   5e-74   Solanum tuberosum [potatoes]
ref|XP_004230489.1|  PREDICTED: importin-4                              249   6e-74   Solanum lycopersicum
ref|XP_011465757.1|  PREDICTED: probable importin subunit beta-4        249   6e-74   Fragaria vesca subsp. vesca
gb|KHN33455.1|  Putative importin subunit beta-4                        248   9e-74   Glycine soja [wild soybean]
ref|XP_003547537.1|  PREDICTED: importin-4-like                         248   1e-73   Glycine max [soybeans]
emb|CAB38276.1|  putative protein                                       243   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103905.1|  putative importin subunit beta-4                   248   1e-73   Morus notabilis
ref|XP_007225401.1|  hypothetical protein PRUPE_ppa000660mg             248   1e-73   Prunus persica
ref|XP_008218783.1|  PREDICTED: importin-4                              248   2e-73   Prunus mume [ume]
ref|XP_002312242.1|  importin beta-2 subunit family protein             248   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_009355231.1|  PREDICTED: importin-4-like                         246   6e-73   Pyrus x bretschneideri [bai li]
ref|XP_011017066.1|  PREDICTED: importin-4-like                         245   1e-72   Populus euphratica
ref|XP_008456074.1|  PREDICTED: importin-4                              245   1e-72   Cucumis melo [Oriental melon]
ref|XP_010243480.1|  PREDICTED: importin-4-like                         244   2e-72   Nelumbo nucifera [Indian lotus]
gb|KCW57080.1|  hypothetical protein EUGRSUZ_I02730                     244   3e-72   Eucalyptus grandis [rose gum]
ref|XP_010433332.1|  PREDICTED: importin-4-like                         244   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010030114.1|  PREDICTED: importin-4                              244   4e-72   Eucalyptus grandis [rose gum]
ref|XP_006283050.1|  hypothetical protein CARUB_v10004045mg             244   4e-72   Capsella rubella
ref|XP_004146264.1|  PREDICTED: probable importin subunit beta-4-...    244   4e-72   Cucumis sativus [cucumbers]
ref|XP_002867489.1|  importin beta-2 subunit family protein             244   5e-72   Arabidopsis lyrata subsp. lyrata
gb|KCW57078.1|  hypothetical protein EUGRSUZ_I02730                     243   5e-72   Eucalyptus grandis [rose gum]
ref|XP_009137675.1|  PREDICTED: importin-4-like                         243   6e-72   Brassica rapa
ref|XP_006413052.1|  hypothetical protein EUTSA_v10024293mg             243   6e-72   Eutrema salsugineum [saltwater cress]
emb|CDY56328.1|  BnaC07g50410D                                          243   7e-72   Brassica napus [oilseed rape]
ref|NP_194494.2|  ARM repeat superfamily protein                        243   7e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29849.1|  BnaA03g48700D                                          243   1e-71   Brassica napus [oilseed rape]
ref|XP_011013548.1|  PREDICTED: importin-4-like                         243   1e-71   Populus euphratica
ref|XP_009347180.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4-like    243   1e-71   
gb|KFK29275.1|  hypothetical protein AALP_AA7G112200                    242   1e-71   Arabis alpina [alpine rockcress]
ref|XP_002315055.1|  importin beta-2 subunit family protein             242   2e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010528662.1|  PREDICTED: importin-4                              241   2e-71   Tarenaya hassleriana [spider flower]
emb|CDY19045.1|  BnaC01g20230D                                          241   3e-71   Brassica napus [oilseed rape]
ref|XP_009143709.1|  PREDICTED: importin-4                              241   4e-71   Brassica rapa
emb|CDY52993.1|  BnaAnng11870D                                          241   4e-71   Brassica napus [oilseed rape]
ref|XP_003532985.1|  PREDICTED: importin-4-like isoform X1              239   2e-70   Glycine max [soybeans]
ref|XP_009410571.1|  PREDICTED: probable importin subunit beta-4 ...    238   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010451154.1|  PREDICTED: importin-4-like                         237   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009410572.1|  PREDICTED: probable importin subunit beta-4 ...    238   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438570.1|  PREDICTED: importin-4-like                         235   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004984713.1|  PREDICTED: importin-4-like                         235   5e-69   Setaria italica
ref|XP_008801050.1|  PREDICTED: LOW QUALITY PROTEIN: probable imp...    234   8e-69   Phoenix dactylifera
ref|XP_010916537.1|  PREDICTED: importin-4                              234   2e-68   Elaeis guineensis
ref|XP_002465518.1|  hypothetical protein SORBIDRAFT_01g040400          234   2e-68   Sorghum bicolor [broomcorn]
ref|XP_006838378.1|  hypothetical protein AMTR_s00002p00059110          233   3e-68   Amborella trichopoda
gb|AAP06844.1|  unknown protein                                         230   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645429.1|  PREDICTED: uncharacterized protein LOC100383...    230   3e-67   
tpg|DAA44500.1|  TPA: hypothetical protein ZEAMMB73_199165              230   3e-67   
gb|EEC74901.1|  hypothetical protein OsI_10833                          230   3e-67   Oryza sativa Indica Group [Indian rice]
gb|EEE58734.1|  hypothetical protein OsJ_10217                          230   4e-67   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44499.1|  TPA: hypothetical protein ZEAMMB73_199165              229   1e-66   
ref|XP_003558305.1|  PREDICTED: importin-4                              226   8e-66   Brachypodium distachyon [annual false brome]
gb|EMS63391.1|  Importin-4                                              195   3e-55   Triticum urartu
ref|XP_001771868.1|  predicted protein                                  182   6e-50   
ref|XP_002961696.1|  hypothetical protein SELMODRAFT_140759             165   5e-44   
ref|XP_002964764.1|  hypothetical protein SELMODRAFT_83420              165   5e-44   
ref|XP_006651232.1|  PREDICTED: importin-4-like                         162   8e-43   
ref|XP_001622543.1|  hypothetical protein NEMVEDRAFT_v1g248390          109   2e-24   Nematostella vectensis
ref|XP_002506707.1|  predicted protein                                  109   2e-24   Micromonas commoda
ref|XP_003058470.1|  predicted protein                                  103   4e-22   Micromonas pusilla CCMP1545
emb|CCF48655.1|  related to KAP123-Importin beta-4 subunit              100   5e-21   Ustilago hordei
gb|ELT89259.1|  hypothetical protein CAPTEDRAFT_159396                99.4    8e-21   Capitella teleta
gb|EST08799.1|  hypothetical protein PSEUBRA_SCAF14g01539             99.4    8e-21   Kalmanozyma brasiliensis GHG001
ref|XP_002604692.1|  hypothetical protein BRAFLDRAFT_228853           99.0    1e-20   Branchiostoma floridae
ref|XP_006008363.1|  PREDICTED: importin-4                            97.8    3e-20   
emb|CBQ68976.1|  related to KAP123-Importin beta-4 subunit            97.8    3e-20   Sporisorium reilianum SRZ2
gb|ETS60182.1|  hypothetical protein PaG_05723                        97.8    3e-20   Moesziomyces aphidis DSM 70725
dbj|GAC77604.1|  defender against cell death protein                  97.4    3e-20   Moesziomyces antarcticus T-34
dbj|GAC94860.1|  hypothetical protein PHSY_002433                     97.4    4e-20   Pseudozyma hubeiensis SY62
emb|CDI55053.1|  related to KAP123-Importin beta-4 subunit            94.7    2e-19   Melanopsichium pennsylvanicum 4
ref|XP_002953478.1|  hypothetical protein VOLCADRAFT_94324            95.1    3e-19   Volvox carteri f. nagariensis
dbj|GAK66523.1|  ARM repeat-containing protein                        94.4    5e-19   Moesziomyces antarcticus
ref|XP_646718.1|  importin 4                                          94.0    6e-19   Dictyostelium discoideum AX4
ref|XP_006824744.1|  PREDICTED: importin-4-like                       93.6    8e-19   Saccoglossus kowalevskii
ref|XP_011391028.1|  hypothetical protein UMAG_15014                  92.8    2e-18   Ustilago maydis 521
ref|XP_007877108.1|  hypothetical protein PFL1_01415                  91.7    4e-18   Anthracocystis flocculosa PF-1
ref|XP_004363945.2|  hypothetical protein CAOG_03106                  91.7    4e-18   Capsaspora owczarzaki ATCC 30864
gb|EWM29705.1|  Importin-beta                                         90.5    9e-18   Nannochloropsis gaditana
gb|AAH80889.1|  importin 4                                            89.7    1e-17   Xenopus tropicalis [western clawed frog]
gb|EFX65679.1|  hypothetical protein DAPPUDRAFT_303554                89.7    2e-17   Daphnia pulex
gb|KIJ55832.1|  hypothetical protein M422DRAFT_63753                  89.4    2e-17   Sphaerobolus stellatus SS14
ref|NP_001008011.2|  importin-4                                       89.4    2e-17   Xenopus tropicalis [western clawed frog]
gb|EFA85401.1|  importin 4                                            89.0    3e-17   Heterostelium album PN500
ref|XP_005648058.1|  ARM repeat-containing protein                    88.6    4e-17   Coccomyxa subellipsoidea C-169
ref|XP_011402444.1|  PREDICTED: importin-4-like                       87.8    7e-17   
ref|XP_008436898.1|  PREDICTED: importin-4                            87.8    9e-17   Poecilia reticulata
ref|XP_010779271.1|  PREDICTED: importin-4                            87.4    1e-16   Notothenia coriiceps [yellowbelly rockcod]
dbj|GAM20378.1|  hypothetical protein SAMD00019534_035530             87.4    1e-16   Acytostelium subglobosum LB1
ref|XP_005096783.1|  PREDICTED: importin-4-like                       87.0    1e-16   Aplysia californica
ref|XP_004081009.1|  PREDICTED: importin-4                            86.3    2e-16   Oryzias latipes [Japanese rice fish]
ref|XP_007548008.1|  PREDICTED: importin-4                            86.3    3e-16   Poecilia formosa
ref|XP_005803702.1|  PREDICTED: importin-4-like                       85.5    4e-16   Xiphophorus maculatus
gb|KDQ11917.1|  hypothetical protein BOTBODRAFT_34989                 85.5    5e-16   Botryobasidium botryosum FD-172 SS1
ref|XP_001199451.2|  PREDICTED: importin-4-like                       81.6    8e-16   
ref|XP_009494320.1|  hypothetical protein H696_02149                  84.7    8e-16   Fonticula alba
ref|XP_009515678.1|  hypothetical protein PHYSODRAFT_471015           84.7    9e-16   Phytophthora sojae
ref|XP_009268036.1|  putative importin subunit beta-4                 84.3    1e-15   Wallemia ichthyophaga EXF-994
gb|ETP46722.1|  hypothetical protein F442_07089                       80.9    2e-15   Phytophthora parasitica P10297
ref|XP_002906616.1|  importin-like protein                            84.0    2e-15   Phytophthora infestans T30-4
ref|XP_004344724.1|  HEAT repeat domain containing protein            83.6    2e-15   Acanthamoeba castellanii str. Neff
emb|CBN81817.1|  Importin-4                                           83.2    3e-15   Dicentrarchus labrax [European sea bass]
emb|CBJ48489.1|  ran binding protein 4-like protein                   83.2    3e-15   Ectocarpus siliculosus
ref|XP_005837332.1|  hypothetical protein GUITHDRAFT_104162           82.4    4e-15   Guillardia theta CCMP2712
emb|CCA20225.1|  importinlike protein putative                        82.4    6e-15   Albugo laibachii Nc14
gb|KIY62189.1|  ARM repeat-containing protein                         82.4    6e-15   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_008857732.1|  HEAT repeat domain containing protein            82.0    7e-15   Entamoeba nuttalli P19
ref|XP_649419.2|  HEAT repeat domain containing protein               82.0    8e-15   Entamoeba histolytica HM-1:IMSS
ref|XP_003443579.1|  PREDICTED: importin-4 isoform X1                 81.6    9e-15   
ref|XP_002675525.1|  importin beta                                    81.6    9e-15   Naegleria gruberi strain NEG-M
gb|KDD75633.1|  hypothetical protein H632_c581p1                      80.5    1e-14   Helicosporidium sp. ATCC 50920
gb|KIO24659.1|  hypothetical protein M407DRAFT_8850                   80.1    1e-14   Tulasnella calospora MUT 4182
ref|XP_001734636.1|  importin beta-4                                  81.3    1e-14   Entamoeba dispar SAW760
ref|XP_004546523.1|  PREDICTED: importin-4-like                       81.3    1e-14   
gb|KFH65491.1|  hypothetical protein MVEG_08969                       81.3    1e-14   Mortierella verticillata NRRL 6337
ref|XP_006794796.1|  PREDICTED: importin-4-like                       81.3    1e-14   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005722478.1|  PREDICTED: importin-4-like                       81.3    1e-14   Pundamilia nyererei
ref|XP_005942469.1|  PREDICTED: importin-4-like                       81.3    1e-14   Haplochromis burtoni
ref|XP_010739919.1|  PREDICTED: importin-4                            80.5    2e-14   
ref|XP_008903634.1|  hypothetical protein PPTG_10113                  80.5    2e-14   Phytophthora parasitica INRA-310
ref|XP_008276178.1|  PREDICTED: importin-4                            79.7    4e-14   Stegastes partitus
ref|XP_002116144.1|  hypothetical protein TRIADDRAFT_60126            79.7    4e-14   Trichoplax adhaerens
emb|CCA67413.1|  related to KAP123-Importin beta-4 subunit            79.7    5e-14   Serendipita indica DSM 11827
ref|XP_011152708.1|  PREDICTED: importin-4-like                       79.7    5e-14   Harpegnathos saltator
ref|XP_684163.4|  PREDICTED: importin-4                               79.3    6e-14   Danio rerio [leopard danio]
emb|CDQ70384.1|  unnamed protein product                              78.6    1e-13   Oncorhynchus mykiss
emb|CCI47572.1|  unnamed protein product                              78.6    1e-13   Albugo candida
ref|XP_009066572.1|  hypothetical protein LOTGIDRAFT_229803           78.6    1e-13   Lottia gigantea
ref|XP_006955840.1|  ARM repeat-containing protein                    78.6    1e-13   Wallemia mellicola CBS 633.66
ref|XP_010884099.1|  PREDICTED: importin-4                            78.6    1e-13   Esox lucius
ref|XP_002770260.1|  DEHA2D04026p                                     78.2    1e-13   Debaryomyces hansenii CBS767
emb|CDQ85517.1|  unnamed protein product                              78.2    1e-13   Oncorhynchus mykiss
gb|KIY92330.1|  hypothetical protein MNEG_15633                       72.8    2e-13   Monoraphidium neglectum
gb|ESA16297.1|  hypothetical protein GLOINDRAFT_333841                77.8    2e-13   
ref|XP_003326810.2|  hypothetical protein PGTG_08347                  77.4    2e-13   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007008011.1|  hypothetical protein TREMEDRAFT_41072            77.4    3e-13   Tremella mesenterica DSM 1558
ref|XP_007401510.1|  hypothetical protein PHACADRAFT_178877           77.4    3e-13   Phanerochaete carnosa HHB-10118-sp
ref|XP_007366711.1|  ARM repeat-containing protein                    77.4    3e-13   Dichomitus squalens LYAD-421 SS1
gb|KII85896.1|  hypothetical protein PLICRDRAFT_44321                 77.0    3e-13   Plicaturopsis crispa FD-325 SS-3
ref|XP_001732250.1|  hypothetical protein MGL_0025                    77.0    4e-13   Malassezia globosa CBS 7966
ref|XP_003283123.1|  hypothetical protein DICPUDRAFT_146718           76.6    4e-13   Dictyostelium purpureum
ref|XP_003867998.1|  karyopherin beta                                 76.6    4e-13   Candida orthopsilosis Co 90-125
gb|KDO29492.1|  hypothetical protein SPRG_06032                       76.6    4e-13   Saprolegnia parasitica CBS 223.65
ref|XP_002430332.1|  Importin-4, putative                             76.6    5e-13   Pediculus humanus corporis [human body lice]
ref|XP_009037354.1|  hypothetical protein AURANDRAFT_64547            76.6    5e-13   Aureococcus anophagefferens
gb|EPS73729.1|  hypothetical protein M569_01025                       76.3    6e-13   Genlisea aurea
ref|XP_008609531.1|  hypothetical protein SDRG_05586                  76.3    7e-13   Saprolegnia diclina VS20
ref|XP_007340470.1|  ARM repeat-containing protein                    75.9    8e-13   
gb|EFA01438.1|  hypothetical protein TcasGA2_TC030696                 75.9    8e-13   
ref|XP_001812612.1|  PREDICTED: importin-4-like                       75.9    8e-13   Tribolium castaneum [rust-red flour beetle]
ref|XP_007327210.1|  hypothetical protein AGABI1DRAFT_54916           75.9    8e-13   Agaricus bisporus var. burnettii JB137-S8
ref|XP_003967995.1|  PREDICTED: importin-4-like                       75.9    8e-13   Takifugu rubripes [tiger puffer]
emb|CCU98606.1|  unnamed protein product                              75.9    9e-13   Malassezia sympodialis ATCC 42132
ref|XP_006461983.1|  hypothetical protein AGABI2DRAFT_206092          75.9    9e-13   Agaricus bisporus var. bisporus H97
ref|XP_005777741.1|  hypothetical protein EMIHUDRAFT_469192           75.5    1e-12   Emiliania huxleyi CCMP1516
ref|XP_003484719.1|  PREDICTED: importin-4-like                       75.1    1e-12   Bombus impatiens
ref|XP_011066781.1|  PREDICTED: importin-4-like isoform X1            75.1    1e-12   Acromyrmex echinatior
ref|XP_002160486.2|  PREDICTED: importin-4-like                       74.3    1e-12   
ref|XP_003396611.1|  PREDICTED: importin-4-like                       75.1    2e-12   
ref|XP_008305734.1|  PREDICTED: importin-4                            75.1    2e-12   
ref|XP_004199626.1|  Piso0_002165                                     74.7    2e-12   
ref|XP_009549591.1|  hypothetical protein HETIRDRAFT_478785           74.7    2e-12   Heterobasidion irregulare TC 32-1
gb|EMT12518.1|  Importin-4                                            73.9    4e-12   
ref|XP_007874054.1|  hypothetical protein PNEG_02074                  73.9    4e-12   Pneumocystis murina B123
ref|XP_002289991.1|  ran binding protein 4-like protein               73.9    4e-12   Thalassiosira pseudonana CCMP1335
ref|XP_004198776.1|  Piso0_002165                                     73.6    5e-12   
ref|XP_454889.1|  hypothetical protein                                73.6    5e-12   Kluyveromyces lactis
gb|KIM27775.1|  hypothetical protein M408DRAFT_329735                 73.2    7e-12   Serendipita vermifera MAFF 305830
dbj|BAO42691.1|  importin subunit beta-4                              72.8    8e-12   Kluyveromyces marxianus DMKU3-1042
emb|CDO68179.1|  hypothetical protein BN946_scf184938.g31             72.8    9e-12   Trametes cinnabarina
ref|XP_011329441.1|  PREDICTED: importin-4-like isoform X2            72.8    9e-12   Ooceraea biroi
ref|XP_011329440.1|  PREDICTED: importin-4-like isoform X1            72.8    9e-12   Ooceraea biroi
emb|CCG82267.1|  Karyopherin Kap123                                   72.4    1e-11   Taphrina deformans PYCC 5710
gb|AAT44183.1|  hypothetical protein                                  69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CDS14373.1|  hypothetical protein LRAMOSA06542                    72.0    2e-11   Lichtheimia ramosa
ref|XP_007865435.1|  ARM repeat-containing protein                    71.6    2e-11   Gloeophyllum trabeum ATCC 11539
ref|XP_001978848.1|  GG12549                                          71.6    2e-11   Drosophila erecta
emb|CDO95036.1|  unnamed protein product                              71.6    2e-11   Kluyveromyces dobzhanskii CBS 2104
ref|XP_007098087.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4       71.6    2e-11   
ref|XP_002839159.1|  hypothetical protein                             71.6    2e-11   Tuber melanosporum Mel28
ref|XP_001120827.3|  PREDICTED: importin-5-like                       71.6    2e-11   
ref|XP_006622037.1|  PREDICTED: importin-5-like                       71.6    2e-11   Apis dorsata [rock honeybee]
ref|XP_003696532.1|  PREDICTED: importin-5                            71.6    2e-11   
gb|EIF46213.1|  ran binding protein                                   71.6    3e-11   Brettanomyces bruxellensis AWRI1499
emb|CCJ29687.1|  unnamed protein product                              70.9    4e-11   Pneumocystis jirovecii
gb|EJK49994.1|  hypothetical protein THAOC_31080                      70.9    4e-11   Thalassiosira oceanica
emb|CCK69452.1|  hypothetical protein KNAG_0C03450                    70.5    5e-11   Kazachstania naganishii CBS 8797
ref|XP_011273450.1|  Ran-binding protein 6                            70.5    5e-11   Wickerhamomyces ciferrii
emb|CCE40704.1|  hypothetical protein CPAR2_107390                    70.5    6e-11   Candida parapsilosis
ref|XP_007304122.1|  ARM repeat-containing protein                    70.5    6e-11   Stereum hirsutum FP-91666 SS1
ref|XP_002550511.1|  conserved hypothetical protein                   70.5    6e-11   Candida tropicalis MYA-3404
emb|CCC86696.1|  karyopherin beta                                     66.6    7e-11   Millerozyma farinosa
gb|EMD38718.1|  hypothetical protein CERSUDRAFT_112448                70.1    7e-11   Gelatoporia subvermispora B
ref|XP_011501436.1|  PREDICTED: importin-4-like                       70.1    8e-11   Ceratosolen solmsi marchali
emb|CBN80552.1|  karyopherin beta                                     66.2    8e-11   Millerozyma farinosa
ref|XP_002616989.1|  hypothetical protein CLUG_02433                  70.1    8e-11   Clavispora lusitaniae ATCC 42720
emb|CCC86701.1|  karyopherin beta                                     66.2    9e-11   Millerozyma miso
ref|XP_004164755.1|  PREDICTED: importin-5-like                       69.7    9e-11   
gb|KGN54027.1|  hypothetical protein Csa_4G268110                     69.7    9e-11   Cucumis sativus [cucumbers]
ref|XP_006858951.1|  hypothetical protein AMTR_s00068p00103300        69.7    1e-10   
gb|KJA23606.1|  hypothetical protein HYPSUDRAFT_583175                69.7    1e-10   Hypholoma sublateritium FD-334 SS-4
ref|XP_008550092.1|  PREDICTED: importin-5                            69.7    1e-10   Microplitis demolitor
emb|CBN80554.1|  karyopherin beta                                     66.2    1e-10   Millerozyma miso
ref|XP_004149646.1|  PREDICTED: LOW QUALITY PROTEIN: importin-5-like  69.7    1e-10   
ref|XP_008449884.1|  PREDICTED: importin-5                            69.7    1e-10   Cucumis melo [Oriental melon]
emb|CBN80553.1|  karyopherin beta                                     65.9    1e-10   Millerozyma farinosa
ref|XP_003667555.1|  hypothetical protein NDAI_0A01540                69.3    1e-10   Naumovozyma dairenensis CBS 421
ref|XP_001526900.1|  conserved hypothetical protein                   69.3    1e-10   Lodderomyces elongisporus NRRL YB-4239
gb|EPT01260.1|  hypothetical protein FOMPIDRAFT_154393                69.3    1e-10   Fomitopsis pinicola FP-58527 SS1
gb|ESX02042.1|  Importin subunit beta-4                               69.3    1e-10   Ogataea parapolymorpha DL-1
ref|XP_006685749.1|  hypothetical protein CANTEDRAFT_103297           69.3    1e-10   Yamadazyma tenuis ATCC 10573
ref|XP_003987556.3|  PREDICTED: importin-4                            69.3    1e-10   
gb|KDR15912.1|  Importin-4                                            69.3    1e-10   Zootermopsis nevadensis
ref|XP_011089154.1|  PREDICTED: LOW QUALITY PROTEIN: importin-5-like  69.3    1e-10   Sesamum indicum [beniseed]
ref|XP_010598869.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4       69.3    2e-10   
ref|XP_007410567.1|  hypothetical protein MELLADRAFT_43549            68.9    2e-10   Melampsora larici-populina 98AG31
ref|XP_011314194.1|  PREDICTED: importin-4-like                       68.9    2e-10   Fopius arisanus
ref|XP_007783482.1|  hypothetical protein W97_07314                   68.9    2e-10   Coniosporium apollinis CBS 100218
ref|XP_003702194.1|  PREDICTED: importin-4-like                       68.9    2e-10   Megachile rotundata
ref|XP_010535931.1|  PREDICTED: importin-5-like                       68.9    2e-10   Tarenaya hassleriana [spider flower]
gb|EDK37470.2|  hypothetical protein PGUG_01568                       68.9    2e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_001485897.1|  hypothetical protein PGUG_01568                  68.9    2e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_005840903.1|  hypothetical protein GUITHDRAFT_41061            68.6    2e-10   Guillardia theta CCMP2712
ref|XP_002495117.1|  ZYRO0B03718p                                     68.6    2e-10   Zygosaccharomyces rouxii
ref|XP_009044446.1|  hypothetical protein LOTGIDRAFT_184912           68.6    2e-10   Lottia gigantea
emb|CCC86695.1|  karyopherin beta                                     65.1    2e-10   Millerozyma farinosa
emb|CBN80555.1|  karyopherin beta                                     64.7    3e-10   Millerozyma farinosa
ref|XP_002174798.1|  karyopherin Kap123                               68.2    3e-10   Schizosaccharomyces japonicus yFS275
ref|XP_010493059.1|  PREDICTED: importin-5-like                       68.2    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006217341.1|  PREDICTED: importin-4                            68.2    3e-10   Vicugna pacos
ref|XP_003680368.1|  hypothetical protein TDEL_0C02680                68.2    3e-10   Torulaspora delbrueckii
ref|XP_002490067.1|  Karyopherin beta, mediates nuclear import of...  68.2    3e-10   Komagataella phaffii GS115
ref|XP_007382655.1|  ARM repeat-containing protein                    68.2    3e-10   Punctularia strigosozonata HHB-11173 SS5
ref|XP_004255148.1|  importin-4, putative                             68.2    3e-10   Entamoeba invadens IP1
ref|XP_005651022.1|  ARM repeat-containing protein                    68.2    3e-10   Coccomyxa subellipsoidea C-169
ref|XP_007372743.1|  ran binding protein                              68.2    3e-10   Spathaspora passalidarum NRRL Y-27907
ref|XP_718593.1|  hypothetical protein CaO19.10025                    68.2    3e-10   
gb|EYU39259.1|  hypothetical protein MIMGU_mgv1a000497mg              68.2    3e-10   Erythranthe guttata [common monkey flower]
gb|KGU33928.1|  hypothetical protein MG7_00538                        68.2    3e-10   Candida albicans P34048
gb|KGU14893.1|  hypothetical protein MEQ_00542                        68.2    3e-10   Candida albicans P87
gb|KGR03762.1|  hypothetical protein MG1_00548                        68.2    3e-10   Candida albicans GC75
gb|KGQ91818.1|  hypothetical protein MEO_00546                        68.2    3e-10   Candida albicans P94015
gb|EZA45052.1|  importin-5-like protein                               68.2    3e-10   
ref|XP_010994072.1|  PREDICTED: importin-4                            68.2    3e-10   Camelus dromedarius [camel]
gb|EEQ42624.1|  conserved hypothetical protein                        68.2    4e-10   Candida albicans WO-1
gb|KHC43385.1|  hypothetical protein MGQ_00540                        68.2    4e-10   Candida albicans P76067
gb|KGU17562.1|  hypothetical protein MEY_00550                        68.2    4e-10   Candida albicans 19F
gb|KGR21583.1|  hypothetical protein MG3_00590                        68.2    4e-10   Candida albicans P78048
gb|KHC85149.1|  hypothetical protein MGS_00546                        68.2    4e-10   Candida albicans P78042
ref|XP_005823506.1|  hypothetical protein GUITHDRAFT_117306           67.8    4e-10   Guillardia theta CCMP2712
ref|XP_001387432.1|  ran binding protein                              67.8    4e-10   Scheffersomyces stipitis CBS 6054
ref|XP_003402055.1|  PREDICTED: importin-5-like                       67.8    4e-10   
gb|ERL84964.1|  hypothetical protein D910_02387                       67.8    5e-10   Dendroctonus ponderosae
ref|XP_005109294.1|  PREDICTED: importin-5-like                       67.8    5e-10   
gb|ENN75169.1|  hypothetical protein YQE_08282                        67.8    5e-10   
ref|XP_001874641.1|  predicted protein                                67.8    5e-10   
ref|XP_001776539.1|  predicted protein                                67.8    5e-10   
gb|EMS19247.1|  importin beta-4 subunit                               67.4    5e-10   
gb|KIK09016.1|  hypothetical protein K443DRAFT_672057                 67.4    5e-10   
gb|KDO54434.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
ref|XP_010454264.1|  PREDICTED: importin-5-like                       67.4    6e-10   
gb|KDO54439.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
gb|KDO54436.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
gb|KDO54435.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
gb|KDR80526.1|  hypothetical protein GALMADRAFT_240827                67.4    6e-10   
ref|XP_006445601.1|  hypothetical protein CICLE_v10014097mg           67.4    6e-10   
ref|XP_001647429.1|  hypothetical protein Kpol_1018p104               67.4    6e-10   
gb|KDO54438.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
gb|KIL69460.1|  hypothetical protein M378DRAFT_196110                 67.4    6e-10   
gb|KDO54437.1|  hypothetical protein CISIN_1g001249mg                 67.4    6e-10   
ref|XP_001831379.2|  importin beta-4 subunit                          67.4    6e-10   
ref|XP_007030074.1|  ARM repeat superfamily protein isoform 1         67.4    7e-10   
ref|XP_396270.4|  PREDICTED: importin-4-like                          67.0    7e-10   
ref|XP_001359375.1|  GA10419                                          67.0    7e-10   
ref|XP_007444444.1|  PREDICTED: importin-4-like                       67.0    7e-10   
gb|KIM44916.1|  hypothetical protein M413DRAFT_366261                 67.0    7e-10   
gb|EPS59891.1|  hypothetical protein M569_14914                       66.6    7e-10   
ref|XP_010420796.1|  PREDICTED: importin-5-like                       67.0    7e-10   
ref|XP_011103228.1|  kap123p                                          67.0    7e-10   
ref|XP_010953063.1|  PREDICTED: importin-4                            67.0    8e-10   
gb|KIM83108.1|  hypothetical protein PILCRDRAFT_450443                67.0    8e-10   
gb|KDP39689.1|  hypothetical protein JCGZ_02709                       67.0    8e-10   
ref|XP_002107595.1|  hypothetical protein TRIADDRAFT_51271            67.0    9e-10   
ref|XP_008038223.1|  ARM repeat-containing protein                    67.0    9e-10   
gb|KDQ49200.1|  hypothetical protein JAAARDRAFT_43038                 66.6    9e-10   
ref|XP_006611155.1|  PREDICTED: importin-4-like                       66.6    9e-10   
ref|XP_007904480.1|  PREDICTED: importin-5                            66.6    1e-09   
ref|XP_008231927.1|  PREDICTED: importin-5                            66.6    1e-09   
ref|XP_007204956.1|  hypothetical protein PRUPE_ppa000523mg           66.6    1e-09   
ref|XP_006643047.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4-like  66.2    1e-09   
ref|XP_010693819.1|  PREDICTED: importin-5-like                       66.6    1e-09   
ref|XP_003693033.1|  PREDICTED: importin-4-like                       66.6    1e-09   
ref|XP_002873965.1|  EMB2734                                          66.6    1e-09   
gb|EMG47821.1|  hypothetical protein G210_1733                        66.6    1e-09   
ref|XP_007770958.1|  ARM repeat-containing protein                    66.6    1e-09   
ref|XP_008117757.1|  PREDICTED: importin-4                            66.6    1e-09   
emb|CDH14258.1|  probable Importin subunit beta-4                     66.6    1e-09   
gb|KFK26216.1|  hypothetical protein AALP_AA8G217600                  66.2    1e-09   
ref|XP_009131753.1|  PREDICTED: importin-5-like                       66.2    1e-09   
gb|EJT96591.1|  ARM repeat-containing protein                         66.2    1e-09   
gb|KIR44631.1|  importin beta-4 subunit                               66.2    1e-09   
gb|EUC67179.1|  importin beta-4 subunit                               66.2    1e-09   
ref|XP_002281591.1|  PREDICTED: importin-5                            66.2    1e-09   
ref|XP_003707535.1|  PREDICTED: importin-5                            66.2    1e-09   
gb|EFZ18482.1|  hypothetical protein SINV_12652                       65.1    1e-09   
emb|CDH08963.1|  probable Importin subunit beta-4                     66.2    2e-09   
ref|XP_003492709.1|  PREDICTED: importin-5-like                       66.2    2e-09   
emb|CDF90780.1|  ZYBA0S08-02828g1_1                                   65.9    2e-09   
ref|NP_596729.1|  karyopherin Kap123                                  65.9    2e-09   
gb|EEU06348.1|  Kap123p                                               65.9    2e-09   
ref|XP_001998194.1|  GI23769                                          65.9    2e-09   
gb|EDN63085.1|  karyopherin beta 4                                    65.9    2e-09   
ref|XP_003194919.1|  importin beta-4 subunit                          65.9    2e-09   
gb|EHN07628.1|  Kap123p                                               65.9    2e-09   
gb|KIR82568.1|  importin beta-4 subunit                               65.9    2e-09   
gb|EIW10904.1|  Kap123p                                               65.9    2e-09   
dbj|GAA22957.1|  K7_Kap123p                                           65.9    2e-09   
ref|XP_005826888.1|  hypothetical protein GUITHDRAFT_164792           65.9    2e-09   
ref|XP_001944128.2|  PREDICTED: importin-4-like                       65.9    2e-09   
gb|AJP38380.1|  Kap123p                                               65.9    2e-09   
ref|XP_009834819.1|  hypothetical protein H257_10076                  65.9    2e-09   
gb|KJB83370.1|  hypothetical protein B456_013G244400                  65.5    2e-09   
gb|KIR86288.1|  importin beta-4 subunit                               65.9    2e-09   
ref|NP_197483.1|  protein EMBRYO DEFECTIVE 2734                       65.9    2e-09   
gb|KIR52681.1|  importin beta-4 subunit                               65.5    2e-09   
ref|XP_001627745.1|  predicted protein                                65.5    2e-09   
gb|KJB83371.1|  hypothetical protein B456_013G244400                  65.5    2e-09   
emb|CAY79294.1|  Kap123p                                              65.5    2e-09   
ref|NP_011035.1|  Kap123p                                             65.5    2e-09   
gb|KJB83373.1|  hypothetical protein B456_013G244400                  65.5    2e-09   
gb|AHY75670.1|  Kap123p                                               65.5    2e-09   
gb|KJB83372.1|  hypothetical protein B456_013G244400                  65.5    2e-09   
ref|XP_003064365.1|  predicted protein                                65.5    2e-09   
ref|XP_007261158.1|  ARM repeat-containing protein                    65.5    2e-09   
ref|XP_002961337.1|  hypothetical protein SELMODRAFT_140234           65.5    3e-09   
ref|XP_006286940.1|  hypothetical protein CARUB_v10000085mg           65.5    3e-09   
ref|XP_002676763.1|  karyopherin beta                                 65.5    3e-09   
ref|XP_007322483.1|  hypothetical protein SERLADRAFT_441859           65.5    3e-09   
ref|XP_002120695.1|  PREDICTED: importin-4-like                       65.5    3e-09   
ref|XP_011329748.1|  PREDICTED: importin-5                            65.5    3e-09   
ref|XP_011269700.1|  PREDICTED: importin-5 isoform X1                 65.1    3e-09   
ref|XP_011089727.1|  PREDICTED: importin-5-like                       65.1    3e-09   
gb|KJB83369.1|  hypothetical protein B456_013G244400                  65.1    3e-09   
gb|KFH71746.1|  hypothetical protein MVEG_02041                       65.1    3e-09   
ref|XP_006400541.1|  hypothetical protein EUTSA_v10012502mg           65.1    3e-09   
gb|KGB75825.1|  importin beta-4 subunit                               65.1    3e-09   
gb|KJB66060.1|  hypothetical protein B456_010G125900                  65.1    3e-09   
gb|EME49418.1|  hypothetical protein DOTSEDRAFT_163771                65.1    3e-09   
ref|XP_007030075.1|  ARM repeat superfamily protein isoform 2         65.1    3e-09   
gb|KJB66062.1|  hypothetical protein B456_010G125900                  65.1    3e-09   
gb|EHN02778.1|  Kap123p                                               65.1    3e-09   
ref|XP_011304534.1|  PREDICTED: importin-5                            65.1    3e-09   
gb|KFM60922.1|  Importin-4                                            64.7    3e-09   
ref|XP_010257630.1|  PREDICTED: importin-5                            65.1    3e-09   
ref|XP_009152475.1|  hypothetical protein HMPREF1120_00236            65.1    3e-09   
ref|XP_002983226.1|  hypothetical protein SELMODRAFT_155690           65.1    4e-09   
ref|XP_007673327.1|  hypothetical protein BAUCODRAFT_153902           65.1    4e-09   
gb|KJB66061.1|  hypothetical protein B456_010G125900                  65.1    4e-09   
gb|KJB66059.1|  hypothetical protein B456_010G125900                  65.1    4e-09   
gb|KJB66063.1|  hypothetical protein B456_010G125900                  65.1    4e-09   
gb|KIR35285.1|  importin beta-4 subunit                               65.1    4e-09   
gb|EPS59215.1|  hypothetical protein M569_15595                       64.3    4e-09   
ref|XP_663321.1|  hypothetical protein AN5717.2                       64.7    4e-09   
gb|KCW52366.1|  hypothetical protein EUGRSUZ_J01771                   64.7    4e-09   
ref|XP_010032870.1|  PREDICTED: importin-5                            64.7    5e-09   
gb|KIP04691.1|  hypothetical protein PHLGIDRAFT_93129                 64.7    5e-09   
ref|XP_007130118.1|  PREDICTED: importin-4                            64.7    5e-09   
ref|XP_002053543.1|  GJ23951                                          64.7    5e-09   
ref|XP_007014669.1|  ARM repeat superfamily protein isoform 2         64.7    5e-09   
ref|XP_571503.1|  importin beta-4 subunit                             64.7    5e-09   
ref|XP_774717.1|  hypothetical protein CNBF3960                       64.7    5e-09   
gb|AFR96204.2|  importin beta-4 subunit                               64.7    5e-09   
ref|XP_007014668.1|  ARM repeat superfamily protein isoform 1         64.7    5e-09   
ref|XP_004311679.1|  PREDICTED: importin-4                            64.3    5e-09   
ref|XP_004504314.1|  PREDICTED: importin-5-like isoform X2            64.3    5e-09   
ref|XP_007014670.1|  ARM repeat superfamily protein isoform 3         64.3    5e-09   
gb|EFB17595.1|  hypothetical protein PANDA_009939                     64.3    6e-09   
gb|KGK38731.1|  hypothetical protein JL09_g2126                       64.3    6e-09   
ref|XP_010531150.1|  PREDICTED: importin-5-like isoform X2            64.3    6e-09   
ref|XP_011181709.1|  PREDICTED: importin-4-like                       64.3    6e-09   
ref|XP_004996912.1|  hypothetical protein PTSG_02419                  64.3    6e-09   
ref|XP_009617273.1|  PREDICTED: importin-5-like                       64.3    6e-09   
ref|XP_004504313.1|  PREDICTED: importin-5-like isoform X1            64.3    6e-09   
gb|KDR17150.1|  Importin-5                                            64.3    6e-09   
ref|XP_004283184.1|  PREDICTED: importin-4                            64.3    6e-09   
ref|XP_004353034.1|  ARM family protein                               64.3    6e-09   
ref|XP_002921086.2|  PREDICTED: LOW QUALITY PROTEIN: importin-4       64.3    6e-09   
ref|XP_003959681.1|  hypothetical protein KAFR_0K01920                64.3    6e-09   
gb|KHC89725.1|  hypothetical protein I503_00551                       64.3    6e-09   
gb|KGT72009.1|  hypothetical protein MEK_00556                        64.3    6e-09   
ref|XP_010531149.1|  PREDICTED: importin-5-like isoform X1            64.3    6e-09   
ref|XP_011159456.1|  PREDICTED: importin-5                            64.3    6e-09   
ref|XP_010112639.1|  hypothetical protein L484_019091                 64.3    6e-09   
ref|XP_007845824.1|  importin beta-4                                  64.3    6e-09   
ref|XP_002500683.1|  predicted protein                                64.3    6e-09   
ref|XP_011214119.1|  PREDICTED: importin-4                            64.3    7e-09   
ref|XP_009791368.1|  PREDICTED: importin-5                            64.3    7e-09   
ref|XP_004362354.1|  importin 4                                       64.3    7e-09   
ref|XP_005790711.1|  hypothetical protein EMIHUDRAFT_122255           60.8    7e-09   
gb|AGO13583.1|  AaceriAGL298Cp                                        64.3    7e-09   
gb|KGR23609.1|  hypothetical protein MG9_00548                        63.9    7e-09   
gb|KGQ98945.1|  hypothetical protein MEU_00545                        63.9    7e-09   
ref|XP_001758132.1|  predicted protein                                63.9    7e-09   
gb|KHG13024.1|  Importin-5                                            63.9    8e-09   
ref|XP_008838051.1|  PREDICTED: importin-4 isoform X2                 63.9    8e-09   
emb|CEP12868.1|  hypothetical protein                                 63.9    8e-09   
gb|EGI67149.1|  Importin-5                                            63.9    8e-09   
ref|NP_986369.2|  AGL298Cp                                            63.9    8e-09   
ref|XP_008838050.1|  PREDICTED: importin-4 isoform X1                 63.9    9e-09   
ref|XP_007159431.1|  hypothetical protein PHAVU_002G237200g           63.9    9e-09   
ref|XP_004537918.1|  PREDICTED: importin-4-like                       63.9    9e-09   
gb|KEQ66487.1|  ARM repeat-containing protein                         63.9    9e-09   
ref|XP_004066666.1|  PREDICTED: importin-5                            63.9    9e-09   
ref|XP_001264986.1|  importin beta-3 subunit, putative                63.9    9e-09   
ref|XP_001990685.1|  GH19498                                          63.9    9e-09   
ref|XP_004296199.1|  PREDICTED: importin-5                            63.9    9e-09   
ref|XP_011500551.1|  PREDICTED: importin-5 isoform X1                 63.5    9e-09   
ref|XP_008560533.1|  PREDICTED: importin-4-like                       63.5    9e-09   
gb|KEQ95446.1|  hypothetical protein AUEXF2481DRAFT_65667             63.5    1e-08   
emb|CDH56835.1|  arm repeat-containing protein                        63.9    1e-08   
ref|XP_004180078.1|  hypothetical protein TBLA_0D00500                63.5    1e-08   
gb|EJY77823.1|  Armadillo/beta-catenin-like repeat-containing pro...  63.5    1e-08   
ref|XP_011051750.1|  PREDICTED: importin-5                            63.5    1e-08   
ref|XP_750428.1|  importin beta-3 subunit                             63.5    1e-08   
gb|KJB44607.1|  hypothetical protein B456_007G260800                  63.2    1e-08   
ref|XP_001605180.1|  PREDICTED: importin-4-like                       63.2    1e-08   
emb|CEI92004.1|  hypothetical protein RMCBS344292_06279               60.5    1e-08   
gb|ETO21346.1|  hypothetical protein RFI_15856                        60.1    1e-08   
gb|KJB44606.1|  hypothetical protein B456_007G260800                  63.2    1e-08   
gb|EIE91473.1|  hypothetical protein RO3G_16184                       63.2    1e-08   
gb|KJB44609.1|  hypothetical protein B456_007G260800                  63.2    1e-08   
gb|KJB44608.1|  hypothetical protein B456_007G260800                  63.2    1e-08   
ref|XP_008351499.1|  PREDICTED: importin-5-like                       63.2    2e-08   
ref|XP_004923075.1|  PREDICTED: LOW QUALITY PROTEIN: importin-5-like  63.2    2e-08   
ref|XP_004185860.1|  importin-4, putative                             63.2    2e-08   
gb|KHG26160.1|  Importin-5                                            63.2    2e-08   
emb|CEG76614.1|  hypothetical protein RMATCC62417_11488               60.1    2e-08   
ref|XP_010276366.1|  PREDICTED: importin-5-like                       62.8    2e-08   
gb|ETN66625.1|  importin beta-4                                       62.8    2e-08   
emb|CEJ00931.1|  hypothetical protein RMCBS344292_14971               60.1    2e-08   
emb|CEG76615.1|  hypothetical protein RMATCC62417_11488               60.1    2e-08   
ref|XP_003674386.1|  hypothetical protein NCAS_0A14490                62.8    2e-08   
gb|KEQ72295.1|  ARM repeat-containing protein                         62.8    2e-08   
ref|XP_008322931.1|  PREDICTED: importin-5                            62.8    2e-08   
ref|XP_009120856.1|  PREDICTED: importin-5                            62.8    2e-08   
ref|XP_002304857.1|  hypothetical protein POPTR_0003s21100g           62.4    2e-08   
ref|XP_005843518.1|  hypothetical protein CHLNCDRAFT_59245            62.4    2e-08   
gb|EPB87956.1|  hypothetical protein HMPREF1544_05247                 62.4    2e-08   
dbj|GAM39001.1|  karyopherin                                          62.4    2e-08   
gb|KDQ26752.1|  hypothetical protein PLEOSDRAFT_174057                62.4    2e-08   
ref|XP_005516512.1|  PREDICTED: importin-5                            62.4    2e-08   
ref|XP_005715077.1|  unnamed protein product                          62.4    2e-08   
gb|EPE02422.1|  karyopherin                                           62.4    2e-08   
emb|CEP13770.1|  hypothetical protein                                 62.4    3e-08   
gb|EIE76327.1|  hypothetical protein RO3G_01031                       62.4    3e-08   
gb|KIW96009.1|  hypothetical protein Z519_03075                       62.4    3e-08   
ref|XP_001269479.1|  importin beta-3 subunit, putative                62.0    3e-08   
gb|EJT51728.1|  importin beta-4 subunit                               62.0    3e-08   
ref|XP_002552499.1|  KLTH0C06292p                                     62.0    3e-08   
ref|XP_007447943.1|  PREDICTED: importin-4                            62.0    3e-08   
ref|XP_006638970.1|  PREDICTED: importin-5-like                       62.0    3e-08   
gb|EYE92083.1|  importin beta-4 subunit                               62.0    3e-08   
ref|XP_008384384.1|  PREDICTED: importin-5-like                       62.0    4e-08   
gb|KIW73495.1|  hypothetical protein PV04_01608                       62.0    4e-08   
gb|EKD02863.1|  importin beta-4 subunit                               62.0    4e-08   
gb|EKD02864.1|  importin beta-4 subunit                               61.6    4e-08   
emb|CEP60246.1|  LALA0S01e06326g1_1                                   62.0    4e-08   
dbj|GAN01990.1|  ARM repeat-containing protein                        62.0    4e-08   
ref|XP_001803400.1|  hypothetical protein SNOG_13188                  62.0    4e-08   
ref|XP_005666296.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4       61.6    4e-08   
ref|XP_003647812.1|  hypothetical protein Ecym_7146                   61.6    4e-08   
emb|CCA25677.1|  hypothetical protein LOC495010                       61.6    4e-08   
gb|EKF32803.1|  importin beta-1 subunit, putative                     61.6    4e-08   
gb|KEQ89201.1|  ARM repeat-containing protein                         61.6    5e-08   



>ref|XP_008339515.1| PREDICTED: importin-4 [Malus domestica]
Length=182

 Score =   243 bits (620),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ + LVKQSLI+SIT+EHS PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQSKHLVKQSLIESITMEHSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_011087739.1| PREDICTED: importin-4 isoform X2 [Sesamum indicum]
Length=853

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/129 (98%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHWGKLSPQLRQLVKQSLI+SITVEHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWGKLSPQLRQLVKQSLIESITVEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_011087737.1| PREDICTED: importin-4 isoform X1 [Sesamum indicum]
 ref|XP_011087738.1| PREDICTED: importin-4 isoform X1 [Sesamum indicum]
Length=1049

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/129 (98%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHWGKLSPQLRQLVKQSLI+SITVEHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWGKLSPQLRQLVKQSLIESITVEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|EYU26532.1| hypothetical protein MIMGU_mgv1a000599mg [Erythranthe guttata]
Length=990

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRL+KDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLSKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHWGKLSPQLRQLVKQSLI+SITVEHS PVR+ASANVVSIIAKYAVP+GEWPDLL
Sbjct  61   RKKITGHWGKLSPQLRQLVKQSLIESITVEHSPPVRKASANVVSIIAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|EYU26531.1| hypothetical protein MIMGU_mgv1a000599mg [Erythranthe guttata]
Length=1049

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRL+KDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLSKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHWGKLSPQLRQLVKQSLI+SITVEHS PVR+ASANVVSIIAKYAVP+GEWPDLL
Sbjct  61   RKKITGHWGKLSPQLRQLVKQSLIESITVEHSPPVRKASANVVSIIAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010683344.1| PREDICTED: importin-4 [Beta vulgaris subsp. vulgaris]
Length=1049

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRL+KDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLSKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLRQLVKQSLI+SIT+EHS+PVRRASANVVS+IAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLRQLVKQSLIESITLEHSSPVRRASANVVSVIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|KDO53025.1| hypothetical protein CISIN_1g001584mg [Citrus sinensis]
Length=721

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>gb|AES63260.2| importin beta-4 [Medicago truncatula]
Length=1048

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQL+AVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++QLVKQSLIDSIT+EHS PVR+ASANVVSI+AKYAVP+GEWPDL 
Sbjct  61   RKKITGHWSKLSPQIKQLVKQSLIDSITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLF  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_009780008.1| PREDICTED: importin-4 [Nicotiana sylvestris]
Length=1049

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLRQLVKQSLI+SIT+EHS PVRRASANV+SI+AKYAVPAGEW DLL
Sbjct  61   RKKITGHWAKLSPQLRQLVKQSLIESITMEHSPPVRRASANVISIVAKYAVPAGEWSDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|KJB60880.1| hypothetical protein B456_009G329500 [Gossypium raimondii]
Length=1014

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL+PQ++QLVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLAPQVKQLVKQSLIESITMEHSRPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>gb|KJB60881.1| hypothetical protein B456_009G329500 [Gossypium raimondii]
Length=1049

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL+PQ++QLVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLAPQVKQLVKQSLIESITMEHSRPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_009616452.1| PREDICTED: importin-4 [Nicotiana tomentosiformis]
Length=1049

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLRQLVKQSLI+SIT+EHS PVRRASANV+SI+AKYAVPAGEW DLL
Sbjct  61   RKKITGHWAKLSPQLRQLVKQSLIESITMEHSPPVRRASANVISIVAKYAVPAGEWSDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|KHG04365.1| putative importin subunit beta-4 [Gossypium arboreum]
Length=997

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL+PQ++QLVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLAPQVKQLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>emb|CDO97558.1| unnamed protein product [Coffea canephora]
Length=1051

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLRQLVKQSLI+SITVEHS  VR+ASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLRQLVKQSLIESITVEHSPLVRKASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>emb|CAN76102.1| hypothetical protein VITISV_007422 [Vitis vinifera]
Length=1028

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQV+PALIHHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVIPALIHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLR LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLRHLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_002267673.1| PREDICTED: importin-4 [Vitis vinifera]
 emb|CBI23779.3| unnamed protein product [Vitis vinifera]
Length=1048

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQV+PALIHHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVIPALIHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLR LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLRHLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_007045325.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY01157.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao]
Length=831

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL  Q++QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLPHQVKQLVKQSLIESITMEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
             FLFQCSQSP
Sbjct  121  SFLFQCSQSP  130



>gb|KDP24688.1| hypothetical protein JCGZ_26509 [Jatropha curcas]
Length=1048

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010268961.1| PREDICTED: importin-4-like isoform X2 [Nelumbo nucifera]
Length=867

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQV+PAL HHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVIPALAHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVK SLI+SIT+EHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKSSLIESITLEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_006437504.1| hypothetical protein CICLE_v10030583mg [Citrus clementina]
 gb|ESR50744.1| hypothetical protein CICLE_v10030583mg [Citrus clementina]
Length=1049

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>gb|KDO53021.1| hypothetical protein CISIN_1g001584mg [Citrus sinensis]
 gb|KDO53022.1| hypothetical protein CISIN_1g001584mg [Citrus sinensis]
Length=1049

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>gb|KDO53024.1| hypothetical protein CISIN_1g001584mg [Citrus sinensis]
Length=992

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>ref|XP_006484649.1| PREDICTED: importin-4-like isoform X1 [Citrus sinensis]
 ref|XP_006484650.1| PREDICTED: importin-4-like isoform X2 [Citrus sinensis]
Length=1049

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>gb|KDO53023.1| hypothetical protein CISIN_1g001584mg [Citrus sinensis]
Length=1018

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIESITLEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQ SQS
Sbjct  121  PFLFQFSQS  129



>ref|XP_004485490.1| PREDICTED: importin-4-like [Cicer arietinum]
Length=1048

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRL+KDPQVVPALIHHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLSKDPQVVPALIHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++ LVKQSLI+SIT+EHS PVR+ASANVVSI+AKYAVP+GEWPDL 
Sbjct  61   RKKITGHWSKLSPQIKHLVKQSLIESITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLF  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_010268960.1| PREDICTED: importin-4-like isoform X1 [Nelumbo nucifera]
Length=1048

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQV+PAL HHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVIPALAHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVK SLI+SIT+EHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKSSLIESITLEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_007148515.1| hypothetical protein PHAVU_006G215200g [Phaseolus vulgaris]
 gb|ESW20509.1| hypothetical protein PHAVU_006G215200g [Phaseolus vulgaris]
Length=1048

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ H+RTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHMRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLID+IT+EHS PVR+ASANVVSI+AKYAVP+GEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIDTITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_007045323.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007045324.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY01155.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY01156.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=1049

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL  Q++QLVKQSLI+SIT+EHSAPVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLPHQVKQLVKQSLIESITMEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
             FLFQCSQSP
Sbjct  121  SFLFQCSQSP  130



>ref|XP_006349374.1| PREDICTED: importin-4-like [Solanum tuberosum]
Length=1049

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ RQLVKQSLI+SIT+EHS PVRRASANV+SI+AKYAVPAGEW DLL
Sbjct  61   RKKITGHWAKLSPQHRQLVKQSLIESITMEHSPPVRRASANVISIVAKYAVPAGEWSDLL  120

Query  420  PFLFQCSQS  446
            P+LFQCSQS
Sbjct  121  PYLFQCSQS  129



>ref|XP_004230489.1| PREDICTED: importin-4 [Solanum lycopersicum]
Length=1049

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVP+LIHHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPSLIHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ RQLVKQSLI+SIT+EHS PVRRASANV+SI+AKYAVPAGEW DLL
Sbjct  61   RKKITGHWAKLSPQHRQLVKQSLIESITMEHSPPVRRASANVISIVAKYAVPAGEWSDLL  120

Query  420  PFLFQCSQS  446
            P+LFQCSQS
Sbjct  121  PYLFQCSQS  129



>ref|XP_011465757.1| PREDICTED: probable importin subunit beta-4 [Fragaria vesca subsp. 
vesca]
Length=1053

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKNLVKQSLIESITMEHSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|KHN33455.1| Putative importin subunit beta-4 [Glycine soja]
Length=1048

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ H+RTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHMRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI++IT+EHS PVR+ASANVVSI+AKYAVP+GEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIETITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_003547537.1| PREDICTED: importin-4-like [Glycine max]
Length=1048

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ H+RTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHMRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLVKQSLI++IT+EHS PVR+ASANVVSI+AKYAVP+GEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVKQSLIETITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>emb|CAB38276.1| putative protein [Arabidopsis thaliana]
 emb|CAB81414.1| putative protein [Arabidopsis thaliana]
Length=651

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_010103905.1| putative importin subunit beta-4 [Morus notabilis]
 gb|EXB97346.1| putative importin subunit beta-4 [Morus notabilis]
Length=1048

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKLLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_007225401.1| hypothetical protein PRUPE_ppa000660mg [Prunus persica]
 gb|EMJ26600.1| hypothetical protein PRUPE_ppa000660mg [Prunus persica]
Length=1048

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++ LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQIKHLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_008218783.1| PREDICTED: importin-4 [Prunus mume]
Length=1048

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++ LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQIKHLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_002312242.1| importin beta-2 subunit family protein [Populus trichocarpa]
 gb|EEE89609.1| importin beta-2 subunit family protein [Populus trichocarpa]
Length=1048

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL  HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALAQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS+PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKLLVKQSLIESITMEHSSPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_009355231.1| PREDICTED: importin-4-like [Pyrus x bretschneideri]
Length=1048

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++ LV+QSLI+SIT+EHS PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQIKHLVRQSLIESITMEHSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_011017066.1| PREDICTED: importin-4-like [Populus euphratica]
Length=1048

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL  HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALAQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS PVRRASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKLLVKQSLIESITMEHSPPVRRASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_008456074.1| PREDICTED: importin-4 [Cucumis melo]
Length=1046

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSP+L+ LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVPAG+WPDLL
Sbjct  61   RKKITGHWAKLSPELKLLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPAGDWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010243480.1| PREDICTED: importin-4-like [Nelumbo nucifera]
Length=1049

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKR AKDPQV+PAL+HHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRQAKDPQVIPALVHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQLRQLVK SLI+SIT+EHS  VRRASANVVSIIAKYA+PAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLRQLVKSSLIESITLEHSPLVRRASANVVSIIAKYAIPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCS+S
Sbjct  121  PFLFQCSRS  129



>gb|KCW57080.1| hypothetical protein EUGRSUZ_I02730 [Eucalyptus grandis]
Length=926

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS  VRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWSKLSPQLKHLVKQSLIESITMEHSPLVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010433332.1| PREDICTED: importin-4-like [Camelina sativa]
Length=1049

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQI+RLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIQRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++QLVKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQIKQLVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_010030114.1| PREDICTED: importin-4 [Eucalyptus grandis]
 gb|KCW57079.1| hypothetical protein EUGRSUZ_I02730 [Eucalyptus grandis]
Length=1048

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS  VRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWSKLSPQLKHLVKQSLIESITMEHSPLVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_006283050.1| hypothetical protein CARUB_v10004045mg [Capsella rubella]
 gb|EOA15948.1| hypothetical protein CARUB_v10004045mg [Capsella rubella]
Length=1048

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_004146264.1| PREDICTED: probable importin subunit beta-4-like [Cucumis sativus]
 ref|XP_004159877.1| PREDICTED: probable importin subunit beta-4-like [Cucumis sativus]
 gb|KGN57585.1| hypothetical protein Csa_3G219200 [Cucumis sativus]
Length=1046

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSP+L+ LVKQSLI+SIT+EHS PVRRASANVVSI+AKYAVP G+WPDLL
Sbjct  61   RKKITGHWAKLSPELKLLVKQSLIESITMEHSPPVRRASANVVSIVAKYAVPGGDWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_002867489.1| importin beta-2 subunit family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43748.1| importin beta-2 subunit family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1048

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>gb|KCW57078.1| hypothetical protein EUGRSUZ_I02730 [Eucalyptus grandis]
Length=1057

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+ LVKQSLI+SIT+EHS  VRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWSKLSPQLKHLVKQSLIESITMEHSPLVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_009137675.1| PREDICTED: importin-4-like [Brassica rapa]
Length=1049

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQMKQEVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_006413052.1| hypothetical protein EUTSA_v10024293mg [Eutrema salsugineum]
 gb|ESQ54505.1| hypothetical protein EUTSA_v10024293mg [Eutrema salsugineum]
Length=1047

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>emb|CDY56328.1| BnaC07g50410D [Brassica napus]
Length=1050

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQMKQEVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|NP_194494.2| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AAL32805.1| putative protein [Arabidopsis thaliana]
 gb|AAR23706.1| At4g27640 [Arabidopsis thaliana]
 gb|AEE85373.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=1048

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>emb|CDY29849.1| BnaA03g48700D [Brassica napus]
Length=1049

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++Q VKQSLI+SIT+E+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQMKQEVKQSLIESITIENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_011013548.1| PREDICTED: importin-4-like [Populus euphratica]
Length=1048

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL  HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALAQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL PQL+ LVKQSLI+SIT+EHS PVR+ASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLPPQLKLLVKQSLIESITMEHSPPVRKASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_009347180.1| PREDICTED: LOW QUALITY PROTEIN: importin-4-like [Pyrus x bretschneideri]
Length=1051

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MSQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ + LVKQSLI+SIT+EHS PVRRASANVVS++AKYAVPAGEWP LL
Sbjct  61   RKKITGHWAKLSPQSKHLVKQSLIESITMEHSPPVRRASANVVSVVAKYAVPAGEWPALL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>gb|KFK29275.1| hypothetical protein AALP_AA7G112200 [Arabis alpina]
Length=1048

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQL+Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDL 
Sbjct  61   RKRITGHWAKLSPQLKQHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLF  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_002315055.1| importin beta-2 subunit family protein [Populus trichocarpa]
 gb|EEF01226.1| importin beta-2 subunit family protein [Populus trichocarpa]
Length=1048

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL  HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALAQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKK+TGHW KL PQL+ LVKQSLI+SIT+EHS PVR+ASANVVSIIAKYAVPAGEWPDLL
Sbjct  61   RKKVTGHWAKLPPQLKLLVKQSLIESITMEHSPPVRKASANVVSIIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010528662.1| PREDICTED: importin-4 [Tarenaya hassleriana]
Length=1047

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+Q VK+SLI+SIT+E+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQHVKESLIESITIENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>emb|CDY19045.1| BnaC01g20230D [Brassica napus]
Length=1047

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ +Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQTKQEVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  GFLFQCSQS  129



>ref|XP_009143709.1| PREDICTED: importin-4 [Brassica rapa]
Length=1049

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ +Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQTKQEVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  GFLFQCSQS  129



>emb|CDY52993.1| BnaAnng11870D [Brassica napus]
Length=1049

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ +Q VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWAKLSPQTKQEVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  GFLFQCSQS  129



>ref|XP_003532985.1| PREDICTED: importin-4-like isoform X1 [Glycine max]
 gb|KHN11232.1| Putative importin subunit beta-4 [Glycine soja]
Length=1048

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+ H+RTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHMRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQL+QLV QSLI++IT+EHS PVR+ASANVVSI+AKYAVP+GEWPDLL
Sbjct  61   RKKITGHWAKLSPQLKQLVMQSLIETITMEHSPPVRKASANVVSIVAKYAVPSGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLF+ SQS
Sbjct  121  PFLFERSQS  129



>ref|XP_009410571.1| PREDICTED: probable importin subunit beta-4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1048

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRL+KDP VVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLSKDPAVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSP L+  VKQ+LIDSIT+EHS  VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  61   RKKITGHWAKLSPSLKLSVKQALIDSITLEHSPLVRRASANVVSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010451154.1| PREDICTED: importin-4-like [Camelina sativa]
Length=847

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQI RLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQINRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++  VKQSLI+SITVE+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWTKLSPQIKLHVKQSLIESITVENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_009410572.1| PREDICTED: probable importin subunit beta-4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1047

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRL+KDP VVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLSKDPAVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSP L+  VKQ+LIDSIT+EHS  VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  61   RKKITGHWAKLSPSLKLSVKQALIDSITLEHSPLVRRASANVVSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010438570.1| PREDICTED: importin-4-like [Camelina sativa]
 ref|XP_010438571.1| PREDICTED: importin-4-like [Camelina sativa]
Length=1049

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQI RLAKDPQVVPALI HLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQINRLAKDPQVVPALIQHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RK+ITGHW KLSPQ++  VKQSLI+SIT E+S PVRRASANVVS++AKYAVPAGEWPDLL
Sbjct  61   RKRITGHWTKLSPQIKLHVKQSLIESITAENSPPVRRASANVVSVVAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
             FLFQCSQS
Sbjct  121  TFLFQCSQS  129



>ref|XP_004984713.1| PREDICTED: importin-4-like [Setaria italica]
Length=1046

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT++HS PVRRASANVVSIIAKYA+PAGEWPDLL
Sbjct  61   RKKITSHWPKLHPDSKANLKQALIDSITLDHSHPVRRASANVVSIIAKYAIPAGEWPDLL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_008801050.1| PREDICTED: LOW QUALITY PROTEIN: probable importin subunit beta-4 
[Phoenix dactylifera]
Length=1047

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPAL+HHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL P ++  VK +LI+SIT++ S PVRRASANVVS+IAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLPPHVKHSVKSALIESITLDPSPPVRRASANVVSVIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCSQS
Sbjct  121  PFLFQCSQS  129



>ref|XP_010916537.1| PREDICTED: importin-4 [Elaeis guineensis]
Length=1047

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDPQVVPAL+HHLRTAKTPNVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPQVVPALVHHLRTAKTPNVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KL P ++  VK +LI+SITV+ S+PVRRASANVVS+IAKYAVPAGEWPDLL
Sbjct  61   RKKITGHWAKLPPHVKHSVKSALIESITVDPSSPVRRASANVVSVIAKYAVPAGEWPDLL  120

Query  420  PFLFQCSQS  446
            PFLFQCS S
Sbjct  121  PFLFQCSHS  129



>ref|XP_002465518.1| hypothetical protein SORBIDRAFT_01g040400 [Sorghum bicolor]
 gb|EER92516.1| hypothetical protein SORBIDRAFT_01g040400 [Sorghum bicolor]
Length=1047

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT++HS PVRRASANVVSIIAKYA+PAGEWP+LL
Sbjct  61   RKKITSHWPKLHPDSKASLKQALIDSITLDHSHPVRRASANVVSIIAKYAIPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_006838378.1| hypothetical protein AMTR_s00002p00059110 [Amborella trichopoda]
 gb|ERN00947.1| hypothetical protein AMTR_s00002p00059110 [Amborella trichopoda]
Length=1051

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QIKRLAKDP V+PAL+ H+RTAKT NVRQL+AVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIKRLAKDPHVIPALLQHMRTAKTANVRQLSAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKITGHW KLSPQ++  VK +L++SITVEHS PVRRASANVVS++AKYAVPAGEWP+LL
Sbjct  61   RKKITGHWMKLSPQVKDSVKSALMESITVEHSPPVRRASANVVSVVAKYAVPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>gb|AAP06844.1| unknown protein [Oryza sativa Japonica Group]
Length=960

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT++HS  VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  61   RKKITSHWPKLPPHAKASLKQALIDSITIDHSHLVRRASANVVSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PF+FQCSQSP
Sbjct  121  PFIFQCSQSP  130



>ref|XP_008645429.1| PREDICTED: uncharacterized protein LOC100383753 isoform X1 [Zea 
mays]
Length=1047

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL    +  +KQ+LIDSIT++HS PVRRASANVVSIIAKYA+PAGEWP+LL
Sbjct  61   RKKITSHWPKLPADSKASLKQALIDSITLDHSHPVRRASANVVSIIAKYAIPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>tpg|DAA44500.1| TPA: hypothetical protein ZEAMMB73_199165 [Zea mays]
Length=993

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL    +  +KQ+LIDSIT++HS PVRRASANVVSIIAKYA+PAGEWP+LL
Sbjct  61   RKKITSHWPKLPADSKASLKQALIDSITLDHSHPVRRASANVVSIIAKYAIPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>gb|EEC74901.1| hypothetical protein OsI_10833 [Oryza sativa Indica Group]
Length=1047

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT++HS  VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  61   RKKITSHWPKLPPHAKASLKQALIDSITIDHSHLVRRASANVVSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PF+FQCSQSP
Sbjct  121  PFIFQCSQSP  130



>gb|EEE58734.1| hypothetical protein OsJ_10217 [Oryza sativa Japonica Group]
Length=1052

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT++HS  VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  61   RKKITSHWPKLPPHAKASLKQALIDSITIDHSHLVRRASANVVSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PF+FQCSQSP
Sbjct  121  PFIFQCSQSP  130



>tpg|DAA44499.1| TPA: hypothetical protein ZEAMMB73_199165 [Zea mays]
Length=1171

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL    +  +KQ+LIDSIT++HS PVRRASANVVSIIAKYA+PAGEWP+LL
Sbjct  61   RKKITSHWPKLPADSKASLKQALIDSITLDHSHPVRRASANVVSIIAKYAIPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>ref|XP_003558305.1| PREDICTED: importin-4 [Brachypodium distachyon]
Length=1046

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            RKKIT HW KL P  +  +KQ+LIDSIT+++S  VRRASANV+SIIAKYAVPAGEWP+LL
Sbjct  61   RKKITSHWPKLPPHAKASLKQALIDSITLDNSHLVRRASANVMSIIAKYAVPAGEWPELL  120

Query  420  PFLFQCSQSP  449
            PFLFQCSQSP
Sbjct  121  PFLFQCSQSP  130



>gb|EMS63391.1| Importin-4 [Triticum urartu]
Length=718

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 120/180 (67%), Gaps = 50/180 (28%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVRQLAAVLL
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRQLAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHS-----APVRR------------------  350
            RKKIT HW KL P  +  +KQ+LIDSIT+++      A ++R                  
Sbjct  61   RKKITSHWPKLPPHAKASLKQALIDSITLDNRVVYGIAELKRLTELLDVMRTGTLSGVIY  120

Query  351  ---------------------------ASANVVSIIAKYAVPAGEWPDLLPFLFQCSQSP  449
                                       ASANVVSIIAKYAVPAGEW +LLPFLFQCSQSP
Sbjct  121  GRTVGNILRMEEVRIGGRNAQIHLVRRASANVVSIIAKYAVPAGEWQELLPFLFQCSQSP  180



>ref|XP_001771868.1| predicted protein [Physcomitrella patens]
 gb|EDQ63297.1| predicted protein [Physcomitrella patens]
Length=1049

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            L +LL QFL+PDN +R+QAE+QI+RL+KDP +VPAL+HH+R +  P VRQLAAVLLRKKI
Sbjct  4    LGVLLGQFLVPDNASRKQAEEQIRRLSKDPLLVPALLHHVRCSPYPEVRQLAAVLLRKKI  63

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
            TGHW +LS ++R  VK +L++SIT+E+S PVRR SA+VVS++AK+AVPAGEWP+LLPFL 
Sbjct  64   TGHWMQLSAEMRNNVKSTLLESITLENSPPVRRGSADVVSVVAKHAVPAGEWPELLPFLH  123

Query  432  QCSQS  446
            QCSQS
Sbjct  124  QCSQS  128



>ref|XP_002961696.1| hypothetical protein SELMODRAFT_140759 [Selaginella moellendorffii]
 gb|EFJ36956.1| hypothetical protein SELMODRAFT_140759 [Selaginella moellendorffii]
Length=984

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  99   MPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSP  278
            MPDNDAR+ AE+QIK LA+DP++VPAL+H +R A++ NVRQLAAVLLRKKI G W KL+P
Sbjct  1    MPDNDARKNAEEQIKHLARDPELVPALLHQIRNARSANVRQLAAVLLRKKIVGLWMKLNP  60

Query  279  QLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            QL   +K  L++SIT+++S  VRRASA+VVS +AK  VPAG WP+LLPFLFQCSQS
Sbjct  61   QLHASLKNLLLESITLDNSLAVRRASADVVSALAKQDVPAGNWPELLPFLFQCSQS  116



>ref|XP_002964764.1| hypothetical protein SELMODRAFT_83420 [Selaginella moellendorffii]
 gb|EFJ33602.1| hypothetical protein SELMODRAFT_83420 [Selaginella moellendorffii]
Length=1046

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  99   MPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSP  278
            MPDNDAR+ AE+QIK LA+DP++VPAL+H +R A++ NVRQLAAVLLRKKI G W KL+P
Sbjct  13   MPDNDARKNAEEQIKHLARDPELVPALLHQIRNARSANVRQLAAVLLRKKIVGLWMKLNP  72

Query  279  QLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            QL   +K  L++SIT+++S  VRRASA+VVS +AK  VPAG WP+LLPFLFQCSQS
Sbjct  73   QLHASLKNLLLESITLDNSLAVRRASADVVSALAKQDVPAGNWPELLPFLFQCSQS  128



>ref|XP_006651232.1| PREDICTED: importin-4-like [Oryza brachyantha]
Length=1007

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 90/130 (69%), Gaps = 39/130 (30%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLELLLIQFLMPDNDARRQAE+QI+RLA+DPQVVPAL+HHLRTAKTPNVR L     
Sbjct  1    MAQSLELLLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAKTPNVRHL-----  55

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
                                              VRRASANVVSIIAKYAVPAGEWP+LL
Sbjct  56   ----------------------------------VRRASANVVSIIAKYAVPAGEWPELL  81

Query  420  PFLFQCSQSP  449
            PF+FQCSQSP
Sbjct  82   PFIFQCSQSP  91



>ref|XP_001622543.1| hypothetical protein NEMVEDRAFT_v1g248390 [Nematostella vectensis]
 gb|EDO30443.1| predicted protein [Nematostella vectensis]
Length=1107

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            LE +L++ L+PDN   +QA  ++K   K P V+P+L+  L T++ P VRQ AAVLLR+++
Sbjct  4    LESILLKLLVPDNTVIQQATVELKEAFKHPAVIPSLMSILSTSQNPQVRQYAAVLLRRRV  63

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            T  W KL P+  Q++KQ L+  +T E    VR +   VVS+IAK+ +PAG+WP+LL FL
Sbjct  64   TKQWTKLPPENHQMLKQGLLQVLTQESVPLVRHSVGQVVSMIAKHELPAGQWPELLLFL  122



>ref|XP_002506707.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67965.1| predicted protein [Micromonas sp. RCC299]
Length=1142

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGH  260
            +L   L  DND R  AE  ++ +A+D  VVPAL+ H R    P VRQLAAV+L++++ GH
Sbjct  25   ILTALLAADNDVRGSAEATLRNVARDANVVPALLTHARGDPDPQVRQLAAVVLKRRVLGH  84

Query  261  WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCS  440
            W +L    ++ VK  L+D +  E    VRR+ A+VVS +AK  VP G+W  L  FL QC+
Sbjct  85   WPRLPRDAQEQVKHILLDGVVKEPVGLVRRSIADVVSKVAKATVPMGQWNALPEFLAQCT  144

Query  441  QSP  449
            QSP
Sbjct  145  QSP  147



>ref|XP_003058470.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56925.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1151

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGH  260
            +L   L  DNDAR  AE  +++L++DP VVP+L+   R+    N RQ+AAV+L++++  H
Sbjct  36   ILRALLASDNDARGVAEATLRQLSRDPHVVPSLLAIARSDADANARQMAAVILKRRVIAH  95

Query  261  WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCS  440
            W +L    R  VKQSL++ +  E    V+RA A+V+  +AK     G W +L  FL QC+
Sbjct  96   WQRLGESTRDAVKQSLLEGVVREPMHLVKRAIADVLGKVAKATFATGSWSELPEFLAQCT  155

Query  441  QSP  449
            QSP
Sbjct  156  QSP  158



>emb|CCF48655.1| related to KAP123-Importin beta-4 subunit [Ustilago hordei]
Length=1075

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 82/138 (59%), Gaps = 5/138 (4%)
 Frame = +3

Query  51   EEAMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLA  227
            + +  Q L  LL Q  +PD +  + A + ++    K+PQ VPAL   L T+    VRQLA
Sbjct  2    DASYVQGLHELLKQSCVPDTNTVKAATESLQNNYYKNPQCVPALFEILATSPDFAVRQLA  61

Query  228  AVLLRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVP  395
            AV LRK++    GK+    S ++R  +K  L++ +T E S PVR + A V+S IAK  +P
Sbjct  62   AVELRKRLAKSGGKVWTKQSLEIRDGIKAKLLEVVTNEQSGPVRNSIARVISEIAKRELP  121

Query  396  AGEWPDLLPFLFQCSQSP  449
            AG WP LLPFLFQ + SP
Sbjct  122  AGSWPALLPFLFQAADSP  139



>gb|ELT89259.1| hypothetical protein CAPTEDRAFT_159396 [Capitella teleta]
Length=1096

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA++LE +    L+PD    +QA  Q+K L  DP +VPAL   L T++TP VRQ AAVLL
Sbjct  1    MAENLEAIFANLLVPDTAVIQQATQQLKGLMNDPALVPALCQVLSTSQTPQVRQYAAVLL  60

Query  240  RKKIT--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPD  413
            R+KI     W  L   + Q ++Q+L+  +  E  A VR++ A +V+ +AK+ +P G WP+
Sbjct  61   RRKILRRKQWTGLGAVIAQNIRQNLLQVMLQESEAIVRKSLAQLVATVAKHDLPQGRWPE  120

Query  414  LLPFL--FQCSQSP  449
            L  F   +  SQ P
Sbjct  121  LFQFFQTYTSSQDP  134



>gb|EST08799.1| hypothetical protein PSEUBRA_SCAF14g01539 [Pseudozyma brasiliensis 
GHG001]
Length=1070

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            A  Q L  LL Q  +PD +  + A + ++    K+PQ +PAL   L T+    VRQLAAV
Sbjct  4    AFVQGLHELLKQSNVPDTNTVKAATESLQNTYYKNPQCIPALFEILATSPDLAVRQLAAV  63

Query  234  LLRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++    GK+    S Q+R  +K  L++ +T E +APVR A A V+S IAK  +PAG
Sbjct  64   ELRKRLAKSGGKVWTKQSVQVRDGIKAKLLEVVTNEQAAPVRNAIARVISEIAKRELPAG  123

Query  402  EWPDLLPFLFQCSQS  446
             WP LLPFLFQ + S
Sbjct  124  SWPALLPFLFQAADS  138



>ref|XP_002604692.1| hypothetical protein BRAFLDRAFT_228853 [Branchiostoma floridae]
 gb|EEN60703.1| hypothetical protein BRAFLDRAFT_228853 [Branchiostoma floridae]
Length=1022

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (61%), Gaps = 0/123 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQSLE +L   L+PDN   +QA  Q++   KDP +VPAL   L  ++ P VRQ AAVLL
Sbjct  1    MAQSLETILENLLVPDNAVIQQATTQLQEAYKDPAIVPALCGVLGASQNPQVRQYAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R+KI   W K   + +  +K +L+  +  E    VR A+A +V  +A++ +  G+WP+LL
Sbjct  61   RRKIAKQWKKFDQETQASLKATLLQVLVQEPERTVRHAAAQIVGAVARHELQEGKWPELL  120

Query  420  PFL  428
             F+
Sbjct  121  QFI  123



>ref|XP_006008363.1| PREDICTED: importin-4 [Latimeria chalumnae]
Length=1058

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA+SLE +L   L P+N+  +QA  Q+K   KDP VVPAL   L  ++ P +RQ AAVL+
Sbjct  1    MAESLEKILSNLLQPNNEIIQQATAQLKEAFKDPSVVPALCAVLTGSQNPQIRQFAAVLV  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R++I   W KL+P L++ +K  ++ ++  E    VR A A + +++ K+  PA  WP LL
Sbjct  61   RRRIVKQWKKLAPNLKENLKPLVLQALQQESEHKVRHAVAQLAAVVMKHETPA-RWPQLL  119

Query  420  PFLFQCSQS  446
             F+ Q ++S
Sbjct  120  QFMHQTTKS  128



>emb|CBQ68976.1| related to KAP123-Importin beta-4 subunit [Sporisorium reilianum 
SRZ2]
Length=1076

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A + ++    K+PQ +PAL   L T+    VRQLAAV
Sbjct  4    SFVQGLHELLKQSNVPDTNTVKAATESLQNNYYKNPQCIPALFEILATSPDLAVRQLAAV  63

Query  234  LLRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++    GK+    S Q+R  +K  L++ +T E +A VR A A V+S IAK  +PAG
Sbjct  64   ELRKRLAKSGGKVWTKQSVQVRDGIKAKLLEVVTNEQAAAVRNAIARVISEIAKRELPAG  123

Query  402  EWPDLLPFLFQCSQSP  449
             WP LLPFLFQ + SP
Sbjct  124  SWPALLPFLFQAADSP  139



>gb|ETS60182.1| hypothetical protein PaG_05723 [Pseudozyma aphidis DSM 70725]
Length=1075

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A D ++    K+PQ VPAL   L T+    VRQLAAV
Sbjct  4    SFVQGLHELLKQSNVPDTNTVKAATDALQNNYYKNPQCVPALFEILATSPDLAVRQLAAV  63

Query  234  LLRKKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++       W K    +R  +K  L++ +T E +APVR + A V+S IAK  +P G
Sbjct  64   ELRKRLAKSGGKVWNKQPVDVRNGIKSKLLEVVTNEQAAPVRNSIARVISEIAKRELPLG  123

Query  402  EWPDLLPFLFQCSQSP  449
             WPDLLPFLF  + SP
Sbjct  124  TWPDLLPFLFNAADSP  139



>dbj|GAC77604.1| defender against cell death protein [Pseudozyma antarctica T-34]
Length=1102

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A D ++    K+PQ VPAL   L T+    VRQLAAV
Sbjct  4    SFVQGLHELLKQSNVPDTNTVKAATDALQNNYYKNPQCVPALFEILATSPDLAVRQLAAV  63

Query  234  LLRKKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++       W K    +R  +K  L++ +T E +APVR + A V+S IAK  +P G
Sbjct  64   ELRKRLAKSGGKVWNKQPVDVRNGIKSKLLEVVTNEQAAPVRNSIARVISEIAKRELPLG  123

Query  402  EWPDLLPFLFQCSQSP  449
             WPDLLPFLF  + SP
Sbjct  124  TWPDLLPFLFNAADSP  139



>dbj|GAC94860.1| hypothetical protein PHSY_002433 [Pseudozyma hubeiensis SY62]
Length=1096

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A + ++    K+PQ +PAL   L T+    VRQLAAV
Sbjct  25   SFVQGLHELLKQSNVPDTNTVKAATESLQNNYYKNPQCIPALFEILATSPDLAVRQLAAV  84

Query  234  LLRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++    GK+    S Q+R  +K  L++ +T E +A VR A A V+S IAK  +PAG
Sbjct  85   ELRKRLAKSGGKVWTKQSVQVRDGIKAKLLEVVTNEQAAAVRSAIARVISEIAKRELPAG  144

Query  402  EWPDLLPFLFQCSQSP  449
             WP LLPFLFQ + SP
Sbjct  145  SWPALLPFLFQAADSP  160



>emb|CDI55053.1| related to KAP123-Importin beta-4 subunit [Melanopsichium pennsylvanicum 
4]
Length=807

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q+L  LL Q  +PD +  + A +Q++    K+ Q VPAL   L T+    VRQLAAV 
Sbjct  47   FVQALHELLKQSNVPDTNTVKAATEQLQNNYYKNSQCVPALFEILATSPDLAVRQLAAVE  106

Query  237  LRKKITGHWGKLSP----QLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK++    GK+      ++R  +K+ L++ +T E +APVR + A V+S IAK  +P G 
Sbjct  107  LRKRLAKSGGKIWTKQPLEVRNGIKEKLLEVVTNEQAAPVRNSIARVISEIAKRELPTGA  166

Query  405  WPDLLPFLFQCSQSP  449
            WP LLPFLFQ + SP
Sbjct  167  WPALLPFLFQAADSP  181



>ref|XP_002953478.1| hypothetical protein VOLCADRAFT_94324 [Volvox carteri f. nagariensis]
 gb|EFJ45451.1| hypothetical protein VOLCADRAFT_94324 [Volvox carteri f. nagariensis]
Length=1029

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +3

Query  108  NDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLR  287
            + A + AE  +KR+   P ++P L+     + +  VRQL+AVLLRK +T HW KLS   R
Sbjct  6    SQAIKAAEAALKRMTVSPTLLPELLARATGSPSAEVRQLSAVLLRKAVTKHWTKLSDPDR  65

Query  288  QLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
              ++  L+D +  E   PVRR+  ++V ++A+Y+VP GEWP LL FL +CS S
Sbjct  66   AHMQTVLLDRLVSEPYHPVRRSLGHLVGVVARYSVPRGEWPGLLEFLGRCSGS  118



>dbj|GAK66523.1| ARM repeat-containing protein [Pseudozyma antarctica]
Length=1287

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 77/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A D ++    K+PQ VPAL   L T+    VRQLAAV
Sbjct  55   SFVQGLHELLKQSNVPDTNTVKAATDALQNNYYKNPQCVPALFEILATSPDLAVRQLAAV  114

Query  234  LLRKKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++       W K    +R  +K  L++ +T E +APVR + A V+S IAK  +P G
Sbjct  115  ELRKRLAKSGGKVWNKQPADVRNGIKAKLLEVVTNEQAAPVRNSIARVISEIAKRELPLG  174

Query  402  EWPDLLPFLFQCSQSP  449
             W DLLPFLF  + SP
Sbjct  175  TWNDLLPFLFNAADSP  190



>ref|XP_646718.1| importin 4 [Dictyostelium discoideum AX4]
 gb|EAL72518.1| importin 4 [Dictyostelium discoideum AX4]
Length=1103

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E  L   L P+ND  + A D++ +L K  +    L H L ++    ++QL+AVLLR+K+
Sbjct  12   IEECLRALLQPNNDIIKAATDKLNKLLKKSEYSLYLFHLLESSPYDEIKQLSAVLLRQKL  71

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
              HW K S + R+ +K S++  +  + S  VRR+ + V+ IIA+  V  G W DL PFL 
Sbjct  72   VAHWTKFSVESRKYIKDSILKLVISQPSQLVRRSISEVIIIIARLEVATGTWGDLFPFLL  131

Query  432  QCSQSP  449
            Q S SP
Sbjct  132  QLSSSP  137



>ref|XP_006824744.1| PREDICTED: importin-4-like [Saccoglossus kowalevskii]
Length=971

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA SLE +L + L+PDN   +Q  ++++   K+P +  AL   L  A+ P +RQ AAVLL
Sbjct  1    MATSLEDILQKLLVPDNAVIQQGTNELREAFKNPAIASALCSVLCGAQNPQIRQFAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R++I   W K+ P  +Q ++ +L+  +T E    VR + A VVS IAK+ +   +WP+LL
Sbjct  61   RRRIVKQWKKVPPDDQQQLRVTLLQVLTQEPEHVVRHSVAEVVSSIAKHDLVENKWPELL  120

Query  420  PFLFQCSQSP  449
             FL + ++SP
Sbjct  121  TFLTEYTRSP  130



>ref|XP_011391028.1| hypothetical protein UMAG_15014 [Ustilago maydis 521]
 gb|KIS67455.1| hypothetical protein UMAG_15014 [Ustilago maydis 521]
Length=1066

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD +  + A +Q++    K+PQ +PAL   L T+    VRQLAAV
Sbjct  4    SFVQGLHELLKQSNVPDTNTVKAATEQLQNNYYKNPQCIPALFEILATSPDLAVRQLAAV  63

Query  234  LLRKKITGHWGKLSPQ----LRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++    GK+  +    +R  VK  L++ +T E  A VR A A V+S IAK  +PAG
Sbjct  64   ELRKRLAKSGGKVWTKQPVNVRDGVKAKLLEVVTNEQVAAVRNAIARVISEIAKRELPAG  123

Query  402  EWPDLLPFLFQCSQS  446
             WP LLPFLFQ + S
Sbjct  124  SWPALLPFLFQAADS  138



>ref|XP_007877108.1| hypothetical protein PFL1_01415 [Pseudozyma flocculosa PF-1]
 gb|EPQ31230.1| hypothetical protein PFL1_01415 [Pseudozyma flocculosa PF-1]
Length=1075

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q L  LL Q  +PD  A + A D ++ +  K+P  VPAL   L T+    VRQLAAV
Sbjct  4    SFVQGLHQLLAQTNVPDTAAVKAATDALQNQYYKNPACVPALFEILATSPDQAVRQLAAV  63

Query  234  LLRKKITGH---WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
             LRK++      W K + ++R  +K  L++ +T E +  VR A A V+S IAK  +P G 
Sbjct  64   ELRKRLAKSQKVWAKQTVEVRNGIKVKLLEIVTNEATPIVRNAIARVISEIAKRELPTGT  123

Query  405  WPDLLPFLFQCSQS  446
            WPDLLPFLF  ++S
Sbjct  124  WPDLLPFLFNAAES  137



>ref|XP_004363945.2| hypothetical protein CAOG_03106 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE92079.1| hypothetical protein CAOG_003106 [Capsaspora owczarzaki ATCC 
30864]
Length=1206

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            +LE  L Q L PD+    QA  ++      P  VPAL+H L  +    VRQLA V++R +
Sbjct  11   TLEHHLAQVLQPDSALISQATAELNAFFGLPVCVPALVHVLGASTNAGVRQLAGVIVRAR  70

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            +   W KL   +   +K +L+  I VE  + VR A+A V+ IIAK+ + A  WP+L+ F+
Sbjct  71   LIRQWMKLPADVHVWIKANLLAMIAVEPLSIVRHATAAVIGIIAKHDMRANNWPELVQFV  130

Query  429  FQCSQS  446
            FQCSQS
Sbjct  131  FQCSQS  136



>gb|EWM29705.1| Importin-beta [Nannochloropsis gaditana]
Length=1143

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            +LE LL+Q   PD    +QAE  IK+  K P  V  L+  L+ +    VRQL+A+LLR++
Sbjct  26   NLEALLLQLTAPDTQIIQQAEAVIKKYVKSPVCVAGLVQQLQGSTYLQVRQLSAMLLRRR  85

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            +  HW KL    ++ +K +L+ ++  E   P+R+  A+V+++ A+  +   +W +LL F+
Sbjct  86   LGPHWNKLDAHTKEALKAALLHTLANEQERPIRKNIASVIAVAARKLLSKNKWNELLSFI  145

Query  429  FQCSQS  446
            +Q SQS
Sbjct  146  YQYSQS  151



>gb|AAH80889.1| importin 4 [Xenopus (Silurana) tropicalis]
Length=636

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQ LE +L   L PDN   +QA  Q+K   KDPQ++PAL   LR ++   +RQ AAVLL
Sbjct  1    MAQILETILTSLLQPDNAVIQQATAQLKEAFKDPQIIPALFDILRGSQELQIRQFAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R+++  HW  + P+ +  +K  +++SI  E    VR A A ++++I K       WP+ +
Sbjct  61   RRRLNKHWKAIQPEQQHNLKIIVLESIQREPEHKVRYALAQLIAVILKNE-RLEHWPEFI  119

Query  420  PFLFQCSQS  446
             F+ Q S S
Sbjct  120  KFVLQLSHS  128



>gb|EFX65679.1| hypothetical protein DAPPUDRAFT_303554 [Daphnia pulex]
Length=1080

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            S++ +L + L PDN++ R    ++K   K P + P L+H  + + +P +RQ A VLLRK+
Sbjct  3    SVDEILAKVLEPDNESIRTGTAELKEAMKRPTICPTLLHIGKYSTSPQIRQYALVLLRKR  62

Query  249  ITG--HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
            ++   HW KL+   +  +K  L+D++T E    VR ++A VV+ IAK+ +   +WP+LL 
Sbjct  63   LSKYYHWEKLTVDFKHGIKSGLLDALTREPEISVRNSAAQVVASIAKHELAERKWPELLE  122

Query  423  FLFQ-CSQS  446
            F+ Q C Q 
Sbjct  123  FMQQLCCQG  131



>gb|KIJ55832.1| hypothetical protein M422DRAFT_63753 [Sphaerobolus stellatus 
SS14]
Length=1055

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
            A  Q+L  LL Q   PD    + A  QIK L K+PQ +PAL   L T+  P+VRQLAAV 
Sbjct  4    AFVQNLHGLLQQVTAPDTSLVKAATSQIKNLYKEPQCIPALFEILATSPEPSVRQLAAVE  63

Query  237  LRKKIT----GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK I      +W  +    RQ +K  +++    E  + VR ASA V++ IA+  +P   
Sbjct  64   LRKIINQDEGKNWQSIDQGTRQTIKDKIVEVTFNEQVSIVRHASARVIAAIAELELPLDL  123

Query  405  WPDLLPFLFQCSQS  446
            WP L+P L Q + S
Sbjct  124  WPGLMPLLTQAATS  137



>ref|NP_001008011.2| importin-4 [Xenopus (Silurana) tropicalis]
Length=1076

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MAQ LE +L   L PDN   +QA  Q+K   KDPQ++PAL   LR ++   +RQ AAVLL
Sbjct  1    MAQILETILTSLLQPDNAVIQQATAQLKEAFKDPQIIPALFDILRGSQELQIRQFAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R+++  HW  + P+ +  +K  +++SI  E    VR A A ++++I K       WP+ +
Sbjct  61   RRRLNKHWKAIQPEQQHNLKIIVLESIQREPEHKVRYALAQLIAVILKNE-RLEHWPEFI  119

Query  420  PFLFQCSQS  446
             F+ Q S S
Sbjct  120  KFVLQLSHS  128



>gb|EFA85401.1| importin 4 [Polysphondylium pallidum PN500]
Length=1029

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 72/125 (58%), Gaps = 0/125 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +EL L  FL P+ +  ++A + + R+ K P     LIH ++++    ++ LAAVLLRKK+
Sbjct  9    VELNLRGFLEPNTEVVQRATNNMNRILKKPSASLILIHFIQSSPYREIKHLAAVLLRKKL  68

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
              HW KLS + R  +K   ID    E    ++++ A V+ IIA+  +P GEW    PFLF
Sbjct  69   VVHWTKLSSKDRDTIKPMFIDLFLKETDGLLKKSIAEVMIIIARVELPLGEWKTFTPFLF  128

Query  432  QCSQS  446
              S+S
Sbjct  129  GLSES  133



>ref|XP_005648058.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23514.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=1073

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 76/125 (61%), Gaps = 0/125 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            LE +L   L P+N  R QAE  +K L K   ++  L+  +R +++  VR L +  LRK +
Sbjct  8    LESILSACLSPENMRRAQAEAALKALCKQRDILLMLLSTVRQSESAEVRLLGSQTLRKSM  67

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
              HW +L  Q +  +K  L+++++ E    VRRA + VV+ I++  VPAG+WP LLP+L 
Sbjct  68   KTHWRQLPKQAQDSLKVGLLEALSAEPVTSVRRALSIVVATISQTDVPAGDWPTLLPWLH  127

Query  432  QCSQS  446
            QC+QS
Sbjct  128  QCTQS  132



>ref|XP_011402444.1| PREDICTED: importin-4-like [Amphimedon queenslandica]
Length=1062

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +3

Query  63   AQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            A  +E L    L PD +  RQA  +++ + K+P ++ +L H +  ++ P++RQL+AV+LR
Sbjct  5    ASDMERLFSLLLSPDTEVIRQATAELRSIYKNPSLLNSLCHVMLHSEDPHIRQLSAVVLR  64

Query  243  KKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
            KK+   W +LS + R+ +K   I+S++ E    V R+ AN+VS+IA +     +WP+L  
Sbjct  65   KKLVQTWRRLSVEDRESLKNIFIESLSSEMHQLVLRSVANLVSVIASHEFSHNQWPELSQ  124

Query  423  FLFQCSQS  446
            F+ +  QS
Sbjct  125  FIMKSCQS  132



>ref|XP_008436898.1| PREDICTED: importin-4 [Poecilia reticulata]
Length=1090

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L+Q   PDN   +QA  Q+K+  KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MIEELEQILLQLTQPDNAIIQQATVQLKQAFKDPAIIPALCAVMSGSQNPEIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ + ++E    V+ + + + +++ +Y  P   WP LL
Sbjct  61   RLRVKKHWNKISPNDRESLKAVVLQAFSMEAEHKVQHSVSQLCAVMVRYETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_010779271.1| PREDICTED: importin-4 [Notothenia coriiceps]
Length=942

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LEL+L Q   PDN   +QA  Q+K+  KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MTEELELILSQLTQPDNAVIQQATVQLKQAFKDPAIIPALCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K++P  R+ +K  ++ +   E    V+ + + + +++ K+  P   WPDLL
Sbjct  61   RLRVKKHWKKINPNDRESLKTVVLQAFMQETEHTVQHSLSQLCAMMVKHETP-DRWPDLL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQATKS  128



>dbj|GAM20378.1| hypothetical protein SAMD00019534_035530 [Acytostelium subglobosum 
LB1]
Length=1061

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   LMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLS  275
            L PD +  + A  ++  L K+P     L HH+++++   ++ +AAVL+RKK+  HW KLS
Sbjct  18   LQPDTNTVQMATAKLNTLLKNPNASLILAHHIQSSQFKEIKHVAAVLMRKKLVVHWTKLS  77

Query  276  PQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCS  440
             Q R+ VK  +ID    E    +RR+ A ++ II +  +P  +W    PFL+Q S
Sbjct  78   SQNREAVKNLMIDLFNKETDFTIRRSIAEIMIIICRVELPVAQWKQFTPFLYQLS  132



>ref|XP_005096783.1| PREDICTED: importin-4-like [Aplysia californica]
Length=1081

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 71/125 (57%), Gaps = 2/125 (2%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA SLE +L + L PDND  ++A  ++K   KDP  +  L H L T+  P +RQ AAVL+
Sbjct  1    MAASLEQILARLLEPDNDVIQKATLELKEAFKDPATLQNLCHILGTSTQPQIRQYAAVLI  60

Query  240  RKKI--TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPD  413
            R+KI  +  W  L   ++  ++ +++  +  E +   R A A +V +IA++  P  +WP 
Sbjct  61   RRKIHKSKQWAALDNTIKDSIRGNILQLLVQEDNKSARSAIAQIVGVIARHDTPTNQWPA  120

Query  414  LLPFL  428
            L  FL
Sbjct  121  LFDFL  125



>ref|XP_004081009.1| PREDICTED: importin-4 [Oryzias latipes]
Length=1087

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M++ LE +L+Q   PDN A +QA  Q+K+  KDP V+PAL   + +++ P +RQ A V L
Sbjct  1    MSEELEQILLQLTQPDNAAIQQATAQLKQACKDPAVIPALCAVISSSQNPLIRQTATVTL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R K+  HW K++P  R+ +K  ++ +   E    V+ A + + +++ K+  P   WP LL
Sbjct  61   RLKVKKHWKKINPNDRESLKAVVLQAFMQETDHTVQHALSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQATKS  128



>ref|XP_007548008.1| PREDICTED: importin-4 [Poecilia formosa]
Length=1090

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L+Q   PDN   +QA  Q+K+  KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MIEELEQILLQLTQPDNAIIQQATVQLKQAFKDPAIIPALCAVMSGSQNPEIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ + ++E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWNKISPNDRESLKAVVLQAFSMEAEHKVQHSVSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_005803702.1| PREDICTED: importin-4-like [Xiphophorus maculatus]
Length=1090

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L+Q   PDN   +QA  Q+K+  KDP V+PAL   +  ++ P +RQ AAV+L
Sbjct  1    MIEELEQILLQLTQPDNAIIQQATVQLKQAFKDPAVIPALCAVMSGSQNPEIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ + ++E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWNKISPNDRESLKAVVLQAFSLEAEHKVQHSLSQLCAMMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>gb|KDQ11917.1| hypothetical protein BOTBODRAFT_34989 [Botryobasidium botryosum 
FD-172 SS1]
Length=1077

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 5/132 (4%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q L  LL+Q   PD    + A  Q+ +   K P  +PAL   + +A    +RQLAAV LR
Sbjct  7    QKLHALLLQTSAPDTALIKAATAQLNQEYYKSPDCIPALFEIIASAPEQTIRQLAAVELR  66

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K++       W  L+  +R+ +K  + + I VE S  VR ++A V++ IA+  +P   WP
Sbjct  67   KRVMQKEGTLWIALAQDVRETIKSKIAEVIIVEQSEIVRHSTARVIATIAEIELPLNNWP  126

Query  411  DLLPFLFQCSQS  446
             LLP+L+QC+ S
Sbjct  127  ALLPWLYQCATS  138



>ref|XP_001199451.2| PREDICTED: importin-4-like [Strongylocentrotus purpuratus]
Length=241

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 75/130 (58%), Gaps = 1/130 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+ +LE +L++ L+PDN   +Q  D++K+  K+P VVP L   L T+  P VRQ AAVLL
Sbjct  1    MSSALEQILLKLLVPDNVVIQQGTDELKQALKNPGVVPELCSVLTTSPNPQVRQFAAVLL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++   W K SP     +K   +  +  E    VR + A + + IA+Y +   +WP++L
Sbjct  61   R-RLVRRWKKFSPDFHNSLKLISLQVLQHETERVVRNSVAQLAAAIARYELADQKWPEIL  119

Query  420  PFLFQCSQSP  449
             ++ + + +P
Sbjct  120  QYIQEGAANP  129



>ref|XP_009494320.1| hypothetical protein H696_02149 [Fonticula alba]
 gb|KCV71197.1| hypothetical protein H696_02149 [Fonticula alba]
Length=1088

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +3

Query  63   AQSLELLL--IQFLMPDN-DARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAA  230
            AQ+LE L   I  L+ +N +  + A D + K   K PQ VPAL H +  +  P +RQ++A
Sbjct  6    AQTLEDLEKHISLLLENNTETVKNATDYLNKNYLKSPQSVPALCHLMFNSPNPVIRQMSA  65

Query  231  VLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
             LL +++T +W ++    R  +K+++++ I  + S  VRRA A VVS+IAK+   +  WP
Sbjct  66   TLLFRQVTRYWIRVPEAERNALKETMLNQIVSDPSEVVRRAMARVVSVIAKHEAASNTWP  125

Query  411  DLLPFLFQCSQS  446
             L  FL QC  S
Sbjct  126  QLFDFLNQCCMS  137



>ref|XP_009515678.1| hypothetical protein PHYSODRAFT_471015 [Phytophthora sojae]
 gb|EGZ28403.1| hypothetical protein PHYSODRAFT_471015 [Phytophthora sojae]
Length=1080

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q   PD +  +QAE  +K   K    V  L+  L+ +  P VRQLAA++LRK
Sbjct  7    EQLEACLLQLTHPDTEQIKQAEAALKAYTKQIAAVGGLLTQLQHSAKPEVRQLAALMLRK  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI  HW KL    +   KQ L+     +    VR   A +++ +A + VP+G WP+L+ F
Sbjct  67   KIFKHWPKLDAAAQAQAKQVLLSRAAEDPVHAVRSTVATLITALALHEVPSGNWPELMVF  126

Query  426  LFQCSQS  446
            +  C+ S
Sbjct  127  INTCANS  133



>ref|XP_009268036.1| putative importin subunit beta-4 [Wallemia ichthyophaga EXF-994]
 gb|EOR01245.1| putative importin subunit beta-4 [Wallemia ichthyophaga EXF-994]
Length=1057

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 5/137 (4%)
 Frame = +3

Query  54   EAMAQSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAA  230
            EA  Q+L  LL Q + PD    + A   +  +  K P+ +P L   + ++    VRQLAA
Sbjct  2    EAYVQNLHSLLEQTVAPDTQIIKNATATLNAQYYKAPECIPGLFEVVASSPMDPVRQLAA  61

Query  231  VLLRKKITGHWGKL---SPQ-LRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA  398
            V LRK+++   G L    PQ +R  +K  L++ I VEHS  VR + A V+S IA+  +P 
Sbjct  62   VELRKRVSNSNGNLWKNCPQEIRTSIKSRLLEVILVEHSNLVRHSCARVISAIAEIELPL  121

Query  399  GEWPDLLPFLFQCSQSP  449
              WPDLL +L Q S SP
Sbjct  122  NTWPDLLSYLTQASTSP  138



>gb|ETP46722.1| hypothetical protein F442_07089 [Phytophthora parasitica P10297]
Length=267

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q   PD +  +QAE  +K   K    V  L+  L+ +  P VRQLAA++LRK
Sbjct  7    EQLEACLLQLTNPDTEQIKQAEVALKAYTKQIASVGGLLTQLQHSAKPEVRQLAALMLRK  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI  HW KL    +   KQ+L+     +    VR   A +++ +A + VPAG WP+L+ F
Sbjct  67   KIFKHWPKLDAAAQAQAKQALLSRAAEDPVHAVRSTVATLIAALALHEVPAGNWPELMVF  126

Query  426  LFQCSQS  446
            +  C+ S
Sbjct  127  INTCANS  133



>ref|XP_002906616.1| importin-like protein [Phytophthora infestans T30-4]
 gb|EEY66017.1| importin-like protein [Phytophthora infestans T30-4]
Length=1079

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q   PD +  +QAE  +K   K    V  L+  L+ +  P VRQLAA++LRK
Sbjct  7    EQLEACLLQLTNPDTEQIKQAEVALKAYTKQIASVGGLLTQLQHSAKPEVRQLAALMLRK  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI  HW KL    +   KQ L+     +    VR   A +++ +A + VPAG WP+L+ F
Sbjct  67   KIFKHWPKLDAAAQAQAKQVLLSRAAEDPVHVVRSTVATLIAALALHEVPAGNWPELMVF  126

Query  426  LFQCSQS  446
            +  C+ S
Sbjct  127  INTCANS  133



>ref|XP_004344724.1| HEAT repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20981.1| HEAT repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=1116

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 0/124 (0%)
 Frame = +3

Query  75   ELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKIT  254
            E LL Q ++P+ +  R A  +++   K      AL+  +       +R LA ++LR K  
Sbjct  14   EHLLGQMMIPNTEVVRAAGAELENRLKTSAAAIALLQLIINHPQIQIRHLAGIILRMKAV  73

Query  255  GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQ  434
              W K+  + ++L+K SL+ ++  E   PVR   A+VV I+A+  VP+  WP+LL FLFQ
Sbjct  74   SLWAKMDAEAQKLMKDSLLQALVREPQKPVRNGIADVVGIVARITVPSNAWPELLDFLFQ  133

Query  435  CSQS  446
            C+ S
Sbjct  134  CTNS  137



>emb|CBN81817.1| Importin-4 [Dicentrarchus labrax]
Length=1089

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAVIQQATAQLKQAFKDPAIIPALCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQTFMQEAEHTVQHSLSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>emb|CBJ48489.1| ran binding protein 4-like protein [Ectocarpus siliculosus]
Length=1087

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            LE LL++  +PD    ++AE  +K+  K+P  VP L+  +R+++    RQLAA+LL+KKI
Sbjct  21   LEQLLMEMFVPDTAQIKKAEGLLKKYTKEPACVPPLLQQMRSSQHEQARQLAAMLLKKKI  80

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAK--YAVPAGEWPDLLPF  425
              HW   +   ++ VK  L+ ++  + S  VR + A++++ +AK  +A P G W +LL  
Sbjct  81   VQHWKTFNDAEKESVKSVLLQAVGTDPSRLVRISVASLIAKLAKTLFATPQG-WQELLDL  139

Query  426  LFQCSQ  443
            + QC+Q
Sbjct  140  VGQCAQ  145



>ref|XP_005837332.1| hypothetical protein GUITHDRAFT_104162 [Guillardia theta CCMP2712]
 gb|EKX50352.1| hypothetical protein GUITHDRAFT_104162 [Guillardia theta CCMP2712]
Length=988

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = +3

Query  102  PDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQ  281
            P ND  + AE ++K ++  P     LI    ++ +P +RQLAAVL R+K   HW  +  +
Sbjct  335  PQNDGIKAAEQRLKAVSSSPSYTILLIDRAMSSPSPQIRQLAAVLARRKCIRHWDMMGDE  394

Query  282  LRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
             R  V+  L   +  E    VRR+ A +VS IAK AVPAG+W  LL FL + S+S
Sbjct  395  DRGRVRSMLEHMLAHEPEHLVRRSIAELVSSIAKLAVPAGQWTGLLQFLLEASES  449



>emb|CCA20225.1| importinlike protein putative [Albugo laibachii Nc14]
Length=1080

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            Q LE  ++Q    D +  +QAED +K   K+ + +  L+  L  +    VRQ AA+LLRK
Sbjct  10   QQLENCILQLTQADTNQIKQAEDVLKAYMKNSECIHGLMTQLEHSSHAQVRQYAAILLRK  69

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            +I  HW  L   ++  +KQ+L+     E++  VR    ++V+ IA   +P  +WP+L  F
Sbjct  70   RIFKHWSALDASMQSNLKQALLQRAVQENTRIVRFNIIDLVAAIASRELPMQKWPELFSF  129

Query  426  LFQCSQS  446
            +  C+QS
Sbjct  130  VTNCTQS  136



>gb|KIY62189.1| ARM repeat-containing protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=1077

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 74/134 (55%), Gaps = 5/134 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
             AQ L  LL+Q L PD +  + A   + K   K  Q +PAL   + ++    +RQLAAV 
Sbjct  5    FAQGLYNLLLQTLSPDTETLKNATQTLSKEYYKKAQCIPALGEIIASSPEFPLRQLAAVE  64

Query  237  LRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK+I    GKL    S  LR  +K  L + I  E +A VR ASA VV+ IA+  VP G 
Sbjct  65   LRKRIAYDSGKLWLEVSQDLRDSLKTKLPEIIFKEPNASVRSASARVVAAIAEIEVPLGS  124

Query  405  WPDLLPFLFQCSQS  446
            WP+LLP L Q S S
Sbjct  125  WPELLPLLHQASTS  138



>ref|XP_008857732.1| HEAT repeat domain containing protein [Entamoeba nuttalli P19]
 gb|EKE39933.1| HEAT repeat domain containing protein [Entamoeba nuttalli P19]
Length=1055

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE ++   L+P+ +   QA   I +L K P+++  +++ L     P +RQ+  VLLRK
Sbjct  6    EQLEQIISNLLVPNTEVISQATQTIVQLLKHPEIIMPMMNILVNHPRPELRQITGVLLRK  65

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI+  W KL+P++++ ++ +L+  I  E    +    A ++ +I K  +P G+WP LL  
Sbjct  66   KISVVWAKLTPEIQEQIENALLQIINTESIKIISITVAQIIIVIGKLTIPIGKWPALLNQ  125

Query  426  LFQCSQS  446
            + Q +QS
Sbjct  126  VLQWTQS  132



>ref|XP_649419.2| HEAT repeat domain containing protein [Entamoeba histolytica 
HM-1:IMSS]
 gb|EAL44033.2| HEAT repeat domain containing protein [Entamoeba histolytica 
HM-1:IMSS]
 gb|EMD48484.1| HEAT repeat domain containing protein [Entamoeba histolytica 
KU27]
 gb|EMH74199.1| HEAT repeat domain containing protein [Entamoeba histolytica 
HM-1:IMSS-B]
 gb|EMS14776.1| HEAT repeat domain containing protein [Entamoeba histolytica 
HM-3:IMSS]
 gb|ENY60255.1| HEAT repeat domain containing protein [Entamoeba histolytica 
HM-1:IMSS-A]
Length=1055

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE ++   L+P+ +   QA   I +L K P+++  +++ L     P +RQ+  VLLRK
Sbjct  6    EQLEQIISNLLVPNTEVISQATQTIVQLLKHPEIIMPMMNILVNHPRPELRQITGVLLRK  65

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI+  W KL+P++++ ++ +L+  I  E    +    A ++ +I K  +P G+WP LL  
Sbjct  66   KISVVWAKLTPEIQEQIENALLQIINTESIKIISITVAQIIIVIGKLTIPIGKWPALLNQ  125

Query  426  LFQCSQS  446
            + Q +QS
Sbjct  126  VLQWTQS  132



>ref|XP_003443579.1| PREDICTED: importin-4 isoform X1 [Oreochromis niloticus]
Length=1086

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++P L   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPGLCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DHWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLTQSTKS  128



>ref|XP_002675525.1| importin beta [Naegleria gruberi]
 gb|EFC42781.1| importin beta [Naegleria gruberi]
Length=1083

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +3

Query  63   AQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            AQ LE +L+  ++PD++  +QAE  +K   K  + +   +  ++ +    VRQL+AVL+R
Sbjct  12   AQELEQVLLCLMVPDSNIIKQAEGVVKLFMKQKECLVGFVSQIKGSSHIGVRQLSAVLMR  71

Query  243  KKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
             K+  HW K+  Q ++ +KQ+L++++  E +  VR +   ++ +++ Y + +  WP L  
Sbjct  72   LKLKNHWKKIEQQTKEEIKQNLLEALLAEATHLVRTSLIELIGVLSCYEISS--WPALPQ  129

Query  423  FLFQCSQ  443
            FL QC Q
Sbjct  130  FLMQCVQ  136



>gb|KDD75633.1| hypothetical protein H632_c581p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=456

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +3

Query  63   AQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQV-VPALIHHLRTAKTPNVRQLAAVLL  239
            A + E LL   +   N+ R  AE     L K P V V +L+  LR +     R L+AVLL
Sbjct  13   AAAFETLLQSLMSAQNEQRSAAEAMFTELKKVPDVCVGSLVRSLRHSSDTMHRSLSAVLL  72

Query  240  RKKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            RK +T      WGKLS   ++LVK   ++ I  E  A + +   ++VS +A   V  G W
Sbjct  73   RKTLTRDDESIWGKLSNDAKELVKTECLNCIKEEPQAVITKKVCDLVSQLAVGLVEEGGW  132

Query  408  PDLLPFLFQCSQS  446
            P LLPF+FQC +S
Sbjct  133  PALLPFMFQCVRS  145



>gb|KIO24659.1| hypothetical protein M407DRAFT_8850 [Tulasnella calospora MUT 
4182]
Length=455

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = +3

Query  153  KDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKL----SPQLRQLVKQSLIDSI  320
            KDP  +PAL   + T+   N+RQLAAV LRK+I    GKL       +RQ VK  ++++I
Sbjct  38   KDPACIPALFEIIATSPEQNIRQLAAVELRKRIAQGDGKLWRALDANIRQQVKTKIVETI  97

Query  321  TVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQSP  449
              E  A VR +++ V++ IA + + A  WP+L+PFL Q + SP
Sbjct  98   LAEQVAIVRHSTSRVIAAIASWDLAANAWPELMPFLQQATSSP  140



>ref|XP_001734636.1| importin beta-4 [Entamoeba dispar SAW760]
 gb|EDR29188.1| importin beta-4, putative [Entamoeba dispar SAW760]
Length=1055

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE ++   L+P+ +   QA   I +L K P+++  +++ L     P +RQ+  VLLRK
Sbjct  6    EQLEQIISNLLVPNTEIISQATQTIVQLLKHPEIIMPMMNILVNHPRPELRQITGVLLRK  65

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI+  W KL+P++++ ++ +LI  I  +    +    A ++ +I K  +P G+WP LL  
Sbjct  66   KISVVWAKLTPEIQEQIENALIQIINTDTVKIISITVAQIIIVIGKLTIPIGKWPALLNQ  125

Query  426  LFQCSQS  446
            + Q +QS
Sbjct  126  VLQWTQS  132



>ref|XP_004546523.1| PREDICTED: importin-4-like [Maylandia zebra]
Length=1086

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++P L   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPGLCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DHWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>gb|KFH65491.1| hypothetical protein MVEG_08969 [Mortierella verticillata NRRL 
6337]
Length=1047

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +3

Query  156  DPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHS  335
            +   VPAL+H ++T+    VRQLAAV LRK+++  W KL   +R  VK  L++ I  E  
Sbjct  38   EANCVPALVHIIQTSPQKEVRQLAAVELRKQVSHWWIKLDLDVRTAVKAKLLEIILSEPE  97

Query  336  APVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            +  R A+A V++ + +  +PAG W +L+ FLFQCS S
Sbjct  98   SLPRHATARVIATVGRVEIPAGTWSELIAFLFQCSSS  134



>ref|XP_006794796.1| PREDICTED: importin-4-like [Neolamprologus brichardi]
Length=1084

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++P L   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPGLCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_005722478.1| PREDICTED: importin-4-like [Pundamilia nyererei]
Length=1086

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++P L   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPGLCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_005942469.1| PREDICTED: importin-4-like [Haplochromis burtoni]
Length=1086

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++P L   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPGLCAVMSGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_010739919.1| PREDICTED: importin-4 [Larimichthys crocea]
Length=1094

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE +L Q   PDN   +QA  Q+K+  KDP ++PAL   +  +  P +RQ AAV+L
Sbjct  1    MTEQLEQILSQLTQPDNAIIQQATAQLKQAFKDPAIIPALCAVMSGSPNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPDDRESLKAVVLQAFMQETEHTVQHSLSQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  QLLNQSTKS  128



>ref|XP_008903634.1| hypothetical protein PPTG_10113 [Phytophthora parasitica INRA-310]
 gb|ETI49035.1| hypothetical protein F443_07026 [Phytophthora parasitica P1569]
 gb|ETK88903.1| hypothetical protein L915_06928 [Phytophthora parasitica]
 gb|ETL42301.1| hypothetical protein L916_06876 [Phytophthora parasitica]
 gb|ETL95475.1| hypothetical protein L917_06743 [Phytophthora parasitica]
 gb|ETM48674.1| hypothetical protein L914_06835 [Phytophthora parasitica]
 gb|ETN11151.1| hypothetical protein PPTG_10113 [Phytophthora parasitica INRA-310]
 gb|ETO77773.1| hypothetical protein F444_07094 [Phytophthora parasitica P1976]
 gb|ETP18802.1| hypothetical protein F441_07039 [Phytophthora parasitica CJ01A1]
Length=1079

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q   PD +  +QAE  +K   K    V  L+  L+ +  P VRQLAA++LRK
Sbjct  7    EQLEACLLQLTNPDTEQIKQAEVALKAYTKQIASVGGLLTQLQHSAKPEVRQLAALMLRK  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI  HW KL    +   KQ+L+     +    VR   A +++ +A + VPAG WP+L+ F
Sbjct  67   KIFKHWPKLDAAAQAQAKQALLSRAAEDPVHAVRSTVATLIAALALHEVPAGNWPELMVF  126

Query  426  LFQCSQS  446
            +  C+ S
Sbjct  127  INTCANS  133



>ref|XP_008276178.1| PREDICTED: importin-4 [Stegastes partitus]
Length=1087

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE  L+Q   PDN   +QA  ++K+  KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MTEELEQTLLQLTEPDNAVIQQATAKLKQAFKDPAIIPALCAVIGGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RLRVKKHWKKISPNDRESLKAVVLQAFIQETEHSVQHSISQLCAVMVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L + ++S
Sbjct  120  QLLNESTKS  128



>ref|XP_002116144.1| hypothetical protein TRIADDRAFT_60126 [Trichoplax adhaerens]
 gb|EDV21177.1| hypothetical protein TRIADDRAFT_60126 [Trichoplax adhaerens]
Length=1035

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  126  AEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQS  305
            A  ++K + K P V+  L   L  ++ P VRQ AA+LLR+KI+  W KL    R  +KQ 
Sbjct  35   ATTELKEILKSPAVIGQLASLLTVSQFPQVRQYAAILLRRKISKLWNKLDSDSRFRMKQL  94

Query  306  LIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQSP  449
             + ++T E    V+ + A ++S+IAKY +P G W +L+  L + ++SP
Sbjct  95   CLQALTQESIKIVQHSIAEIISVIAKYDLPEGNWNELMILLSEYTKSP  142



>emb|CCA67413.1| related to KAP123-Importin beta-4 subunit [Piriformospora indica 
DSM 11827]
Length=1069

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            + Q +  LL +  +PD    ++A  Q++++  +P+ +P L      A    +RQLAAV L
Sbjct  5    LTQQVYQLLQKTTVPDTATLKEATAQLQQVLVNPECIPVLFELSVAAPESTIRQLAAVEL  64

Query  240  RKKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            RK++       W  + P+ R+ +K  L++ +  E  + VR + A V+S +A   +P GEW
Sbjct  65   RKQVNSEENSPWLHVPPEFRKNIKTGLLERLLNESESIVRHSLARVISAVASIELPQGEW  124

Query  408  PDLLPFLFQCSQSP  449
            PDLLPF+ +  ++P
Sbjct  125  PDLLPFVQRLCEAP  138



>ref|XP_011152708.1| PREDICTED: importin-4-like [Harpegnathos saltator]
 gb|EFN75640.1| Importin-4 [Harpegnathos saltator]
Length=1078

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L++  +PDN   +QA  ++++  ++P  + AL   + T+  P VRQ AAVLLRK+ 
Sbjct  1    MESILLKLCVPDNSTIQQATAELRKALRNPDNISALCQLIVTSTNPQVRQYAAVLLRKRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                +W  L   +R   K  ++ ++  E    VR A A ++ II K+ +P   WP++L F
Sbjct  61   NKEKYWTSLPENIRTEFKALILQALVNEQQKNVRNAIAQLIGIIVKHELPTNTWPEILQF  120

Query  426  LFQ  434
            + Q
Sbjct  121  IQQ  123



>ref|XP_684163.4| PREDICTED: importin-4 [Danio rerio]
Length=1085

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M++ LE +L +   PDN   +QA  ++K+  KDP ++PAL   +  ++ P VRQ AAV+L
Sbjct  1    MSEELERVLTRLTEPDNAVIQQATAELKQAFKDPAIIPALCAVMTGSQNPQVRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++   W K+SP  R+ +K  ++ +   E    VR + + + +++ K+  P   WP LL
Sbjct  61   RMRVRKQWKKISPDHRESLKAVVLQAFQQETEHTVRHSLSQLSAVLVKHETP-DRWPALL  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  ELLNQSTKS  128



>emb|CDQ70384.1| unnamed protein product [Oncorhynchus mykiss]
Length=1087

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+  LE +L+Q   PDN   +QA  Q+K   KDP ++PAL   +  ++ P +RQ AAV+L
Sbjct  1    MSGELEQILLQLTQPDNAIIQQATAQLKLAFKDPAIIPALCAVMTGSQNPQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+S   R+ +K  ++ +   E    VR + + + +++ K+  P   WP L 
Sbjct  61   RMRVKKHWKKISLDHRESLKAVVLQAFQQETEHTVRHSLSQLSAVMVKHETP-DRWPALF  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  TLLNQSTKS  128



>emb|CCI47572.1| unnamed protein product [Albugo candida]
Length=1079

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            Q LE  ++Q    D +  +QAED +K   K    +  L+  L  +    VRQ AA+LLRK
Sbjct  10   QQLETCILQLTQADTNQIKQAEDALKIYMKSSACIHGLMTQLEHSSYAQVRQYAAILLRK  69

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            +I  HW  L   ++  +KQ L+     E +  VR    ++V+ IA   +P  +WP+L  F
Sbjct  70   RIFKHWSALDVSMQTNLKQVLLQRAVQESTRIVRFNIIDLVAAIASRELPMQKWPELFSF  129

Query  426  LFQCSQS  446
            +  C+QS
Sbjct  130  VTNCAQS  136



>ref|XP_009066572.1| hypothetical protein LOTGIDRAFT_229803 [Lottia gigantea]
 gb|ESO82779.1| hypothetical protein LOTGIDRAFT_229803 [Lottia gigantea]
Length=1085

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 73/125 (58%), Gaps = 2/125 (2%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA  +E +L + L P+N+  ++A  Q+K   KDP ++ AL H L ++    +RQ +AVL+
Sbjct  1    MAVVVEEILAKLLQPNNEVIQEATKQLKEAFKDPGILSALCHILGSSTNSQIRQYSAVLI  60

Query  240  RKKI--TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPD  413
            R+KI  + HW  L  + ++ ++++++  +  E    V+ A   ++  IA++ +P  +WP 
Sbjct  61   RRKIQKSRHWNALPNETKESIRRNILQLLVQEPDKNVKTAIGTIIGTIARHDLPTNKWPA  120

Query  414  LLPFL  428
            L  F+
Sbjct  121  LFEFV  125



>ref|XP_006955840.1| ARM repeat-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM24006.1| ARM repeat-containing protein [Wallemia sebi CBS 633.66]
Length=1056

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 5/136 (4%)
 Frame = +3

Query  54   EAMAQSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAA  230
            EA  Q+L  LL Q + PD    + A   +  +  K P+ +P L   + ++    VRQLAA
Sbjct  2    EAYVQNLHSLLEQTVAPDTQIIKNATATLNAQYYKSPECIPGLFEVVASSPMDPVRQLAA  61

Query  231  VLLRKKITGHWGKL---SPQ-LRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA  398
            V LRK++    G L    PQ +R  +K  L++ I VE+S  VR + A V+S IA+  +P 
Sbjct  62   VELRKRVGNSNGNLWKNCPQDIRTSIKSRLLEVILVENSNLVRHSCARVISAIAEIELPL  121

Query  399  GEWPDLLPFLFQCSQS  446
              WPDLL +L Q S S
Sbjct  122  NTWPDLLGYLTQASTS  137



>ref|XP_010884099.1| PREDICTED: importin-4 [Esox lucius]
Length=1090

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+  LE +L+Q   PDN   +QA  Q+K   KDP ++PAL   +  +  P  RQ AAV+L
Sbjct  1    MSGDLEQILLQLTQPDNAIIQQATAQLKLAFKDPAIIPALCAVMTGSPNPESRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+SP  R+ +K  ++ +   E    VR + + + +++ K+  P   WP L 
Sbjct  61   RMRVKKHWKKISPDHRESLKTVVLQAFQQETEHKVRHSLSQLSAVMVKHETP-DRWPALF  119

Query  420  PFLFQCSQS  446
              L + + S
Sbjct  120  ALLNESTNS  128



>ref|XP_002770260.1| DEHA2D04026p [Debaryomyces hansenii CBS767]
 emb|CAR65616.1| DEHA2D04026p [Debaryomyces hansenii CBS767]
Length=1105

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SLE  L Q L+PD+ A +QA  ++ K     P  +P+L+H L+ A+   ++QLAAV  RK
Sbjct  8    SLEETLKQTLVPDSTAIKQAVTKLTKEFYTSPLALPSLLHILQNAQDDQLKQLAAVEARK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
             +  +W  +   L+  +++S++++   + S  +R +SA VV+ I +  +   EWP+LLP 
Sbjct  68   LVLTNWEGVDASLKPQIRESMLNNTFTQSSKLIRHSSARVVASIGEVDLENNEWPELLPV  127

Query  426  LFQCSQ  443
            L +  Q
Sbjct  128  LVKSIQ  133



>emb|CDQ85517.1| unnamed protein product [Oncorhynchus mykiss]
Length=1085

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M+  LE +L+Q   PDN   +QA  Q+K   KDP ++PAL   +  ++   +RQ AAV+L
Sbjct  1    MSGELEQILLQLTQPDNAIIQQATAQLKLAFKDPAIIPALCAVMTGSQNSQIRQSAAVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K+ P  R+ +K  ++ +   E    VR + + + +++ K+  P   WP L 
Sbjct  61   RMRVKKHWKKIGPDHRESLKAVVLQAFQQETEHTVRHSLSQLSAVMVKHETP-DRWPALF  119

Query  420  PFLFQCSQS  446
              L Q ++S
Sbjct  120  TLLNQSTKS  128



>gb|KIY92330.1| hypothetical protein MNEG_15633 [Monoraphidium neglectum]
Length=117

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 1/113 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            L+ +L   L  DN AR+ AE  +K+L+     VP L   L  A    VRQLAAVL+RK +
Sbjct  4    LDAMLAACLGFDNQARKAAEKALKQLSGHADYVPELCKRLEAADA-QVRQLAAVLVRKAV  62

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            + H+ KL P+ +  ++  L+  +  E    VRRA A+V   +A+ AVP  +WP
Sbjct  63   SKHFPKLPPEAQARIRALLLQRVVQEPLHSVRRAIADVAGAVARIAVPLNQWP  115



>gb|ESA16297.1| hypothetical protein GLOINDRAFT_333841, partial [Rhizophagus 
irregularis DAOM 181602]
Length=1024

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            V AL+  L ++    VRQLAAV LRK+    W K+    +  +K  L++ I  E    VR
Sbjct  16   VAALVQILSSSTHWQVRQLAAVELRKRSIKWWSKIDINTQTAIKNQLLEVILRESHELVR  75

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQSP  449
             A+A V+S IAK  +PAG W  LL FL+QC QSP
Sbjct  76   HATARVISSIAKIEIPAGTWNHLLQFLYQCCQSP  109



>ref|XP_003326810.2| hypothetical protein PGTG_08347 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP82391.2| hypothetical protein PGTG_08347 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=1083

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 68/136 (50%), Gaps = 6/136 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQI--KRLAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
              Q L+  L Q   P      +A  Q   ++  + P  +P L   L T  TP VRQL+AV
Sbjct  5    FVQQLQSCLEQIATPSGTDGIKAATQALNEQFYRSPLAIPGLFEILTTCGTPAVRQLSAV  64

Query  234  LLRKKITG----HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK+++     HW KL   +R  +K  L++ +  E     R A A V+S +A+Y +P  
Sbjct  65   ELRKRVSAGKRKHWKKLESSMRDAIKARLLEIVVSEPVPITRHAIARVISEVAEYELPEK  124

Query  402  EWPDLLPFLFQCSQSP  449
             WP LL FL + + SP
Sbjct  125  AWPQLLGFLIKATDSP  140



>ref|XP_007008011.1| hypothetical protein TREMEDRAFT_41072 [Tremella mesenterica DSM 
1558]
 gb|EIW66019.1| hypothetical protein TREMEDRAFT_41072 [Tremella mesenterica DSM 
1558]
Length=1088

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q+L  LL   L+ D +  ++A  Q+  +  K    +PAL     T++   VRQLAAV LR
Sbjct  7    QNLHQLLEASLVTDTNVVKRATAQLNTQFYKKAHCIPALYEISATSQNQGVRQLAAVELR  66

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIA--KYAVPAGE  404
            K+I+      W K++P LR  +K+SL+  +T E ++ VR A A  VS IA  +  V   +
Sbjct  67   KRISAGDGKLWKKINPTLRNQIKESLLARLTQEPTSIVRHALARAVSAIADLELTVKPVQ  126

Query  405  WPDLLPFLFQCSQSP  449
            WP LLP L+Q +QSP
Sbjct  127  WPGLLPSLYQAAQSP  141



>ref|XP_007401510.1| hypothetical protein PHACADRAFT_178877 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50327.1| hypothetical protein PHACADRAFT_178877 [Phanerochaete carnosa 
HHB-10118-sp]
Length=1074

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 78/137 (57%), Gaps = 5/137 (4%)
 Frame = +3

Query  51   EEAMAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLA  227
            ++   Q+L  LL+Q   PD    + A  Q+ K   K+P  +PAL   + ++   +VRQLA
Sbjct  2    DQNFVQALHTLLVQSTSPDTIQLKAATSQLNKEFYKNPTCIPALATIIASSPEQSVRQLA  61

Query  228  AVLLRKKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVP  395
            AV LRK+I+ + G +  Q+    R+ +KQ + + I  E +  VR +SA VV+ IA   +P
Sbjct  62   AVELRKRISQNSGDMWLQVNAPEREQIKQKMPELILNEPNKLVRHSSARVVAAIASIEIP  121

Query  396  AGEWPDLLPFLFQCSQS  446
             G+W +L+PFL Q   S
Sbjct  122  LGQWTELMPFLEQTCTS  138



>ref|XP_007366711.1| ARM repeat-containing protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60572.1| ARM repeat-containing protein [Dichomitus squalens LYAD-421 SS1]
Length=1081

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 70/135 (52%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q+L  LLIQF   D    + A  Q+ K   K+PQ +PAL   + ++    VRQLAAV 
Sbjct  5    FVQNLHSLLIQFTSNDTVQLKAATAQLNKEFYKNPQCIPALASIMASSPEQAVRQLAAVE  64

Query  237  LRKKIT----GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK+        W ++    R+ +K  L + +  E +  VR + A V++ IA   +P G 
Sbjct  65   LRKRTIQASGDFWTQVDANSREEIKSKLPEIVLAESNNLVRHSIARVIAAIASVEIPLGH  124

Query  405  WPDLLPFLFQCSQSP  449
            WP LLPFL Q   SP
Sbjct  125  WPTLLPFLEQTCLSP  139



>gb|KII85896.1| hypothetical protein PLICRDRAFT_44321 [Plicaturopsis crispa FD-325 
SS-3]
Length=1084

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
              Q L  LL+Q    D    + A  Q+ +  K P  + AL   L ++    VRQL+AV L
Sbjct  5    FVQELHALLVQSTTNDTVQVKAATAQLNKYFKTPACISALASILASSPEQGVRQLSAVEL  64

Query  240  RKKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            RK+I  + G L  QL    R+ +K  L + I  E +  VR ++A VV  IA   +P G W
Sbjct  65   RKRIRQNSGDLWTQLPQDEREQIKAKLPELILAEPTNSVRHSAARVVGAIASIEIPLGNW  124

Query  408  PDLLPFLFQCSQSP  449
            P LLPFL Q + SP
Sbjct  125  PQLLPFLHQTATSP  138



>ref|XP_001732250.1| hypothetical protein MGL_0025 [Malassezia globosa CBS 7966]
 gb|EDP45036.1| hypothetical protein MGL_0025 [Malassezia globosa CBS 7966]
Length=1075

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q L  LL Q  +PD    + A + ++ R  KD + VPAL   + T+    VRQLAAV LR
Sbjct  9    QELHGLLQQANVPDTAVLKAATEALQSRYLKDGKAVPALFEIIATSSDLAVRQLAAVELR  68

Query  243  KKI---TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPD  413
            KK+   T  W K   ++R+ VK  L++ I  E +A +R A A +++ IA+  +P   WP 
Sbjct  69   KKLAKSTKVWTKHRVEIRESVKSKLLEMIAQEQNAAMRNALARLIAEIARKELPNHSWPA  128

Query  414  LLPFLFQCSQSP  449
            LLP+L++ + +P
Sbjct  129  LLPWLYESATAP  140



>ref|XP_003283123.1| hypothetical protein DICPUDRAFT_146718 [Dictyostelium purpureum]
 gb|EGC40372.1| hypothetical protein DICPUDRAFT_146718 [Dictyostelium purpureum]
Length=1083

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E  L   L P+N+  + A D++  + K  +    L H L+ +    ++QL+AV+LR+K+
Sbjct  12   IEECLKCLLQPNNEIIKMATDKLNGILKKSENSLYLYHLLQNSPFNEIKQLSAVILRQKL  71

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
               W K     R+ +K++++  +  + S  VRR+ + V+ IIA+    AG WPDL PFL 
Sbjct  72   VAQWIKFDIPSRKYIKETILQLVLSQPSQLVRRSISEVIIIIARIETAAGTWPDLFPFLI  131

Query  432  Q  434
            Q
Sbjct  132  Q  132



>ref|XP_003867998.1| karyopherin beta [Candida orthopsilosis Co 90-125]
 emb|CCG22563.1| karyopherin beta [Candida orthopsilosis]
Length=1108

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SLE  L Q L PD+   +QA  ++ K    +PQ +PAL+  L+ +    V+QLAAV  RK
Sbjct  8    SLEETLKQTLTPDSSVIKQASQRLSKEFYPNPQALPALLQILQQSNQDEVKQLAAVEARK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
             +  +WG +   L+  ++ SL+ S   E +  +R  SA +++ +A+  + A EW DLLP 
Sbjct  68   LVADNWGSVDTSLKSSIRDSLLKSTFNEQNKRLRNVSAYLIAALAETDLDANEWQDLLPT  127

Query  426  LFQCSQS  446
            L    Q 
Sbjct  128  LISAIQG  134



>gb|KDO29492.1| hypothetical protein SPRG_06032 [Saprolegnia parasitica CBS 223.65]
Length=1074

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q    +    ++AE  IK   K P  V  L+  ++ +    VRQLAA+LLR 
Sbjct  7    EQLEACLLQLTASNTATIKEAEAIIKAYLKTPSSVTGLVLQIQGSAHVAVRQLAAILLRL  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            K++ HW KL    +  +KQ+L+  I  E  + V+ A A +++ +A+  VP  EWPD    
Sbjct  67   KVSKHWAKLDDATQNGIKQTLLTRIMEESESVVKSAVARLIAQLARDLVPRNEWPD----  122

Query  426  LFQC  437
            LF C
Sbjct  123  LFAC  126



>ref|XP_002430332.1| Importin-4, putative [Pediculus humanus corporis]
 gb|EEB17594.1| Importin-4, putative [Pediculus humanus corporis]
Length=1081

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 2/121 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L + L+ +N    Q   +++   K+P+ +PAL + L T+  P +RQ AAV+LRK++
Sbjct  1    MEEILSKLLVSNNAVIIQGTKELREAFKNPEAIPALCNVLSTSNNPQIRQYAAVILRKRL  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            +   HW KL   ++  +KQ ++  +  E    V+ + A  + IIAK+   +  WP+LL  
Sbjct  61   SKQKHWNKLPLDVKTSIKQGILQILINEKDKSVKNSVAQFIGIIAKHEESSSSWPELLKL  120

Query  426  L  428
            +
Sbjct  121  V  121



>ref|XP_009037354.1| hypothetical protein AURANDRAFT_64547 [Aureococcus anophagefferens]
 gb|EGB07989.1| hypothetical protein AURANDRAFT_64547 [Aureococcus anophagefferens]
Length=1156

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            Q LE +L+    PD    +QAED +K + K    V AL+  + ++    VRQ+AAV+LRK
Sbjct  6    QQLEAVLVALTAPDTSRIKQAEDALKPVLKKSACVGALMTQVASSGNVAVRQIAAVILRK  65

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            KI   W KL    +  VK ++++ +  E    VR++ A + S +AK  VP  +WP+LL F
Sbjct  66   KIVKLWKKLKKSAQTRVKAAILERLGSEPERAVRKSVAALASALAKVLVPHNKWPELLAF  125

Query  426  LFQCSQS  446
            + QC+ +
Sbjct  126  ISQCATA  132



>gb|EPS73729.1| hypothetical protein M569_01025, partial [Genlisea aurea]
Length=953

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  333  SAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            S PVRRASANVVSIIAK+AVPAGEWPDLLPFLFQC QS
Sbjct  1    SPPVRRASANVVSIIAKFAVPAGEWPDLLPFLFQCIQS  38



>ref|XP_008609531.1| hypothetical protein SDRG_05586 [Saprolegnia diclina VS20]
 gb|EQC37369.1| hypothetical protein SDRG_05586 [Saprolegnia diclina VS20]
Length=1075

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            + LE  L+Q    +    ++AE  IK   K P  V  L+  ++ +    VRQLAA+LLR 
Sbjct  7    ERLEACLLQLTASNTATIKEAEAIIKAYLKTPGSVTGLVLQIQGSAHVAVRQLAAILLRL  66

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            K++ HW KL    +  +KQ+L+  I  E  + V+ A A +++ +A+  VP  EWPD    
Sbjct  67   KVSKHWAKLDDATQNGIKQTLLTRIMEESESVVKSAVARLIAQLARDLVPRNEWPD----  122

Query  426  LFQC  437
            LF C
Sbjct  123  LFAC  126



>ref|XP_007340470.1| ARM repeat-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD51758.1| ARM repeat-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=1089

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 5/132 (4%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q+L  LL Q   PD +A + A   + K   K+PQ +PAL   + T+    VRQLAAV LR
Sbjct  7    QNLHGLLQQATAPDTNAIKAATATLNKEYYKNPQCIPALFEIIATSPNEAVRQLAAVELR  66

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K+I       W  L  ++R  +K+  +  +  E  + VR ++A  VS IA + +P  +WP
Sbjct  67   KRINAEDNKLWIALPQEIRNAIKEKSLQVVLNESKSLVRHSTARAVSAIANFELPLSQWP  126

Query  411  DLLPFLFQCSQS  446
            +LL FL     S
Sbjct  127  ELLAFLEHSCNS  138



>gb|EFA01438.1| hypothetical protein TcasGA2_TC030696 [Tribolium castaneum]
Length=1075

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 69/126 (55%), Gaps = 3/126 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L + L+ ++   +Q   ++K   K P+ +PAL   + ++  P +RQ AAVLLR+K+
Sbjct  1    MEEILSKLLVANSKVIQQGTKELKEAFKKPEAIPALCEVIVSSSNPQIRQSAAVLLRRKL  60

Query  252  TG--HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                 W KL  + R  +KQ ++ ++  E    V+ A A  + I+ K+  P   WP++L F
Sbjct  61   GKKRQWNKLDAETRSRIKQGMLQALVNEQEKLVKNAIAQFIGILGKHEFPENTWPEVLQF  120

Query  426  LFQ-CS  440
            +   CS
Sbjct  121  IHTLCS  126



>ref|XP_001812612.1| PREDICTED: importin-4-like [Tribolium castaneum]
Length=1087

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 67/121 (55%), Gaps = 2/121 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L + L+ ++   +Q   ++K   K P+ +PAL   + ++  P +RQ AAVLLR+K+
Sbjct  1    MEEILSKLLVANSKVIQQGTKELKEAFKKPEAIPALCEVIVSSSNPQIRQSAAVLLRRKL  60

Query  252  TG--HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                 W KL  + R  +KQ ++ ++  E    V+ A A  + I+ K+  P   WP++L F
Sbjct  61   GKKRQWNKLDAETRSRIKQGMLQALVNEQEKLVKNAIAQFIGILGKHEFPENTWPEVLQF  120

Query  426  L  428
            +
Sbjct  121  I  121



>ref|XP_007327210.1| hypothetical protein AGABI1DRAFT_54916 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81851.1| hypothetical protein AGABI1DRAFT_54916 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=1061

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 70/132 (53%), Gaps = 5/132 (4%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q L  LL+Q    D D  + A  Q+ R   K+P  +PAL   L T+    VRQLAAV LR
Sbjct  2    QLLHNLLLQSTSNDTDQLKAATAQLNRDFYKNPGCIPALAAILATSPQQAVRQLAAVELR  61

Query  243  KKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K+I+   G L   L    R  +K  L + + +E +  VR ++A V++ IA   +P G W 
Sbjct  62   KRISQKSGTLWSSLDRVQRDEIKAKLPELVVIETNNLVRHSAARVIAAIAGIEIPEGTWS  121

Query  411  DLLPFLFQCSQS  446
            DLLPFL Q   S
Sbjct  122  DLLPFLHQSCTS  133



>ref|XP_003967995.1| PREDICTED: importin-4-like [Takifugu rubripes]
Length=1087

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            MA+ LE +L Q   PDN   +QA  Q+K+  KDP +V AL   +  +  P +RQ A+V+L
Sbjct  1    MAEDLEHILSQLSQPDNAVIQQATAQLKQAFKDPAIVLALCTVVIGSTNPEIRQSASVML  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++  HW K++P  ++ +K  ++ +   E    V+ + + + ++I K+  P   WP L+
Sbjct  61   RLRVKNHWKKMNPNDKESLKGVVLQAFMQESEHFVQHSLSQLCAVIVKHETPDC-WPALM  119

Query  420  PFLFQCSQS  446
             FL   ++S
Sbjct  120  QFLTGSTKS  128



>emb|CCU98606.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=1069

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            A  Q L  +L Q  +PD  A + A + ++ R  KD + VPAL   L ++    VRQLA+V
Sbjct  4    AYVQELHGILQQANVPDTAAVKAATEALQSRYLKDSKAVPALFEILASSSDLAVRQLASV  63

Query  234  LLRKKITGH---WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
             LRKK++     W K   ++R  +K   ++ I+ E S  +R A A V++ IA+  +P   
Sbjct  64   ELRKKLSKSNKVWTKQPVEIRDGIKTKFLEIISAEPSHLLRNAMARVIAEIARKELPMQS  123

Query  405  WPDLLPFLFQCSQSP  449
            WP LLP+LF  ++SP
Sbjct  124  WPALLPWLFTSAESP  138



>ref|XP_006461983.1| hypothetical protein AGABI2DRAFT_206092 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV46659.1| hypothetical protein AGABI2DRAFT_206092 [Agaricus bisporus var. 
bisporus H97]
Length=1061

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 70/132 (53%), Gaps = 5/132 (4%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q L  LL+Q    D D  + A  Q+ R   K+P  +PAL   L T+    VRQLAAV LR
Sbjct  2    QLLHNLLLQSTSNDTDQLKAATAQLNRDFYKNPGCIPALAAILATSPQQAVRQLAAVELR  61

Query  243  KKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K+I+   G L   L    R  +K  L + + +E +  VR ++A V++ IA   +P G W 
Sbjct  62   KRISQKSGTLWSSLDRVQRDEIKAKLPELVVIETNNLVRHSAARVIAAIAGIEIPEGTWS  121

Query  411  DLLPFLFQCSQS  446
            DLLPFL Q   S
Sbjct  122  DLLPFLHQSCTS  133



>ref|XP_005777741.1| hypothetical protein EMIHUDRAFT_469192 [Emiliania huxleyi CCMP1516]
 gb|EOD25312.1| hypothetical protein EMIHUDRAFT_469192 [Emiliania huxleyi CCMP1516]
Length=942

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            LE LL Q +  D +  RQAE+ +      P  +  L+  L  ++  +VRQLAAVLLR++I
Sbjct  17   LESLLSQMVQGDPEQIRQAEEALTPALSTPAFMLDLLTRLTQSQAAHVRQLAAVLLRRRI  76

Query  252  TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLF  431
              HW KL       +K +L+  +  E    V R+ A + +  A++A+  G WP+LL  + 
Sbjct  77   GSHWRKLGAANTNRIKATLLQVLATEPEGAVVRSVAALCASAARHAMSKGGWPELLSCVL  136

Query  432  QCSQSP  449
            + S+SP
Sbjct  137  EGSRSP  142



>ref|XP_003484719.1| PREDICTED: importin-4-like [Bombus impatiens]
Length=1080

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L++ L+ DN + +Q   +++   K P+  PAL   + ++    VRQ AA+LLRK+ 
Sbjct  1    MEEILLKLLVADNTSIQQGTAELREAFKKPESTPALCQLIVSSTNSQVRQYAAILLRKRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                HW KL   +R   K  ++ ++  E    V+ A A ++  I K+ +P  EWP++L F
Sbjct  61   AKGKHWLKLPQHIRNEFKTVILQALVNEPEKMVKNAIAQLIGTIVKHELPNNEWPEVLQF  120

Query  426  LFQ  434
            + Q
Sbjct  121  VQQ  123



>ref|XP_011066781.1| PREDICTED: importin-4-like isoform X1 [Acromyrmex echinatior]
 gb|EGI57688.1| Importin-4 [Acromyrmex echinatior]
Length=1082

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 73/123 (59%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E LL+  L  D+   ++A  ++K++ ++P  VPAL   + T+  P VRQ A ++LR++ 
Sbjct  1    MERLLLNLLASDSATIQEATKELKKVLQNPDSVPALCQLVVTSSNPEVRQYATLILRRRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            T   +W KLS  +R   K+ ++ ++  E +  VR + A ++ +I K+ +P   WP+++ +
Sbjct  61   TKGKYWTKLSIPVRTEFKKIILQALEHESANLVRNSIAQLIGVIVKHELPTNSWPEIIHY  120

Query  426  LFQ  434
            + Q
Sbjct  121  VQQ  123



>ref|XP_002160486.2| PREDICTED: importin-4-like [Hydra vulgaris]
Length=523

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (54%), Gaps = 1/126 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE +L + L+PDN   +QA  ++K    K   V+PAL+  L+    P +RQ  ++LLR++
Sbjct  6    LEKILRKLLVPDNHIIQQATIELKTAFIKTDVVLPALVELLQNCTEPTIRQYCSILLRRR  65

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            I   W  ++ + +  +K  L+  +T E    V  +   VV  IA++      WP+LL F+
Sbjct  66   IVKQWNSVNTETKTSLKSLLLTCVTRETIPFVLGSICQVVGSIARHDFANNAWPELLQFI  125

Query  429  FQCSQS  446
             QC QS
Sbjct  126  SQCIQS  131



>ref|XP_003396611.1| PREDICTED: importin-4-like [Bombus terrestris]
Length=1082

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L++ L+ DN + +Q   +++   K P+ +PAL   + ++    +RQ AA+LLRK+ 
Sbjct  1    MEEILLKLLVADNTSIQQGTTELREAFKKPESIPALCQLIVSSTNSQIRQYAAILLRKRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                HW KL   +R   K  ++ ++  E    V+ A A ++ II K+ +P   WP++L F
Sbjct  61   AKGKHWLKLPQHIRNEFKTVILQALVNEPEKMVKNAIAQLIGIIVKHELPNNGWPEVLQF  120

Query  426  LFQ  434
            + Q
Sbjct  121  VQQ  123



>ref|XP_008305734.1| PREDICTED: importin-4 [Cynoglossus semilaevis]
Length=1082

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            M + LE  L+Q   PDN   +QA +Q+K+  K P ++PAL   +  ++   +RQ AAV+L
Sbjct  1    MTEELERFLLQLTEPDNAVIQQATEQLKQAFKQPAIIPALCAVMTGSQNQQIRQSAAVIL  60

Query  240  RKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLL  419
            R ++   W K+ P  R+ +K  ++ +   E    V+ + + + +++ K+  P   WP LL
Sbjct  61   RMRVKKQWSKIMPNDRESLKAVVLQAFVQETEHTVQHSLSQLCAMLVKHETPE-RWPALL  119

Query  420  PFLFQCSQS  446
             FL   ++S
Sbjct  120  QFLNDATKS  128



>ref|XP_004199626.1| Piso0_002165 [Millerozyma farinosa CBS 7064]
 emb|CCE81507.1| Piso0_002165 [Millerozyma farinosa CBS 7064]
Length=1102

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 75/132 (57%), Gaps = 1/132 (1%)
 Frame = +3

Query  51   EEAMAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLA  227
            ++    SLE  L   L+PD+   +QA +++ K    +   +P+L H L+ A+   ++QLA
Sbjct  2    DQQFTSSLEETLKHTLVPDSAVVKQASNKLQKEFYINDLALPSLFHILQNAQDDQMKQLA  61

Query  228  AVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            AV  RK +   W K+   L+  ++++++++   + S  +R +SA VV+ I +  +  GEW
Sbjct  62   AVEARKLVMSKWEKVDGSLKPHIREAMLNNTFSQGSKLIRHSSARVVAAIGEIDLENGEW  121

Query  408  PDLLPFLFQCSQ  443
            PDLLP L +  Q
Sbjct  122  PDLLPVLVKSIQ  133



>ref|XP_009549591.1| hypothetical protein HETIRDRAFT_478785 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79355.1| hypothetical protein HETIRDRAFT_478785 [Heterobasidion irregulare 
TC 32-1]
Length=1083

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q L  LL+Q    D    + A  Q+ K   K+P  +PAL   + ++    VRQL AV 
Sbjct  5    FVQGLHNLLLQSTANDTVQLKAATSQLNKEFYKNPACIPALASIIASSPEVPVRQLGAVE  64

Query  237  LRKKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            +RK++T + G L  Q+    R+ +K  L + I  E +  VR ++A V++ IA   +P G 
Sbjct  65   MRKRVTQNSGDLWTQVPQADREQIKSKLPELIVAEPNKLVRHSTARVIAAIASVEIPLGT  124

Query  405  WPDLLPFLFQCSQSP  449
            WP LLPFL Q + SP
Sbjct  125  WPQLLPFLHQTAVSP  139



>gb|EMT12518.1| Importin-4 [Aegilops tauschii]
Length=921

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  342  VRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQSP  449
            VRRASANVVSIIAKYAVPAGEW +LLPFLFQCSQSP
Sbjct  33   VRRASANVVSIIAKYAVPAGEWQELLPFLFQCSQSP  68



>ref|XP_007874054.1| hypothetical protein PNEG_02074 [Pneumocystis murina B123]
 gb|EMR09486.1| hypothetical protein PNEG_02074 [Pneumocystis murina B123]
Length=1065

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +3

Query  174  ALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRA  353
             L+H +++++ P +RQL+A+  RK I   W  LS  L+  +K+SL+ SI +E  + VR +
Sbjct  44   GLLHIMQSSENPQIRQLSAIEARKLIAIFWEDLSKSLKCQIKKSLLQSIVLEPVSIVRHS  103

Query  354  SANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            SA V+S IAK  +P  EW DL  F+ Q S S
Sbjct  104  SARVISSIAKIDLPVEEWKDLPIFIHQASLS  134



>ref|XP_002289991.1| ran binding protein 4-like protein [Thalassiosira pseudonana 
CCMP1335]
 gb|EED93528.1| ran binding protein 4-like protein, partial [Thalassiosira pseudonana 
CCMP1335]
Length=1009

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 10/129 (8%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPN--VRQLAAVLLRK  245
            L  LL     PD +A RQAE  +K L KD + VPAL+  ++     N  +R +A ++LRK
Sbjct  1    LSTLLAALTHPDTNAIRQAEVALKPLLKDARCVPALVEIVKAQGNQNDAIRHVAVIILRK  60

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKY--------AVPAG  401
            +I+GH  K     +  +K  L+  ++ E S PVR     +V+ I K         A   G
Sbjct  61   RISGHLTKFDTATKSALKAELLSILSSETSRPVRNGVVALVATICKLEAEGNQDGAATGG  120

Query  402  EWPDLLPFL  428
             WP+L  F+
Sbjct  121  GWPELFLFI  129



>ref|XP_004198776.1| Piso0_002165 [Millerozyma farinosa CBS 7064]
 emb|CCE82439.1| Piso0_002165 [Millerozyma farinosa CBS 7064]
Length=1102

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 74/132 (56%), Gaps = 1/132 (1%)
 Frame = +3

Query  51   EEAMAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLA  227
            ++    SLE  L   L+PD+   +QA  ++ K    +   +P+L H L+ A+   ++QLA
Sbjct  2    DQQFTSSLEETLKHTLVPDSAVVKQASTKLQKEFYINDLALPSLFHILQNAQDDQMKQLA  61

Query  228  AVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            AV  RK +   W K+   L+  ++++++++   + S  +R +SA VV+ I +  +  GEW
Sbjct  62   AVEARKLVMSKWEKVDSSLKPHIREAMLNNTFSQGSKLIRHSSARVVAAIGEIDLENGEW  121

Query  408  PDLLPFLFQCSQ  443
            PDLLP L +  Q
Sbjct  122  PDLLPVLVKSIQ  133



>ref|XP_454889.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG99976.1| KLLA0E20769p [Kluyveromyces lactis]
Length=1113

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +PALIH L+ +    ++QLA V  RK+++ HWG L    +  VKQSL++S   E    VR
Sbjct  41   LPALIHILQNSSNDGIKQLAGVEARKQVSKHWGSLDAATQTSVKQSLLNSAFNEGKDAVR  100

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQ--CSQSP  449
             A+A V++ I    +   +WP+L+P L Q  C  +P
Sbjct  101  HANARVIASIGSEELDEKKWPELIPNLLQAACDSNP  136



>gb|KIM27775.1| hypothetical protein M408DRAFT_329735 [Serendipita vermifera 
MAFF 305830]
Length=1070

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            + Q L  LL +  +PD    ++A  Q++++  + + VPAL      A   N+RQLAAV L
Sbjct  5    LFQHLYGLLQKSTVPDTATVKEATAQLQQIFANAECVPALFELAVKAPEVNIRQLAAVEL  64

Query  240  RKKI----TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            RK++    T  W K++   R  +K  L++ +  E  + VR + A V+S IA   +  G W
Sbjct  65   RKQVNNEETSPWVKVNEASRATIKSGLLERLLHETESIVRHSLARVISAIASVELSTGTW  124

Query  408  PDLLPFLFQCSQSP  449
            P+LLPF+     +P
Sbjct  125  PELLPFIQNLCNAP  138



>dbj|BAO42691.1| importin subunit beta-4 [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP74062.1| importin subunit beta-4 [Kluyveromyces marxianus]
Length=1113

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +PALIH L+ +    ++QLA V  RK++  HWG L    +  +KQSL++S   E    +R
Sbjct  41   LPALIHILQNSTNDGIKQLAGVEARKQVAKHWGSLDAATQSSIKQSLLNSAFSEEKDAIR  100

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQ--CSQSP  449
             A+A V++ I    +   +WP+L+P L Q  C  +P
Sbjct  101  HANARVIASIGSEELDEKKWPELIPNLLQAACDSNP  136



>emb|CDO68179.1| hypothetical protein BN946_scf184938.g31 [Trametes cinnabarina]
Length=1084

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 70/135 (52%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q+L  LL+Q    D    + A  Q+ R   K+P  +PAL   +  +    VRQLAAV 
Sbjct  5    FVQNLHALLVQSTSNDTVQLKAATAQLNREFYKNPLCIPALTQIIAESPEQAVRQLAAVE  64

Query  237  LRKKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK+I    G L  QL    R+ +K  L + +  E S  VR ++A V++ IA   +P G 
Sbjct  65   LRKRIAQKDGDLWLQLETGQREQIKAKLPELVLSESSNLVRHSTARVIAAIASIEMPLGT  124

Query  405  WPDLLPFLFQCSQSP  449
            WP LLPFL Q   SP
Sbjct  125  WPQLLPFLEQTCLSP  139



>ref|XP_011329441.1| PREDICTED: importin-4-like isoform X2 [Cerapachys biroi]
Length=1069

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E  L+  L+ DN   ++A   +K+L KDP+ +  L   + +++   VRQ AAVLLR++ 
Sbjct  1    MEAALVNLLVSDNATIQEATVALKKLLKDPESIKTLCEIIVSSQNAEVRQYAAVLLRRRY  60

Query  252  TG--HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                +W KL   +R   K+ ++ ++  E    V+ + A ++ II KY +P   WP+++ F
Sbjct  61   CKDVNWKKLPESIRTDFKKVILQALVNEKEKFVKNSIAQLIGIIIKYELPTNNWPEIIDF  120

Query  426  LFQ  434
            + Q
Sbjct  121  VQQ  123



>ref|XP_011329440.1| PREDICTED: importin-4-like isoform X1 [Cerapachys biroi]
 gb|EZA60060.1| Importin-4 [Cerapachys biroi]
Length=1078

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E  L+  L+ DN   ++A   +K+L KDP+ +  L   + +++   VRQ AAVLLR++ 
Sbjct  1    MEAALVNLLVSDNATIQEATVALKKLLKDPESIKTLCEIIVSSQNAEVRQYAAVLLRRRY  60

Query  252  TG--HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                +W KL   +R   K+ ++ ++  E    V+ + A ++ II KY +P   WP+++ F
Sbjct  61   CKDVNWKKLPESIRTDFKKVILQALVNEKEKFVKNSIAQLIGIIIKYELPTNNWPEIIDF  120

Query  426  LFQ  434
            + Q
Sbjct  121  VQQ  123



>emb|CCG82267.1| Karyopherin Kap123 [Taphrina deformans PYCC 5710]
Length=1077

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            + LE LL +   PD+     A   +K     +P  +P+LI  ++ +++  +RQLAAV  R
Sbjct  2    EQLEGLLNEIAQPDSQRIAAATKALKETYYNNPACLPSLIQVMQQSQSVQIRQLAAVEAR  61

Query  243  KKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
            K+ T HW  L    R  ++ SL+ S   E    VR ASA V++ IA+  +P G+W DL  
Sbjct  62   KQATAHWASLDETTRLNIRNSLLQSTLSEQQKLVRHASARVIANIARIDLPDGKWQDLPN  121

Query  423  FLFQCSQS  446
            FL Q + S
Sbjct  122  FLVQAATS  129



>gb|AAT44183.1| hypothetical protein [Oryza sativa Japonica Group]
Length=296

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +3

Query  3    AAGFYTLTKRSRRRV*EEAMAQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALI  182
             AG     + +RRR      AQSL+LLLIQFLMPDNDA RQAE+Q +RLA DPQ+VP L+
Sbjct  82   GAGGVGDGETARRR---GGTAQSLDLLLIQFLMPDNDACRQAEEQTRRLAWDPQLVPVLV  138



>emb|CDS14373.1| hypothetical protein LRAMOSA06542 [Absidia idahoensis var. thermophila]
Length=1047

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = +3

Query  159  PQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSA  338
            PQ VPAL+  L ++    VRQLAAV LRK+++  W KL    R  ++  L+  +  E   
Sbjct  37   PQCVPALVQILSSSPRDEVRQLAAVELRKRVSKWWLKLDESTRAPLRSQLLQVVLSEQHQ  96

Query  339  PVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
              R A +  +S IA+  +P   WP+LL FL Q + S
Sbjct  97   LTRHAISRAISSIARIDIPENRWPELLSFLHQATSS  132



>ref|XP_007865435.1| ARM repeat-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ56762.1| ARM repeat-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=1084

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  Q+L  LL+Q    D    + A  Q+ ++  K+P  +PAL   + ++    VRQLA V
Sbjct  4    SFVQNLHDLLVQSTANDTVQLKAATAQLNQQYYKNPACIPALASIIASSPQEAVRQLAGV  63

Query  234  LLRKKITGHWGKL---SPQ-LRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             +RK++  + G L    PQ  R  +KQ L D    E S  VR ++A VV+ IA   VP G
Sbjct  64   EMRKRVLNNSGSLWIEVPQDQRDQIKQQLPDLTLSESSKIVRHSTARVVAAIATIEVPLG  123

Query  402  EWPDLLPFLFQCSQS  446
             WP LLPFL Q + S
Sbjct  124  TWPQLLPFLHQTATS  138



>ref|XP_001978848.1| GG12549 [Drosophila erecta]
 gb|EDV47806.1| GG12549 [Drosophila erecta]
Length=1105

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 7/133 (5%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
             + LL+  L  DND R+QAED    LA++ +V   L +     ++   RQ+AAVLLR+  
Sbjct  8    FQQLLVSLLSTDNDVRQQAEDAYNNLARELKVTHLLSNIQNGQQSEEARQMAAVLLRRLF  67

Query  252  TGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA---GEWP  410
            T      +  + P+ +  + Q ++ ++  E +  +RR    VV+ +A+  +       WP
Sbjct  68   TTEFMEFYKGIQPESQNQLLQQILMAVRQEVTPQLRRKICEVVAEVARNLIDEDCNNLWP  127

Query  411  DLLPFLFQCSQSP  449
            D+L FLFQC+ SP
Sbjct  128  DILQFLFQCANSP  140



>emb|CDO95036.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=1113

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +3

Query  159  PQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSA  338
            P  +PALIH L+ +    ++QLA +  RK++  HW  L    +  +KQSL++S   E   
Sbjct  38   PAALPALIHILQNSSNDGIKQLAGIESRKQVNKHWSALDAATQSSIKQSLLNSAFSEEKD  97

Query  339  PVRRASANVVSIIAKYAVPAGEWPDLLPFLFQ--CSQSP  449
             +R A+A V++ I        +WP+L+P L Q  C  +P
Sbjct  98   AIRHANARVIASIGSEEFEENKWPELIPNLLQAACDSNP  136



>ref|XP_007098087.1| PREDICTED: LOW QUALITY PROTEIN: importin-4 [Panthera tigris altaica]
Length=1102

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 73/128 (57%), Gaps = 3/128 (2%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            SLE +L + L+PD +  R+A +Q++ + +DP  +PAL   L +A  P +RQ AAVL R++
Sbjct  29   SLEQILRELLLPDTERIRRATEQLQTVLRDPAALPALCDLLASAADPQIRQFAAVLTRRR  88

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANV-VSIIAKYAVPAGEWPDLLPF  425
            ++ HW +L+ + R+ +K  ++ +   E    V  + A +  +I  K  + A  WP L+  
Sbjct  89   LSTHWRRLTAEHRESLKSLVLSAFQRETQHSVSLSLAQLSATIFRKEGLEA--WPQLMQL  146

Query  426  LFQCSQSP  449
            L   + SP
Sbjct  147  LQHSTHSP  154



>ref|XP_002839159.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83350.1| unnamed protein product [Tuber melanosporum]
Length=842

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 16/134 (12%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITG  257
            LL   L PD +  + A   ++R     P+ +  L+H LRT     +RQLAAV  R  +  
Sbjct  9    LLEHVLTPDTNIVKHATGTLRRDYYSKPESLSTLLHLLRTHPNAQIRQLAAVEARNLVPK  68

Query  258  HW-----------GKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
             W            +L PQLR+ + QS I+    E ++ V+ +SA V+S +AK  +PAGE
Sbjct  69   FWVARGNDLSHIPAELKPQLRESILQSTIE----ETNSLVKHSSARVISSMAKIDLPAGE  124

Query  405  WPDLLPFLFQCSQS  446
            W DL  FL Q + S
Sbjct  125  WTDLPGFLVQAASS  138



>ref|XP_001120827.3| PREDICTED: importin-5-like [Apis mellifera]
Length=1109

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK----K  248
            LL   L  DNDAR QAED    L  D +V   L        T  +R +AAVLLR+    +
Sbjct  23   LLNTLLSTDNDARTQAEDAYNNLPVDSKVTFLLTSLCNATLTEEMRAMAAVLLRRLFSSE  82

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA---GEWPDLL  419
                + K+ P+ +  +K+ ++ S+  E +  +RR    V + +A+  +      +WP+ L
Sbjct  83   FMDFYPKIPPEAQAQLKEQILLSVQNEQTETIRRKVCEVAAEVARNLIDEDGNNQWPEFL  142

Query  420  PFLFQCSQSP  449
             FLFQC+ SP
Sbjct  143  QFLFQCANSP  152



>ref|XP_006622037.1| PREDICTED: importin-5-like [Apis dorsata]
Length=1109

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK----K  248
            LL   L  DNDAR QAED    L  D +V   L        T  +R +AAVLLR+    +
Sbjct  23   LLNTLLSTDNDARTQAEDAYNNLPVDSKVTFLLTSLCNATLTEEMRAMAAVLLRRLFSSE  82

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA---GEWPDLL  419
                + K+ P+ +  +K+ ++ S+  E +  +RR    V + +A+  +      +WP+ L
Sbjct  83   FMDFYPKIPPEAQAQLKEQILLSVQNEQTETIRRKVCEVAAEVARNLIDEDGNNQWPEFL  142

Query  420  PFLFQCSQSP  449
             FLFQC+ SP
Sbjct  143  QFLFQCANSP  152



>ref|XP_003696532.1| PREDICTED: importin-5 [Apis florea]
Length=1109

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK----K  248
            LL   L  DNDAR QAED    L  D +V   L        T  +R +AAVLLR+    +
Sbjct  23   LLNTLLSTDNDARTQAEDAYNNLPVDSKVTFLLTSLCNATLTEEMRAMAAVLLRRLFSSE  82

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA---GEWPDLL  419
                + K+ P+ +  +K+ ++ S+  E +  +RR    V + +A+  +      +WP+ L
Sbjct  83   FMDFYPKIPPEAQAQLKEQILLSVQNEQTETIRRKVCEVAAEVARNLIDEDGNNQWPEFL  142

Query  420  PFLFQCSQSP  449
             FLFQC+ SP
Sbjct  143  QFLFQCANSP  152



>gb|EIF46213.1| ran binding protein [Brettanomyces bruxellensis AWRI1499]
Length=1108

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            + LE  L   L PD+ A ++A +Q+K+    +   +PALIH L+ +    ++QLAAV  +
Sbjct  8    EQLEQTLSVILSPDSKAIKZATEQLKKQFYPNTGALPALIHILQNSGNDGIKQLAAVEAK  67

Query  243  KKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
            K I+  W K  P L+Q ++ SL+       S  +R ++A +V+ IA   +P   W  LLP
Sbjct  68   KLISKQWEKQDPSLQQQIRDSLLQFAFTYPSKNIRHSTARIVAAIADIDLPEKHWDGLLP  127

Query  423  FLFQCSQS  446
             L   +Q 
Sbjct  128  ALVSGAQB  135



>emb|CCJ29687.1| unnamed protein product, partial [Pneumocystis jirovecii]
Length=1014

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +3

Query  189  LRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVV  368
            +++++   +RQLAA+  RK I   W KL   L+  +K+SL+ SI  E  + VR +SA V+
Sbjct  1    MQSSENSQIRQLAAIEARKLIPSFWNKLDDPLKPEIKKSLLQSIVSEPVSIVRHSSARVI  60

Query  369  SIIAKYAVPAGEWPDLLPFLFQCSQS  446
            S IAK  +P  EW DL  F++Q S S
Sbjct  61   SSIAKIDLPTEEWQDLPAFIYQASTS  86



>gb|EJK49994.1| hypothetical protein THAOC_31080 [Thalassiosira oceanica]
Length=1075

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 10/136 (7%)
 Frame = +3

Query  63   AQSLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHL--RTAKTPNVRQLAAVL  236
            A  +   L     PD +  RQAE  +K + K+PQ VPA++  +  R ++  +VR +  ++
Sbjct  7    AAQMATYLSALTQPDTNIIRQAEAALKPILKNPQCVPAMVEVIKARDSQGESVRHVTVIV  66

Query  237  LRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAK--------YAV  392
            LRK+I GH GK     R  +K  L+  +T E S PVR     +V+ I K         A 
Sbjct  67   LRKRIGGHLGKFDGAARNALKAELLGILTAEASRPVRLGVVALVAAICKAEADADSDGAA  126

Query  393  PAGEWPDLLPFLFQCS  440
                WP+L  F+ Q +
Sbjct  127  AGAGWPELFQFIAQAA  142



>emb|CCK69452.1| hypothetical protein KNAG_0C03450 [Kazachstania naganishii CBS 
8797]
Length=1115

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 1/126 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE  L   + P++   + A   ++    K+PQ V ALIH L+ +    ++QLA V  RK 
Sbjct  9    LEQTLSAIVQPNSAGLKDATKTLQNHFYKEPQTVSALIHILQNSSDDALKQLAGVEARKL  68

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            I   W  L  Q +  +K SL+ +   E    +R A+A V++ IA   + + EWPDL+P L
Sbjct  69   IPKCWKALDVQTKASIKTSLLQTAFTESKEIIRHANARVIAAIAAEELESNEWPDLIPSL  128

Query  429  FQCSQS  446
             Q + S
Sbjct  129  MQAAAS  134



>ref|XP_011273450.1| Ran-binding protein 6 [Wickerhamomyces ciferrii]
 emb|CCH44727.1| Ran-binding protein 6 [Wickerhamomyces ciferrii]
Length=1111

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SL+  L Q  +PD+ A + A  ++      +P  +PA+I+ L+      +RQLAAV  RK
Sbjct  8    SLQETLTQVTLPDSAAIKAATAKLSNEFYPNPASLPAIIYILQNNPNDQIRQLAAVESRK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
             +  HW  +   ++  +K+S++ S   E S  +R ++A VV+ IA+Y      W  LLP 
Sbjct  68   LVNKHWETVDQSIKNEIKESILTSTFKEQSKLIRHSAARVVAAIAEYEFSTNTWESLLPL  127

Query  426  L  428
            L
Sbjct  128  L  128



>emb|CCE40704.1| hypothetical protein CPAR2_107390 [Candida parapsilosis]
Length=1108

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SLE  L Q L PD+   +QA  ++ K    + Q +PAL+   + +    V+QLAAV  RK
Sbjct  8    SLEETLKQTLTPDSSVIKQASQRLTKEFYPNSQALPALLQIFQQSNQDEVKQLAAVEARK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                +W  +   L+  +++SL+ S   E +  +R  SA +++ +A+  + A EW DLLP 
Sbjct  68   LAADNWESVDASLKPSIRESLLKSTFSEQNKRLRNVSAYLIASLAELDLDANEWQDLLPT  127

Query  426  LFQCSQ  443
            L    Q
Sbjct  128  LVNAIQ  133



>ref|XP_007304122.1| ARM repeat-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM86396.1| ARM repeat-containing protein [Stereum hirsutum FP-91666 SS1]
Length=1084

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   AMAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAV  233
            +  + L  LL+Q    D    + A   + R   K+P V+PAL   + ++    VRQLAAV
Sbjct  4    SFVEGLHNLLLQSTANDTVQLKAATATLNRDFNKNPAVIPALAQLIASSPEVPVRQLAAV  63

Query  234  LLRKKITGHWGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAG  401
             LRK++  + G L  Q+    R+ +K  + + I  E +  VR ++A VV+ IA   +P G
Sbjct  64   ELRKRVAQNSGDLWLQVAQNDREQIKARMPEFILTEQNKLVRNSAARVVASIAGIEIPHG  123

Query  402  EWPDLLPFLFQCSQSP  449
             WP LLP+L Q   SP
Sbjct  124  TWPQLLPYLHQTCVSP  139



>ref|XP_002550511.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER32026.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=1108

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQ-IKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SLE  L Q L+PD+   +QA ++ +K    +P  +PAL+   +T     ++QLA V  RK
Sbjct  8    SLEETLKQSLVPDSAVIKQASNKLVKEFYPNPATLPALLQIYQTTAQDELKQLALVEARK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                 W  +   L+  +++SL+ +   E +  +R  SA +++ IA   +   EW DLLP 
Sbjct  68   LSLDKWKDVDASLKPTIRESLLKATFAEQNKRLRNLSAYLIAAIADTDLENQEWQDLLPT  127

Query  426  LFQCSQS  446
            LF   QS
Sbjct  128  LFTAVQS  134



>emb|CCC86696.1| karyopherin beta, partial [Millerozyma farinosa]
Length=152

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +P+L H L+ A+   ++QLAAV  RK +   W K+   L+  ++++++++   + S  +R
Sbjct  6    LPSLFHILQNAQDDQMKQLAAVEARKLVMSKWEKVDSSLKPHIREAMLNNTFSQGSKLIR  65

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQ  443
             +SA VV+ I +  +  GEWPDLLP L +  Q
Sbjct  66   HSSARVVAAIGEIDLENGEWPDLLPVLVKSVQ  97



>gb|EMD38718.1| hypothetical protein CERSUDRAFT_112448 [Ceriporiopsis subvermispora 
B]
Length=1082

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 71/135 (53%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q L  LL Q    D    + A  Q+ R   K+P  +PAL   + ++    +RQLAAV 
Sbjct  5    FVQGLHNLLAQSTSNDTVQLKAATAQLNREFYKNPLCIPALTSIIASSPDQAIRQLAAVE  64

Query  237  LRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK+I+   G+L    S   RQ ++  L + +  + S  VR ++A V++ IA   +P  +
Sbjct  65   LRKRISQGSGELWITVSSDQRQEIRSKLPELVLNDPSNLVRHSTARVIAAIASIEIPLNQ  124

Query  405  WPDLLPFLFQCSQSP  449
            W +LLPFL Q  QSP
Sbjct  125  WSELLPFLLQTCQSP  139



>ref|XP_011501436.1| PREDICTED: importin-4-like [Ceratosolen solmsi marchali]
Length=1086

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 65/123 (53%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +++  L+ D     QA  Q+K   K+PQ    L   +  +KT  VRQ AA+LLRK+ 
Sbjct  1    MEEIILNLLVTDTAVIHQATAQLKEAFKNPQSTQLLYQLIVNSKTVQVRQYAALLLRKRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                 W +LS ++R   K  L+ ++  E    V+ A A ++ +I K+ +P   WP+ L +
Sbjct  61   NKIKCWSQLSQEIRSEFKAVLLQALVQETEKSVKNAIAQLIGVIIKHELPQNGWPECLQY  120

Query  426  LFQ  434
            + Q
Sbjct  121  IRQ  123



>emb|CBN80552.1| karyopherin beta [Millerozyma farinosa]
Length=154

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +P+L H L+ A+   ++QLAAV  RK +   W K+   L+  ++++++++   + S  +R
Sbjct  8    LPSLFHILQNAQDDQMKQLAAVEARKLVMSKWEKVDSSLKPHIREAMLNNTFSQGSKLIR  67

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQ  443
             +SA VV+ I +  +  GEWPDLLP L +  Q
Sbjct  68   HSSARVVAAIGEIDLENGEWPDLLPVLVKSVQ  99



>ref|XP_002616989.1| hypothetical protein CLUG_02433 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38307.1| hypothetical protein CLUG_02433 [Clavispora lusitaniae ATCC 42720]
Length=1106

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +3

Query  120  RQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLV  296
            +QA  ++ K    +P  +P+L+H L+ ++   ++QLAAV  RK I   W  +   L+  +
Sbjct  23   KQATSKLSKEFYTNPLALPSLLHILQNSQQDQIKQLAAVEARKLIGTKWESVDASLKPQI  82

Query  297  KQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            +++L+ +   + S  +R +SA VVS I +Y +    WPDLLP L    QS
Sbjct  83   REALLQNTFTQPSKLIRHSSARVVSAIGEYDLQDNTWPDLLPNLVNAVQS  132



>emb|CCC86701.1| karyopherin beta, partial [Millerozyma miso]
Length=152

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +P+L H L+ A+   ++QLAAV  RK +   W K+   L+  ++++++++   + S  +R
Sbjct  6    LPSLFHILQNAQDDQMKQLAAVEARKLVMSKWEKVDASLKPHIREAMLNNTFSQGSKLIR  65

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQ  443
             +SA VV+ I +  +  GEWPDLLP L +  Q
Sbjct  66   HSSARVVAAIGEIDLENGEWPDLLPVLVKSIQ  97



>ref|XP_004164755.1| PREDICTED: importin-5-like, partial [Cucumis sativus]
Length=798

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 10/135 (7%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAK--DPQVVP-ALIHHLRTAKTPNVRQLAAVLLR  242
             E LL   +   N+ R QAE  +  L K  DP  +   L H L+ +  P  R +AAVLLR
Sbjct  24   FETLLSHLMSSSNEQRSQAE-LVFNLCKQTDPDSLSLKLAHLLQFSPQPEARAMAAVLLR  82

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K++T      W +L+P  +  +K  L+  I  E S  + +   + VS +A   +P   WP
Sbjct  83   KQLTRDDSYLWPRLNPSSQSSLKSILLSCIQREDSKSISKKLCDTVSELASGILPDNGWP  142

Query  411  DLLPFLFQC--SQSP  449
            +LLPF+FQC  S SP
Sbjct  143  ELLPFMFQCVSSDSP  157



>gb|KGN54027.1| hypothetical protein Csa_4G268110 [Cucumis sativus]
Length=1105

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 10/135 (7%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAK--DPQVVP-ALIHHLRTAKTPNVRQLAAVLLR  242
             E LL   +   N+ R QAE  +  L K  DP  +   L H L+ +  P  R +AAVLLR
Sbjct  24   FETLLSHLMSSSNEQRSQAE-LVFNLCKQTDPDSLSLKLAHLLQFSPQPEARAMAAVLLR  82

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K++T      W +L+P  +  +K  L+  I  E S  + +   + VS +A   +P   WP
Sbjct  83   KQLTRDDSYLWPRLNPSSQSSLKSILLSCIQREDSKSISKKLCDTVSELASGILPDNGWP  142

Query  411  DLLPFLFQC--SQSP  449
            +LLPF+FQC  S SP
Sbjct  143  ELLPFMFQCVSSDSP  157



>ref|XP_006858951.1| hypothetical protein AMTR_s00068p00103300 [Amborella trichopoda]
 gb|ERN20418.1| hypothetical protein AMTR_s00068p00103300 [Amborella trichopoda]
Length=1084

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 73/139 (53%), Gaps = 13/139 (9%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAK--DPQVVPA-LIHHLRTAKTPNVRQLAAVLL  239
            + E L+ Q +   N+ R QAE  +  L K  DP  +   L H L +     +R +AA+LL
Sbjct  21   AFEALISQLMATGNEQRAQAE-TLFNLCKQHDPDSLALRLTHLLHSCPQSELRAMAAILL  79

Query  240  RKKITGH-------WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPA  398
            RK+IT         W +LSPQ +  +K  L+  +  E +  + +   + V+ +A   +  
Sbjct  80   RKQITSRTGDDSYLWPRLSPQTQATLKAQLLVCVQREDAKTIIKKLCDTVAELAAGVLAE  139

Query  399  GEWPDLLPFLFQC--SQSP  449
            G+WP+LLPF+FQC  S SP
Sbjct  140  GQWPELLPFMFQCVSSDSP  158



>gb|KJA23606.1| hypothetical protein HYPSUDRAFT_583175 [Hypholoma sublateritium 
FD-334 SS-4]
Length=1015

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 5/133 (4%)
 Frame = +3

Query  66   QSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLR  242
            Q+L  LL+Q    D +  + A  Q+ +   K+P  + AL   L ++   +VRQLAAV LR
Sbjct  7    QALHNLLLQTTSNDTNLLKAATAQLNQEYYKNPACISALASILASSPENSVRQLAAVELR  66

Query  243  KKI---TGH-WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K+I   +G+ W  L+   R+ +K  L + I  E +  VR ++A V++ IA   VP G W 
Sbjct  67   KRIIQNSGNLWTLLAQNEREEIKARLPELILAETNNLVRHSAARVIAAIATIEVPLGSWN  126

Query  411  DLLPFLFQCSQSP  449
             LLPFL Q + SP
Sbjct  127  QLLPFLQQTATSP  139



>ref|XP_008550092.1| PREDICTED: importin-5 [Microplitis demolitor]
Length=1098

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 65/130 (50%), Gaps = 7/130 (5%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGH  260
            LL   L  DND R QAE+  K L    +V   L           +R +AAVLLR+  +  
Sbjct  11   LLSTLLSTDNDVRTQAEEAYKNLPIQSKVTWLLTSLCNGHLAEEIRAMAAVLLRRLFSSE  70

Query  261  WGKLSPQL----RQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVP---AGEWPDLL  419
            +    PQL    ++ +K+ ++ SI  E S  +RR    VV+ +A+  +      +WP+ L
Sbjct  71   FMDFYPQLPPEAQEELKKQILLSIQNEQSETIRRKICEVVAEVARNLIDDDGNNQWPEFL  130

Query  420  PFLFQCSQSP  449
             FLFQC+ SP
Sbjct  131  NFLFQCANSP  140



>emb|CBN80554.1| karyopherin beta [Millerozyma miso]
Length=153

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +P+L H L+ A+   ++QLAAV  RK +   W K+   L+  ++++++++   + S  +R
Sbjct  7    LPSLFHILQNAQDDQMKQLAAVEARKLVMSKWEKVDASLKPHIREAMLNNTFSQGSKLIR  66

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQ  443
             +SA VV+ I +  +  GEWPDLLP L +  Q
Sbjct  67   HSSARVVAAIGEIDLENGEWPDLLPVLVKSIQ  98



>ref|XP_004149646.1| PREDICTED: LOW QUALITY PROTEIN: importin-5-like [Cucumis sativus]
Length=1116

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 10/135 (7%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAK--DPQVVP-ALIHHLRTAKTPNVRQLAAVLLR  242
             E LL   +   N+ R QAE  +  L K  DP  +   L H L+ +  P  R +AAVLLR
Sbjct  24   FETLLSHLMSSSNEQRSQAE-LVFNLCKQTDPDSLSLKLAHLLQFSPQPEARAMAAVLLR  82

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K++T      W +L+P  +  +K  L+  I  E S  + +   + VS +A   +P   WP
Sbjct  83   KQLTRDDSYLWPRLNPSSQSSLKSILLSCIQREDSKSISKKLCDTVSELASGILPDNGWP  142

Query  411  DLLPFLFQC--SQSP  449
            +LLPF+FQC  S SP
Sbjct  143  ELLPFMFQCVSSDSP  157



>ref|XP_008449884.1| PREDICTED: importin-5 [Cucumis melo]
Length=1105

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 10/135 (7%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAK--DPQVVP-ALIHHLRTAKTPNVRQLAAVLLR  242
             E LL   +   N+ R QAE  +  L K  DP  +   L H L+ +  P  R +AAVLLR
Sbjct  24   FETLLSHLMSSSNEQRSQAE-LVFNLCKQTDPDSLSLKLAHLLQFSPQPEARAMAAVLLR  82

Query  243  KKITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWP  410
            K++T      W +L+P  +  +K  L+  I  E S  + +   + VS +A   +P   WP
Sbjct  83   KQLTRDDSYLWPRLNPSSQSSLKSILLSCIQREDSKSISKKLCDTVSELASGILPDNGWP  142

Query  411  DLLPFLFQC--SQSP  449
            +LLPF+FQC  S SP
Sbjct  143  ELLPFMFQCVSSDSP  157



>emb|CBN80553.1| karyopherin beta [Millerozyma farinosa]
 emb|CCC86697.1| karyopherin beta, partial [Millerozyma farinosa]
 emb|CCC86698.1| karyopherin beta, partial [Millerozyma farinosa]
 emb|CCC86699.1| karyopherin beta, partial [Millerozyma farinosa]
 emb|CCC86700.1| karyopherin beta, partial [Millerozyma farinosa]
Length=152

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  VPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVR  347
            +P+L H L+ A+   ++QLAAV  RK +   W K+   L+  ++++++++   + S  +R
Sbjct  6    LPSLFHILQNAQDDQMKQLAAVEARKLVMSKWEKVDGSLKPHIREAMLNNTFSQGSKLIR  65

Query  348  RASANVVSIIAKYAVPAGEWPDLLPFLFQCSQ  443
             +SA VV+ I +  +  GEWPDLLP L +  Q
Sbjct  66   HSSARVVAAIGEIDLENGEWPDLLPVLVKSIQ  97



>ref|XP_003667555.1| hypothetical protein NDAI_0A01540 [Naumovozyma dairenensis CBS 
421]
 emb|CCD22312.1| hypothetical protein NDAI_0A01540 [Naumovozyma dairenensis CBS 
421]
Length=1114

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = +3

Query  159  PQVVPALIHHLRTAKTPNVRQLAAVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSA  338
            P  VPAL++ L+T     VRQLA + +RK I  HW  L    +  +K SL+ +   E   
Sbjct  40   PASVPALVNILQTQPDVGVRQLAGIEVRKLIPKHWNSLDDATKTQIKTSLLQNAFTEEKQ  99

Query  339  PVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
             +R A+A+V++ I+   + A +WPDL+P L Q + +
Sbjct  100  IIRHANAHVIAAISIEELEANKWPDLIPNLIQAASN  135



>ref|XP_001526900.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK43550.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
Length=1107

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 1/133 (1%)
 Frame = +3

Query  51   EEAMAQSLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLA  227
            ++    SLE  L Q L PD+   ++A  ++ K    +P  +PAL+  L  +    VRQLA
Sbjct  2    DDQFVSSLENTLRQTLTPDSSVIKEASQRLSKEFYPNPLALPALLQILNQSSQDEVRQLA  61

Query  228  AVLLRKKITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            AV  RK    +W K+   L+  +K+ L+     E +  +R  SA V++ IA+  +   EW
Sbjct  62   AVEARKLAADNWEKVDGSLKGSIKEQLLKGTFQEQNKRLRNLSARVIAAIAELDLEINEW  121

Query  408  PDLLPFLFQCSQS  446
             DLLP L    QS
Sbjct  122  QDLLPTLISAVQS  134



>gb|EPT01260.1| hypothetical protein FOMPIDRAFT_154393 [Fomitopsis pinicola FP-58527 
SS1]
Length=1083

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 5/135 (4%)
 Frame = +3

Query  60   MAQSLELLLIQFLMPDNDARRQAEDQIKR-LAKDPQVVPALIHHLRTAKTPNVRQLAAVL  236
              Q L  LL+Q    D    + A  Q+ R   K+P  +PAL   + ++    VRQLAAV 
Sbjct  5    FVQGLHSLLVQSTANDTVQLKAATAQLNREYYKNPACIPALASIIASSPDQAVRQLAAVE  64

Query  237  LRKKITGHWGKL----SPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGE  404
            LRK+I    G+L    S   R+ +K  L + +  + S  VR ++A V++ IA   +P G+
Sbjct  65   LRKRIASASGELWISVSQPDREQIKAKLPELVLADPSNLVRHSTARVIAAIASIEIPTGQ  124

Query  405  WPDLLPFLFQCSQSP  449
            W  LLPFL Q   SP
Sbjct  125  WQTLLPFLQQTCTSP  139



>gb|ESX02042.1| Importin subunit beta-4 [Ogataea parapolymorpha DL-1]
Length=1095

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE  L   L PDN+A + A   +K +   +    P+LIH L+ +   +V+QLAAV  +K 
Sbjct  9    LEQTLRNILSPDNNAIKNATQALKTQYYSNSLAFPSLIHLLQNSADDSVKQLAAVEAKKL  68

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            +   W  L   L+  +++SL+       S  +R +SA +V+ IA+  +P  +WP LL  L
Sbjct  69   VPKQWETLDESLKSQIRESLLKFAFAYKSKSIRHSSARIVAAIAEIDIPDNKWPTLLQSL  128

Query  429  FQCSQ  443
               +Q
Sbjct  129  VGGAQ  133



>ref|XP_006685749.1| hypothetical protein CANTEDRAFT_103297 [Candida tenuis ATCC 10573]
 gb|EGV64943.1| hypothetical protein CANTEDRAFT_103297 [Candida tenuis ATCC 10573]
Length=1104

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRK  245
            SLE  L Q L+ +    +QA  ++ K    +P  +P+L H L+ A+   ++QLA+V  RK
Sbjct  8    SLEDTLKQTLVANTATIKQASQKLTKDFYTNPLALPSLFHILQNAQDDQLKQLASVEARK  67

Query  246  KITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
             +   W  +   L+  ++ +++++   + S  +R +SA VV+ IA+  +   +WP+LLP 
Sbjct  68   LVYTKWAGVDEGLKSQIRSAMLNNTFTQSSKLIRHSSARVVAAIAEMDLDEKKWPELLPT  127

Query  426  LFQCSQS  446
            L +  QS
Sbjct  128  LIENVQS  134



>ref|XP_003987556.3| PREDICTED: importin-4 [Felis catus]
Length=1078

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
             LE +L + L+PD +  R+A +Q++ + +DP  +PAL   L +A  P +RQ +AVL R++
Sbjct  5    GLEQILRELLLPDTERIRRATEQLQTVLRDPAALPALCDLLASAADPQIRQFSAVLTRRR  64

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANV-VSIIAKYAVPAGEWPDLLPF  425
            ++ HW +L+ + R+ +K  ++ +   E    V  + A +  +I  K  + A  WP L+  
Sbjct  65   LSTHWRRLTAEHRESLKSLVLSAFQRETQHSVSLSLAQLSATIFRKEGLEA--WPQLMQL  122

Query  426  LFQCSQSP  449
            L   + SP
Sbjct  123  LQHSTHSP  130



>gb|KDR15912.1| Importin-4, partial [Zootermopsis nevadensis]
Length=1410

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = +3

Query  123  QAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITG--HWGKLSPQLRQLV  296
            Q   +++   K P+V+PAL + +  ++ P +RQ AAVLLRK+++   +W KL   ++  +
Sbjct  390  QGTRELQEAFKKPEVIPALCNVVGVSQNPQIRQYAAVLLRKRLSKSRNWTKLPVNVKNGI  449

Query  297  KQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQCSQS  446
            K+ ++ ++  E    V+ + A  +  I ++  P   WP++L F+ Q + S
Sbjct  450  KEGILQAMVNEQETYVKNSIAQFIGTIVRHEFPNQNWPEMLQFIQQLTSS  499



>ref|XP_011089154.1| PREDICTED: LOW QUALITY PROTEIN: importin-5-like [Sesamum indicum]
Length=1103

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 8/134 (6%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAK-DPQVVP-ALIHHLRTAKTPNVRQLAAVLLRK  245
             E L+   +   ND R QAE     L + DP  +   L H L ++     R +A +LLRK
Sbjct  24   FETLISHLMSSSNDQRSQAESIFNLLKQNDPNSLALKLAHLLSSSLHVEARAMATILLRK  83

Query  246  KITGH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPD  413
            ++T      W +L+   R  +K  L+ SI  E S  + +   + +S +A   +P  +WP+
Sbjct  84   QLTRDDSFIWPQLNESTRSAIKNILLSSIQSEDSKSIIKKLCDTISELASSLLPENQWPE  143

Query  414  LLPFLFQC--SQSP  449
            +LPF+FQC  S SP
Sbjct  144  ILPFMFQCVTSNSP  157



>ref|XP_010598869.1| PREDICTED: LOW QUALITY PROTEIN: importin-4 [Loxodonta africana]
Length=1098

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +3

Query  69   SLELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
             LE +L + L+PD +  R+A +Q++   +DP  +PAL   L +A  P +RQ AAVL R++
Sbjct  5    GLEQILRELLLPDTERIRRATEQLQIALRDPTALPALCDLLASAADPQIRQFAAVLTRRQ  64

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANV-VSIIAKYAVPAGEWPDLLPF  425
            +   W +L+ + R+ +K  ++ S+  E    VR + A +  +I  K  + A  WP+L+  
Sbjct  65   LNTRWRRLAAEPRESLKSLVLTSLQRETEHSVRLSLAQLAATIFRKEGLEA--WPELMQL  122

Query  426  LFQCSQSP  449
            L   + SP
Sbjct  123  LQHSTHSP  130



>ref|XP_007410567.1| hypothetical protein MELLADRAFT_43549 [Melampsora larici-populina 
98AG31]
 gb|EGG06329.1| hypothetical protein MELLADRAFT_43549 [Melampsora larici-populina 
98AG31]
Length=1084

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 70/133 (53%), Gaps = 6/133 (5%)
 Frame = +3

Query  66   QSLELLLIQFLMPDN-DARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLL  239
            Q L+  L Q   P   D  ++A   + +   K PQ +P L+  L  +  P+VRQL+AV L
Sbjct  7    QQLQTCLEQIASPSGTDGIKEATQALNEHFYKSPQAIPGLVELLSASPNPSVRQLSAVEL  66

Query  240  RKKIT----GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEW  407
            RK+I      H+ +L   +R  +K  L++ IT E  +  R A + VV+ IA+  +P   W
Sbjct  67   RKRILVAKRKHYKRLDDSVRVTIKARLLELITSETVSLTRHAISRVVAEIAELELPERTW  126

Query  408  PDLLPFLFQCSQS  446
            P+LL FL   + S
Sbjct  127  PELLNFLIAATDS  139



>ref|XP_011314194.1| PREDICTED: importin-4-like [Fopius arisanus]
Length=1079

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 2/123 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L + L+ DN   +Q   +++     P+  P L   + ++  P +RQ A +LLRK+ 
Sbjct  1    MEEILAKLLVADNSVIQQGTAELRAALVKPESTPMLCELIVSSVNPEIRQYATLLLRKRY  60

Query  252  T--GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
            T   HW +L P +R  VK  L+  +  E    V+   A ++ +I K+ +P   WP++  F
Sbjct  61   TKGKHWNQLPPTIRNQVKAILLPGLVNEPDKQVKNGIAQLIGVIVKHELPHNTWPEIFQF  120

Query  426  LFQ  434
            + Q
Sbjct  121  IQQ  123



>ref|XP_007783482.1| hypothetical protein W97_07314 [Coniosporium apollinis CBS 100218]
 gb|EON68165.1| hypothetical protein W97_07314 [Coniosporium apollinis CBS 100218]
Length=1080

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKITG  257
            LL   L PD +  + A   + K     P+ + AL+H L T  T  +RQLAAV  RK ++ 
Sbjct  9    LLESLLQPDTERVKAATASLNKNYYTSPESLKALLHILTTHPTSQLRQLAAVEARKLVSK  68

Query  258  HWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQC  437
            HW KL    +  ++Q L+     E    VR +SA V+S IAK  +  GEW +L   L Q 
Sbjct  69   HWAKLPADQKPQIRQQLLQFTLNEEGTLVRHSSARVISAIAKIDLEDGEWTELPGLLQQA  128

Query  438  SQS  446
            + S
Sbjct  129  ASS  131



>ref|XP_003702194.1| PREDICTED: importin-4-like [Megachile rotundata]
Length=1082

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKKI  251
            +E +L++ L+ DN   ++   +++   K P+   AL   + ++    +RQ AAVLLRK+ 
Sbjct  1    MEEILLKLLVADNATIQEGTTELREAFKKPESTLALCRLIVSSTNSQIRQYAAVLLRKRY  60

Query  252  --TGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPF  425
                HW KL P ++   K  ++ ++  E    V+ A A ++ +I K+ +P   WP++L F
Sbjct  61   GKGKHWLKLPPHIQTEFKTIILQALVNEQEKFVKNAVAQLIGVIVKHELPNNGWPEVLQF  120

Query  426  LFQCSQS  446
            + Q   S
Sbjct  121  VQQLVTS  127



>ref|XP_010535931.1| PREDICTED: importin-5-like [Tarenaya hassleriana]
 ref|XP_010535932.1| PREDICTED: importin-5-like [Tarenaya hassleriana]
Length=1116

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = +3

Query  84   LIQFLMPDNDARRQAEDQIKRLAK--DPQVVP-ALIHHLRTAKTPNVRQLAAVLLRKKIT  254
            LI  LM  ++ +R + + +  LAK  DP  +   L H L+ +  P  R +AAVLLRK +T
Sbjct  27   LISSLMSSSNEQRSSAEALFNLAKQTDPDTLALKLAHILQLSPYPEARAMAAVLLRKLLT  86

Query  255  GH----WGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLP  422
                  W +LS   +  +K S++  I  E +  + +   + VS +A   +P   WP+LLP
Sbjct  87   RDDAYLWPRLSLSTQSSLKSSMLSCIQREDTKSISKKICDTVSELASGILPENGWPELLP  146

Query  423  FLFQCSQS  446
            F+FQC  S
Sbjct  147  FVFQCVSS  154



>gb|EDK37470.2| hypothetical protein PGUG_01568 [Meyerozyma guilliermondii ATCC 
6260]
Length=1105

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 1/126 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE  L Q L+PD+ A +QA  ++ K L  +   +PALIH L+ +    ++QLA+V  RK 
Sbjct  8    LEDTLKQTLVPDSVAIKQASQRLSKELYPNDLALPALIHILQNSSNDQIKQLASVEARKL  67

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            +   W  L    +  +++S++ +   + SA +R +SA VV+ I +  +  GEW +LLP L
Sbjct  68   VLSKWETLDASQKPQIRESMLQNTFTQPSALIRHSSARVVAAIGEIDLDKGEWQELLPSL  127

Query  429  FQCSQS  446
             +  Q 
Sbjct  128  VKGIQG  133



>ref|XP_001485897.1| hypothetical protein PGUG_01568 [Meyerozyma guilliermondii ATCC 
6260]
Length=1105

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 1/126 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQI-KRLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE  L Q L+PD+ A +QA  ++ K L  +   +PALIH L+ +    ++QLA+V  RK 
Sbjct  8    LEDTLKQTLVPDSVAIKQASQRLSKELYPNDLALPALIHILQNSSNDQIKQLASVEARKL  67

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            +   W  L    +  +++S++ +   + SA +R +SA VV+ I +  +  GEW +LLP L
Sbjct  68   VLSKWETLDASQKPQIRESMLQNTFTQPSALIRHSSARVVAAIGEIDLDKGEWQELLPSL  127

Query  429  FQCSQS  446
             +  Q 
Sbjct  128  VKGIQG  133



>ref|XP_005840903.1| hypothetical protein GUITHDRAFT_41061, partial [Guillardia theta 
CCMP2712]
 gb|EKX53923.1| hypothetical protein GUITHDRAFT_41061, partial [Guillardia theta 
CCMP2712]
Length=1033

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 3/120 (3%)
 Frame = +3

Query  81   LLIQFLMPDNDARRQAEDQIKRLAKD--PQVVPALIHHLRTAKTPNVRQLAAVLLRKKIT  254
            L+   +  +N+ R++AE + + +  +       ALI  +   ++   + +AAVL R  ++
Sbjct  4    LMKSLMSSENEIRKEAEKKYEEIKTEMPDATCTALIQEIAQGESEESKTMAAVLARSTLS  63

Query  255  GHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFLFQ  434
              W KLS   ++ ++  L+D++  E SAP  R  ANVV  I+ +A   G+WP LLP L++
Sbjct  64   EVWEKLSTSTKEDLQSRLLDALKAESSAPFLRKVANVVGAIS-FAANDGKWPQLLPTLYE  122



>ref|XP_002495117.1| ZYRO0B03718p [Zygosaccharomyces rouxii]
 emb|CAR26184.1| ZYRO0B03718p [Zygosaccharomyces rouxii]
Length=1115

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 1/124 (1%)
 Frame = +3

Query  72   LELLLIQFLMPDNDARRQAEDQIK-RLAKDPQVVPALIHHLRTAKTPNVRQLAAVLLRKK  248
            LE  L     P++ + + A   ++ +    P  +PALIH L+ ++   ++QLA V  RK 
Sbjct  9    LEQTLGAITQPNSASVKDATKTLQSQFYTKPATLPALIHILQGSQNDALKQLAGVEARKL  68

Query  249  ITGHWGKLSPQLRQLVKQSLIDSITVEHSAPVRRASANVVSIIAKYAVPAGEWPDLLPFL  428
            ++ HW  L   L+  +K SL+ +   E    VR A+A V++ I    +   +WPDL+P L
Sbjct  69   VSKHWKTLDTNLQNRIKASLLQTAFSEPKEIVRHANARVIAAIGTEELEDNKWPDLIPNL  128

Query  429  FQCS  440
             Q +
Sbjct  129  IQAA  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553272586920