BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004D07

Length=260
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007161307.1|  hypothetical protein PHAVU_001G058800g             143   1e-38   Phaseolus vulgaris [French bean]
ref|XP_003550140.1|  PREDICTED: zinc finger protein 622-like isof...    142   3e-38   Glycine max [soybeans]
gb|KHN31608.1|  Zinc finger protein                                     142   3e-38   Glycine soja [wild soybean]
ref|XP_010049815.1|  PREDICTED: zinc finger protein 622                 142   3e-38   Eucalyptus grandis [rose gum]
ref|XP_003538077.1|  PREDICTED: zinc finger protein 622-like isof...    141   7e-38   Glycine max [soybeans]
ref|XP_003550141.1|  PREDICTED: zinc finger protein 622-like            140   1e-37   Glycine max [soybeans]
gb|KHN13054.1|  Zinc finger protein                                     140   1e-37   Glycine soja [wild soybean]
ref|XP_007011584.1|  Zinc finger protein 622 isoform 3                  137   2e-37   
ref|XP_003538078.1|  PREDICTED: zinc finger protein 622-like            139   3e-37   Glycine max [soybeans]
gb|KHN13053.1|  Zinc finger protein 622                                 138   4e-37   Glycine soja [wild soybean]
gb|KJB55203.1|  hypothetical protein B456_009G068400                    135   6e-37   Gossypium raimondii
ref|XP_007011582.1|  Zinc finger protein 622 isoform 1                  138   6e-37   
ref|XP_010265409.1|  PREDICTED: zinc finger protein 622                 137   1e-36   Nelumbo nucifera [Indian lotus]
gb|KJB55202.1|  hypothetical protein B456_009G068400                    135   2e-36   Gossypium raimondii
gb|KJB55201.1|  hypothetical protein B456_009G068400                    137   3e-36   Gossypium raimondii
emb|CDP12462.1|  unnamed protein product                                136   3e-36   Coffea canephora [robusta coffee]
emb|CDP12454.1|  unnamed protein product                                137   3e-36   Coffea canephora [robusta coffee]
ref|XP_011082078.1|  PREDICTED: zinc finger protein 622                 135   8e-36   Sesamum indicum [beniseed]
gb|KHG19598.1|  Zinc finger protein                                     135   1e-35   Gossypium arboreum [tree cotton]
ref|XP_008219929.1|  PREDICTED: zinc finger protein 622                 134   3e-35   Prunus mume [ume]
ref|XP_007222754.1|  hypothetical protein PRUPE_ppa006521mg             134   4e-35   Prunus persica
ref|XP_010102859.1|  Zinc finger protein                                134   4e-35   Morus notabilis
ref|XP_011031356.1|  PREDICTED: zinc finger protein 622-like            133   5e-35   Populus euphratica
ref|XP_006382168.1|  zinc finger family protein                         133   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009338830.1|  PREDICTED: zinc finger protein 622-like            133   6e-35   Pyrus x bretschneideri [bai li]
gb|KDP33442.1|  hypothetical protein JCGZ_07013                         133   7e-35   Jatropha curcas
ref|XP_009368013.1|  PREDICTED: zinc finger protein 622-like            132   8e-35   Pyrus x bretschneideri [bai li]
ref|XP_009363611.1|  PREDICTED: zinc finger protein 622-like            132   8e-35   Pyrus x bretschneideri [bai li]
ref|XP_002527963.1|  transcription factor, putative                     132   9e-35   Ricinus communis
gb|AFK41799.1|  unknown                                                 132   1e-34   Lotus japonicus
gb|KJB06568.1|  hypothetical protein B456_001G001500                    132   1e-34   Gossypium raimondii
ref|XP_008352169.1|  PREDICTED: zinc finger protein 622-like            132   1e-34   
gb|KJB06566.1|  hypothetical protein B456_001G001500                    132   1e-34   Gossypium raimondii
gb|AFK42392.1|  unknown                                                 132   1e-34   Lotus japonicus
gb|KHG15736.1|  Zinc finger protein                                     131   1e-34   Gossypium arboreum [tree cotton]
gb|KHG15735.1|  Zinc finger protein                                     132   2e-34   Gossypium arboreum [tree cotton]
ref|XP_004498584.1|  PREDICTED: zinc finger protein 622-like            132   2e-34   Cicer arietinum [garbanzo]
ref|NP_001280881.1|  zinc finger protein 622                            132   2e-34   Malus domestica [apple tree]
ref|XP_004253056.1|  PREDICTED: zinc finger protein 622                 131   3e-34   Solanum lycopersicum
ref|XP_010668047.1|  PREDICTED: zinc finger protein 622                 131   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006342459.1|  PREDICTED: zinc finger protein 622-like            131   4e-34   Solanum tuberosum [potatoes]
ref|XP_002324955.2|  zinc finger family protein                         130   5e-34   
ref|XP_008378248.1|  PREDICTED: zinc finger protein 622-like            130   5e-34   
ref|XP_010914164.1|  PREDICTED: zinc finger protein 622-like            129   1e-33   Elaeis guineensis
gb|EYU22071.1|  hypothetical protein MIMGU_mgv1a007393mg                129   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_009800477.1|  PREDICTED: zinc finger protein 622-like            129   2e-33   Nicotiana sylvestris
gb|KDO67269.1|  hypothetical protein CISIN_1g015261mg                   125   2e-33   Citrus sinensis [apfelsine]
ref|XP_009616044.1|  PREDICTED: zinc finger protein 622                 128   4e-33   Nicotiana tomentosiformis
ref|XP_010417208.1|  PREDICTED: zinc finger protein 622-like            127   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010429428.1|  PREDICTED: zinc finger protein 622-like            127   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010472458.1|  PREDICTED: zinc finger protein 622-like            127   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006450152.1|  hypothetical protein CICLE_v10008476mg             126   1e-32   Citrus clementina [clementine]
gb|KDO67268.1|  hypothetical protein CISIN_1g015261mg                   125   2e-32   Citrus sinensis [apfelsine]
ref|NP_180026.1|  zinc finger domain protein REI1-LIKE 2                126   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAA16545.1|  putative zinc finger protein                           126   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880589.1|  hypothetical protein ARALYDRAFT_481305             125   3e-32   
ref|XP_006293479.1|  hypothetical protein CARUB_v10023355mg             125   3e-32   Capsella rubella
ref|XP_009117121.1|  PREDICTED: zinc finger protein 622-like            125   3e-32   Brassica rapa
ref|XP_006404984.1|  hypothetical protein EUTSA_v10000189mg             125   4e-32   Eutrema salsugineum [saltwater cress]
emb|CDY34766.1|  BnaA09g41330D                                          125   4e-32   Brassica napus [oilseed rape]
ref|NP_567875.1|  protein REI1-LIKE 1                                   125   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974652.1|  protein REI1-LIKE 1                                   125   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAK44084.1|AF370269_1  putative zinc finger protein                  124   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794317.1|  PREDICTED: zinc finger protein 622-like            125   8e-32   Phoenix dactylifera
ref|XP_002867303.1|  zinc finger family protein                         124   8e-32   
gb|KEH39759.1|  C2H2-type zinc finger protein                           124   9e-32   Medicago truncatula
gb|KFK32629.1|  hypothetical protein AALP_AA6G268300                    124   9e-32   Arabis alpina [alpine rockcress]
ref|XP_011045006.1|  PREDICTED: zinc finger protein 622-like            124   1e-31   Populus euphratica
gb|EPS72142.1|  hypothetical protein M569_02614                         124   1e-31   Genlisea aurea
ref|XP_009140559.1|  PREDICTED: zinc finger protein 622                 124   1e-31   Brassica rapa
emb|CDY20320.1|  BnaC04g36360D                                          124   1e-31   Brassica napus [oilseed rape]
ref|XP_004291236.1|  PREDICTED: zinc finger protein 622                 124   1e-31   Fragaria vesca subsp. vesca
emb|CAN62771.1|  hypothetical protein VITISV_027109                     123   2e-31   Vitis vinifera
ref|XP_006412594.1|  hypothetical protein EUTSA_v10025366mg             123   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010525877.1|  PREDICTED: zinc finger protein 622                 123   3e-31   Tarenaya hassleriana [spider flower]
emb|CDY46155.1|  BnaA04g14430D                                          122   4e-31   Brassica napus [oilseed rape]
ref|XP_006483736.1|  PREDICTED: zinc finger protein 622-like            122   5e-31   
emb|CBI20772.3|  unnamed protein product                                122   6e-31   Vitis vinifera
ref|XP_002282746.1|  PREDICTED: zinc finger protein 622                 122   6e-31   Vitis vinifera
ref|XP_004171115.1|  PREDICTED: zinc finger protein 622-like            117   1e-30   
gb|KFK29727.1|  hypothetical protein AALP_AA7G170800                    121   1e-30   Arabis alpina [alpine rockcress]
emb|CDX68744.1|  BnaC01g07090D                                          121   2e-30   
ref|XP_009126994.1|  PREDICTED: zinc finger protein 622                 120   2e-30   Brassica rapa
ref|XP_009769243.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    120   2e-30   Nicotiana sylvestris
emb|CDY28267.1|  BnaA01g05820D                                          120   4e-30   Brassica napus [oilseed rape]
ref|XP_009406616.1|  PREDICTED: zinc finger protein 622-like            119   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845651.1|  hypothetical protein AMTR_s00019p00227240          118   1e-29   Amborella trichopoda
ref|XP_006283853.1|  hypothetical protein CARUB_v10004960mg             118   1e-29   Capsella rubella
ref|XP_009618306.1|  PREDICTED: zinc finger protein 622-like            118   2e-29   Nicotiana tomentosiformis
ref|XP_004136315.1|  PREDICTED: zinc finger protein 622-like            117   4e-29   Cucumis sativus [cucumbers]
ref|XP_008466318.1|  PREDICTED: zinc finger protein 622                 116   6e-29   Cucumis melo [Oriental melon]
emb|CDX76808.1|  BnaC08g33940D                                          115   1e-28   
ref|XP_010438043.1|  PREDICTED: zinc finger protein 622-like            115   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010447561.1|  PREDICTED: zinc finger protein 622-like            115   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010432868.1|  PREDICTED: zinc finger protein 622-like            115   2e-28   Camelina sativa [gold-of-pleasure]
gb|ABK25050.1|  unknown                                                 114   3e-28   Picea sitchensis
ref|XP_002437507.1|  hypothetical protein SORBIDRAFT_10g028300          112   3e-27   Sorghum bicolor [broomcorn]
ref|XP_004966161.1|  PREDICTED: zinc finger protein 622-like            111   4e-27   Setaria italica
ref|XP_006656412.1|  PREDICTED: zinc finger protein 622-like            110   8e-27   Oryza brachyantha
dbj|BAK05098.1|  predicted protein                                      110   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151247.1|  LOC100284880                                       110   9e-27   Zea mays [maize]
gb|EEC81236.1|  hypothetical protein OsI_24290                          108   3e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001058435.1|  Os06g0693500                                       108   4e-26   
ref|XP_003563458.1|  PREDICTED: zinc finger protein 622                 105   4e-25   Brachypodium distachyon [annual false brome]
ref|XP_004244493.1|  PREDICTED: zinc finger protein 622               98.6    1e-22   Solanum lycopersicum
ref|XP_010929264.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  99.0    1e-22   
ref|XP_002437508.1|  hypothetical protein SORBIDRAFT_10g028310        92.0    1e-20   
ref|XP_004966160.1|  PREDICTED: zinc finger protein 622-like          92.8    2e-20   Setaria italica
ref|XP_001753134.1|  predicted protein                                92.4    3e-20   
emb|CDX73317.1|  BnaC05g27890D                                        83.6    1e-17   
emb|CDX80697.1|  BnaC08g05310D                                        82.8    2e-17   
ref|XP_002985761.1|  hypothetical protein SELMODRAFT_234873           82.8    1e-16   Selaginella moellendorffii
ref|XP_002974456.1|  hypothetical protein SELMODRAFT_101058           82.8    1e-16   
ref|XP_006591049.1|  PREDICTED: zinc finger protein 622-like isof...  78.2    4e-15   Glycine max [soybeans]
ref|XP_010149978.1|  PREDICTED: zinc finger protein 622               68.6    1e-11   Eurypyga helias
ref|XP_009961992.1|  PREDICTED: zinc finger protein 622               67.0    1e-11   Tyto alba [Schleiereule]
gb|KFV39278.1|  Zinc finger protein 622                               67.0    1e-11   Tyto alba [Schleiereule]
ref|XP_009907485.1|  PREDICTED: zinc finger protein 622               68.2    3e-11   Picoides pubescens
ref|XP_009955918.1|  PREDICTED: zinc finger protein 622               68.2    3e-11   Leptosomus discolor
gb|EOB07815.1|  Zinc finger protein 622                               67.8    4e-11   Anas platyrhynchos [duck]
ref|XP_010084783.1|  PREDICTED: zinc finger protein 622               67.8    5e-11   Pterocles gutturalis
gb|EJW74120.1|  hypothetical protein WUBG_14972                       63.9    5e-11   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_009882040.1|  PREDICTED: zinc finger protein 622               67.4    5e-11   Charadrius vociferus
ref|XP_005041707.1|  PREDICTED: zinc finger protein 622 isoform X1    67.4    6e-11   Ficedula albicollis
ref|XP_010175401.1|  PREDICTED: zinc finger protein 622               67.4    6e-11   Antrostomus carolinensis
ref|XP_005484357.1|  PREDICTED: zinc finger protein 622               67.4    6e-11   Zonotrichia albicollis
ref|XP_005422625.1|  PREDICTED: zinc finger protein 622               67.4    6e-11   
gb|AAK97212.1|AF299386_1  putative Zn-finger protein C47L             67.0    7e-11   Gallus gallus [bantam]
ref|XP_005010777.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  67.0    7e-11   
ref|XP_009470313.1|  PREDICTED: zinc finger protein 622               67.4    7e-11   Nipponia nippon
ref|XP_008635410.1|  PREDICTED: zinc finger protein 622               67.4    7e-11   Corvus brachyrhynchos
ref|XP_010129714.1|  PREDICTED: zinc finger protein 622               67.0    7e-11   Buceros rhinoceros silvestris
ref|XP_009875577.1|  PREDICTED: zinc finger protein 622               67.0    8e-11   Apaloderma vittatum
sp|Q90Y35.1|ZN622_CHICK  RecName: Full=Zinc finger protein 622; A...  67.0    8e-11   Gallus gallus [bantam]
ref|XP_005530939.1|  PREDICTED: zinc finger protein 622               67.0    8e-11   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFO61817.1|  Zinc finger protein 622                               67.0    8e-11   Corvus brachyrhynchos
ref|XP_010193686.1|  PREDICTED: zinc finger protein 622               67.0    8e-11   Colius striatus
ref|XP_009568575.1|  PREDICTED: zinc finger protein 622               67.0    8e-11   Cuculus canorus
ref|XP_009572955.1|  PREDICTED: zinc finger protein 622               67.0    8e-11   Fulmarus glacialis
ref|XP_006027690.1|  PREDICTED: zinc finger protein 622 isoform X2    67.0    9e-11   Alligator sinensis
ref|XP_008937252.1|  PREDICTED: zinc finger protein 622               67.0    9e-11   Merops nubicus
ref|XP_009911754.1|  PREDICTED: zinc finger protein 622               67.0    9e-11   Haliaeetus albicilla
ref|XP_001779994.1|  predicted protein                                66.6    9e-11   
ref|XP_003204860.1|  PREDICTED: zinc finger protein 622               67.0    9e-11   Meleagris gallopavo [common turkey]
ref|XP_006027689.1|  PREDICTED: zinc finger protein 622 isoform X1    67.0    9e-11   Alligator sinensis
ref|XP_006261028.1|  PREDICTED: zinc finger protein 622 isoform X2    67.0    9e-11   
ref|XP_008920936.1|  PREDICTED: zinc finger protein 622               67.0    9e-11   Manacus vitellinus
ref|XP_009286281.1|  PREDICTED: zinc finger protein 622               67.0    9e-11   Aptenodytes forsteri
ref|XP_006261027.1|  PREDICTED: zinc finger protein 622 isoform X1    67.0    9e-11   
ref|XP_010225595.1|  PREDICTED: zinc finger protein 622 isoform X2    67.0    1e-10   Tinamus guttatus
ref|XP_008496309.1|  PREDICTED: zinc finger protein 622               66.2    1e-10   
ref|XP_010225587.1|  PREDICTED: zinc finger protein 622 isoform X1    67.0    1e-10   Tinamus guttatus
ref|XP_010122778.1|  PREDICTED: zinc finger protein 622               67.0    1e-10   Chlamydotis macqueenii
ref|XP_009820658.1|  PREDICTED: zinc finger protein 622               67.0    1e-10   Gavia stellata
gb|KFR13904.1|  Zinc finger protein 622                               67.0    1e-10   Opisthocomus hoazin [hoatzin]
ref|XP_009505834.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Phalacrocorax carbo [common cormorant]
ref|XP_009936853.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Opisthocomus hoazin [hoatzin]
ref|XP_010014921.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Nestor notabilis
ref|XP_005153414.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Melopsittacus undulatus
ref|XP_005498025.1|  PREDICTED: zinc finger protein 622 isoform X1    66.6    1e-10   Columba livia [carrier pigeon]
gb|KFZ65667.1|  Zinc finger protein 622                               66.6    1e-10   Podiceps cristatus
ref|XP_009323268.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Pygoscelis adeliae
gb|KFQ84619.1|  Zinc finger protein 622                               66.6    1e-10   Phoenicopterus ruber ruber
ref|XP_009476736.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Pelecanus crispus
ref|NP_989461.2|  zinc finger protein 622                             66.6    1e-10   Gallus gallus [bantam]
ref|XP_010298371.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Balearica regulorum gibbericeps
ref|XP_010291352.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Phaethon lepturus
ref|XP_009980421.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Tauraco erythrolophus
gb|KFO09709.1|  Zinc finger protein 622                               66.6    1e-10   Balearica regulorum gibbericeps
gb|KFO96100.1|  Zinc finger protein 622                               66.6    1e-10   Calypte anna
ref|XP_009679581.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Struthio camelus australis
ref|XP_010003388.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Chaetura pelagica
ref|XP_010185136.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Mesitornis unicolor
gb|KFP54392.1|  Zinc finger protein 622                               66.6    1e-10   Cathartes aura
ref|XP_005235847.1|  PREDICTED: zinc finger protein 622               66.6    1e-10   Falco peregrinus [peregrine]
ref|XP_001645072.1|  hypothetical protein Kpol_1035p27                65.5    2e-10   Vanderwaltozyma polyspora DSM 70294
ref|XP_009702614.1|  PREDICTED: zinc finger protein 622               65.9    2e-10   Cariama cristata
ref|XP_008611697.1|  hypothetical protein SDRG_07629                  65.5    3e-10   Saprolegnia diclina VS20
ref|XP_005290261.1|  PREDICTED: zinc finger protein 622 isoform X1    65.9    3e-10   Chrysemys picta bellii
ref|XP_004175197.1|  PREDICTED: zinc finger protein 622               65.5    3e-10   
ref|XP_008166808.1|  PREDICTED: zinc finger protein 622 isoform X3    65.5    3e-10   
ref|XP_009636175.1|  PREDICTED: zinc finger protein 622               65.5    3e-10   Egretta garzetta
gb|EMP28578.1|  hypothetical protein UY3_14325                        65.1    3e-10   Chelonia mydas [green seaturtle]
ref|XP_005290262.1|  PREDICTED: zinc finger protein 622 isoform X2    65.5    3e-10   Chrysemys picta bellii
ref|XP_006126162.1|  PREDICTED: zinc finger protein 622-like isof...  65.5    3e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010398489.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  65.5    4e-10   
emb|CCE40769.1|  hypothetical protein CPAR2_108040                    65.1    4e-10   Candida parapsilosis
ref|XP_006126163.1|  PREDICTED: zinc finger protein 622-like isof...  65.1    4e-10   Pelodiscus sinensis [Chinese softshell turtle]
dbj|BAO40726.1|  pre-60S factor REI1                                  64.7    4e-10   Kluyveromyces marxianus DMKU3-1042
ref|XP_009076748.1|  PREDICTED: zinc finger protein 622               65.1    5e-10   Acanthisitta chloris
ref|XP_007067500.1|  PREDICTED: zinc finger protein 622               65.1    5e-10   
ref|XP_003868061.1|  Rei1 cytoplasmic pre-60S factor                  64.3    5e-10   Candida orthopsilosis Co 90-125
ref|XP_001899722.1|  Zinc finger, C2H2 type family protein            64.3    6e-10   Brugia malayi [agent of lymphatic filariasis]
emb|CDQ00177.1|  Protein Bm13985, isoform a                           64.3    6e-10   
emb|CDH17194.1|  related to Zinc finger protein REH1                  64.3    6e-10   Zygosaccharomyces bailii ISA1307
emb|CDF91377.1|  ZYBA0S11-01486g1_1                                   64.3    6e-10   Zygosaccharomyces bailii CLIB 213
gb|KJB06567.1|  hypothetical protein B456_001G001500                  63.9    7e-10   Gossypium raimondii
emb|CAJ83907.1|  zinc finger protein 622                              62.4    7e-10   Xenopus tropicalis [western clawed frog]
ref|XP_009094102.1|  PREDICTED: zinc finger protein 622               64.3    7e-10   
gb|KDO30833.1|  hypothetical protein SPRG_04734                       63.9    7e-10   Saprolegnia parasitica CBS 223.65
ref|XP_710870.1|  potential zinc finger protein                       63.9    1e-09   
ref|XP_001526946.1|  conserved hypothetical protein                   63.9    1e-09   Lodderomyces elongisporus NRRL YB-4239
ref|XP_710858.1|  potential zinc finger protein                       63.9    1e-09   
ref|XP_003759684.1|  PREDICTED: zinc finger protein 622               63.5    1e-09   
ref|XP_008819991.1|  PREDICTED: zinc finger protein 622 isoform X2    63.5    1e-09   
gb|ETL81695.1|  hypothetical protein L917_18045                       63.2    2e-09   Phytophthora parasitica
emb|CDO95283.1|  unnamed protein product                              63.2    2e-09   Kluyveromyces dobzhanskii CBS 2104
ref|XP_008896708.1|  hypothetical protein PPTG_05012                  63.2    2e-09   Phytophthora parasitica INRA-310
ref|XP_004078799.1|  PREDICTED: zinc finger protein 622               63.5    2e-09   Oryzias latipes [Japanese rice fish]
ref|XP_003143673.1|  hypothetical protein LOAG_08093                  59.3    2e-09   
ref|XP_008819990.1|  PREDICTED: zinc finger protein 622 isoform X1    63.5    2e-09   Nannospalax galili
ref|XP_694322.6|  PREDICTED: zinc finger protein 622                  63.5    2e-09   
gb|KFO24852.1|  Zinc finger protein 622                               63.2    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_010642309.1|  PREDICTED: zinc finger protein 622               63.2    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005002367.1|  PREDICTED: zinc finger protein 622 isoform X3    63.2    2e-09   
ref|XP_003466756.1|  PREDICTED: zinc finger protein 622 isoform X1    63.2    2e-09   
emb|CDH10948.1|  related to Zinc finger protein REH1                  62.8    2e-09   Zygosaccharomyces bailii ISA1307
ref|XP_005002366.1|  PREDICTED: zinc finger protein 622 isoform X2    62.8    2e-09   Cavia porcellus [guinea pig]
ref|XP_003340644.1|  PREDICTED: zinc finger protein 622               62.8    2e-09   Monodelphis domestica
ref|XP_005386191.1|  PREDICTED: zinc finger protein 622 isoform X2    62.8    3e-09   
ref|XP_002417147.1|  conserved hypothetical protein                   62.4    3e-09   Candida dubliniensis CD36
gb|EDK36114.2|  hypothetical protein PGUG_00212                       62.0    3e-09   Meyerozyma guilliermondii ATCC 6260
ref|XP_005386190.1|  PREDICTED: zinc finger protein 622 isoform X1    62.4    3e-09   Chinchilla lanigera
ref|NP_984910.1|  AER050Cp                                            62.0    4e-09   Eremothecium gossypii ATCC 10895
ref|XP_455158.1|  hypothetical protein                                62.0    4e-09   Kluyveromyces lactis
ref|XP_004641912.1|  PREDICTED: zinc finger protein 622-like          62.4    4e-09   
ref|XP_004644793.1|  PREDICTED: zinc finger protein 622               62.4    4e-09   Octodon degus
ref|XP_003668755.1|  hypothetical protein NDAI_0B04780                62.0    4e-09   Naumovozyma dairenensis CBS 421
ref|NP_001011460.1|  zinc finger protein 622                          62.0    4e-09   Xenopus tropicalis [western clawed frog]
gb|AES97876.2|  hypothetical protein MTR_5g061270                     59.7    4e-09   Medicago truncatula
gb|AAO13531.1|  zinc finger protein Yan                               62.0    5e-09   Bufo gargarizans [Chusan Island toad]
ref|XP_002907194.1|  conserved hypothetical protein                   61.6    5e-09   Phytophthora infestans T30-4
ref|XP_003681582.1|  hypothetical protein TDEL_0E01280                61.6    6e-09   Torulaspora delbrueckii
ref|XP_008864373.1|  hypothetical protein H310_02589                  61.6    6e-09   Aphanomyces invadans
emb|CDR44718.1|  CYFA0S15e01904g1_1                                   61.2    7e-09   Cyberlindnera fabianii
ref|XP_009844345.1|  hypothetical protein H257_17308                  61.2    7e-09   Aphanomyces astaci
ref|XP_008347704.1|  PREDICTED: zinc finger protein 622-like          61.2    7e-09   
ref|XP_447077.1|  hypothetical protein                                61.2    7e-09   [Candida] glabrata
ref|NP_001079501.1|  zinc finger protein 622                          61.2    8e-09   Xenopus laevis [clawed frog]
ref|XP_003675200.1|  hypothetical protein NCAS_0B07450                60.8    1e-08   Naumovozyma castellii CBS 4309
ref|XP_001486835.1|  hypothetical protein PGUG_00212                  60.8    1e-08   Meyerozyma guilliermondii ATCC 6260
ref|XP_011308899.1|  PREDICTED: ankyrin repeat and zinc finger do...  61.2    1e-08   Fopius arisanus
ref|XP_005796649.1|  PREDICTED: zinc finger protein 622-like          60.8    1e-08   Xiphophorus maculatus
ref|XP_003614918.1|  C2H2 zinc finger protein FZF                     58.9    1e-08   
sp|Q7TM96.2|ZN622_RAT  RecName: Full=Zinc finger protein 622; Alt...  60.5    1e-08   Rattus norvegicus [brown rat]
ref|XP_003058551.1|  predicted protein                                60.1    1e-08   Micromonas pusilla CCMP1545
gb|EDL82619.1|  zinc finger protein 622, isoform CRA_a                60.5    1e-08   Rattus norvegicus [brown rat]
ref|XP_004845257.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   Heterocephalus glaber [naked mole rat]
ref|XP_004884669.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   
ref|XP_008433012.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   Poecilia reticulata
ref|XP_004995052.1|  zinc finger protein                              60.5    2e-08   Salpingoeca rosetta
gb|AGO12404.1|  AaceriAER050Cp                                        60.1    2e-08   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_002767249.1|  conserved hypothetical protein                   60.1    2e-08   Perkinsus marinus ATCC 50983
ref|NP_001009652.1|  zinc finger protein 622                          60.5    2e-08   Rattus norvegicus [brown rat]
ref|XP_002550205.1|  hypothetical protein CTRG_04503                  60.1    2e-08   Candida tropicalis MYA-3404
ref|XP_005081365.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007577180.1|  PREDICTED: zinc finger protein 622               60.1    2e-08   Poecilia formosa
gb|AAH55386.1|  Znf622 protein                                        60.5    2e-08   Danio rerio [leopard danio]
ref|XP_005993558.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   
ref|XP_005319724.1|  PREDICTED: zinc finger protein 622               60.5    2e-08   Ictidomys tridecemlineatus
gb|EPY72545.1|  zinc finger protein 622                               60.1    2e-08   Camelus ferus
ref|XP_002108682.1|  hypothetical protein TRIADDRAFT_18203            59.7    2e-08   Trichoplax adhaerens
ref|XP_456511.1|  DEHA2A04356p                                        60.1    2e-08   Debaryomyces hansenii CBS767
gb|AAP78750.1|  Ac1133                                                60.5    2e-08   Rattus norvegicus [brown rat]
emb|CDS03646.1|  hypothetical protein LRAMOSA01048                    59.7    2e-08   Lichtheimia ramosa
ref|XP_003504730.1|  PREDICTED: zinc finger protein 622               60.1    2e-08   Cricetulus griseus [Chinese hamsters]
gb|EJD75085.1|  hypothetical protein LOAG_17697                       59.7    2e-08   Loa loa
ref|XP_007950095.1|  PREDICTED: zinc finger protein 622               59.7    2e-08   Orycteropus afer afer
ref|XP_011308898.1|  PREDICTED: ankyrin repeat and zinc finger do...  60.5    3e-08   Fopius arisanus
ref|XP_005874550.1|  PREDICTED: zinc finger protein 622               60.1    3e-08   Myotis brandtii
ref|XP_002768113.1|  conserved hypothetical protein                   59.7    3e-08   Perkinsus marinus ATCC 50983
emb|CEP64736.1|  LALA0S13e01860g1_1                                   59.7    3e-08   Lachancea lanzarotensis
ref|XP_006895073.1|  PREDICTED: zinc finger protein 622               60.1    3e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002161600.1|  PREDICTED: zinc finger protein 622-like          59.7    3e-08   Hydra vulgaris
gb|ELU13958.1|  hypothetical protein CAPTEDRAFT_174182                59.7    3e-08   Capitella teleta
ref|XP_005356713.1|  PREDICTED: zinc finger protein 622               59.7    3e-08   Microtus ochrogaster [prairie voles]
ref|XP_003688550.1|  hypothetical protein TPHA_0O01490                59.7    3e-08   Tetrapisispora phaffii CBS 4417
gb|ERE84923.1|  zinc finger protein                                   60.1    3e-08   Cricetulus griseus [Chinese hamsters]
gb|KIO10058.1|  hypothetical protein M404DRAFT_231026                 59.7    3e-08   Pisolithus tinctorius Marx 270
gb|EEQ43875.1|  conserved hypothetical protein                        59.7    3e-08   
ref|XP_006081639.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  59.7    3e-08   
ref|XP_004583683.1|  PREDICTED: zinc finger protein 622               59.7    3e-08   
gb|KHC60052.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGU01065.1|  pre-60S factor REI1                                   59.7    3e-08   
emb|CDH48403.1|  cytoplasmic protein                                  59.7    3e-08   
gb|KGR05725.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGQ81011.1|  pre-60S factor REI1                                   59.7    3e-08   
ref|XP_005694911.1|  PREDICTED: zinc finger protein 622               59.7    3e-08   
gb|KHC28839.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGU18269.1|  pre-60S factor REI1                                   59.7    3e-08   
ref|XP_952608.1|  hypothetical protein                                59.3    3e-08   
ref|XP_716246.1|  potential zinc finger protein                       59.7    3e-08   
gb|AGO12196.1|  AaceriAEL165Cp                                        59.3    3e-08   
gb|KGQ81232.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KHC43864.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGU01824.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGU01555.1|  pre-60S factor REI1                                   59.7    3e-08   
gb|KGR01208.1|  pre-60S factor REI1                                   59.7    3e-08   
ref|XP_003680980.1|  hypothetical protein TDEL_0D01850                59.3    3e-08   
gb|EYB86221.1|  hypothetical protein Y032_0283g1324                   59.7    3e-08   
ref|XP_004181196.1|  hypothetical protein TBLA_0F01340                59.3    3e-08   
ref|XP_001200563.1|  PREDICTED: zinc finger protein 622-like          59.7    3e-08   
ref|XP_010742488.1|  PREDICTED: zinc finger protein 622               59.7    3e-08   
ref|XP_004422744.1|  PREDICTED: zinc finger protein 622               59.7    4e-08   
gb|ERE84924.1|  zinc finger protein                                   59.7    4e-08   
ref|XP_007623607.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  59.7    4e-08   
ref|XP_002815490.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_006769510.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_004203127.1|  Piso0_000727                                     59.3    4e-08   
ref|XP_002553327.1|  KLTH0D14212p                                     59.3    4e-08   
ref|XP_003219852.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_008149889.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_004059066.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_008260303.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|NP_219482.1|  zinc finger protein 622                             59.3    4e-08   
ref|XP_007959442.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
gb|EYB86217.1|  hypothetical protein Y032_0283g1324                   59.3    4e-08   
ref|XP_003310680.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_003821988.1|  PREDICTED: zinc finger protein 622               59.3    4e-08   
ref|XP_002495476.1|  ZYRO0B12254p                                     58.9    4e-08   
gb|EYB86218.1|  hypothetical protein Y032_0283g1324                   59.3    4e-08   
ref|XP_006683823.1|  hypothetical protein CANTEDRAFT_101025           58.9    4e-08   
ref|XP_003645586.1|  hypothetical protein Ecym_3276                   58.9    5e-08   
ref|XP_003263222.1|  PREDICTED: zinc finger protein 622               59.3    5e-08   
ref|XP_010354635.1|  PREDICTED: zinc finger protein 622               59.3    5e-08   
ref|XP_009206444.1|  PREDICTED: zinc finger protein 622 isoform X1    59.3    5e-08   
gb|KGU20773.1|  pre-60S factor REI1                                   58.9    5e-08   
gb|KGU21702.1|  pre-60S factor REI1                                   58.9    5e-08   
gb|KGR00963.1|  pre-60S factor REI1                                   58.9    5e-08   
ref|XP_001830498.1|  cytoplasmic protein                              58.9    5e-08   
ref|XP_003899566.1|  PREDICTED: zinc finger protein 622 isoform X2    58.9    5e-08   
ref|XP_004017190.1|  PREDICTED: zinc finger protein 622               58.9    5e-08   
ref|XP_005968236.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
gb|AAH68406.1|  Znf622 protein                                        58.9    6e-08   
emb|CDH12538.1|  related to Pre-60S factor REI1                       58.5    6e-08   
ref|XP_001917283.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_008515981.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|NP_001247620.1|  zinc finger protein 622                          58.9    6e-08   
ref|XP_006165305.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_002924578.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_006874501.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_005556671.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_006073019.1|  PREDICTED: zinc finger protein 622               58.9    6e-08   
ref|XP_007426935.1|  PREDICTED: zinc finger protein 622               58.9    7e-08   
gb|AEY96820.1|  FAEL165Cp                                             58.5    7e-08   
ref|XP_006907186.1|  PREDICTED: zinc finger protein 622               58.5    7e-08   
ref|XP_010059081.1|  PREDICTED: cytoplasmic 60S subunit biogenesi...  58.5    7e-08   
ref|NP_984696.1|  AEL165Cp                                            58.5    7e-08   
gb|EYB86220.1|  hypothetical protein Y032_0283g1324                   58.9    7e-08   
gb|EYB86219.1|  hypothetical protein Y032_0283g1324                   58.9    7e-08   
ref|XP_010857102.1|  PREDICTED: zinc finger protein 622               58.9    7e-08   
ref|XP_006928161.1|  PREDICTED: zinc finger protein 622               58.5    7e-08   
gb|KIH45555.1|  zinc finger, C2H2 type                                58.2    7e-08   
ref|XP_005898604.1|  PREDICTED: zinc finger protein 622               58.5    7e-08   
ref|NP_001029623.1|  zinc finger protein 622                          58.5    7e-08   
ref|XP_008688114.1|  PREDICTED: zinc finger protein 622               58.5    8e-08   
ref|XP_001387457.1|  zinc finger protein with unknown function        58.5    8e-08   
ref|XP_006968714.1|  predicted protein                                58.5    8e-08   
ref|XP_002498880.1|  ZYRO0G20746p                                     58.2    8e-08   
ref|XP_006981814.1|  PREDICTED: zinc finger protein 622-like          58.2    8e-08   
emb|CEP60423.1|  LALA0S01e10550g1_1                                   58.2    8e-08   
ref|XP_007092986.1|  PREDICTED: zinc finger protein 622               58.5    8e-08   
ref|XP_001634569.1|  predicted protein                                58.2    9e-08   
ref|XP_002422335.1|  zinc finger protein, putative                    58.2    9e-08   
ref|NP_001080550.1|  zinc finger protein 622                          58.5    9e-08   
ref|XP_004453979.1|  PREDICTED: zinc finger protein 622               58.2    1e-07   
ref|XP_006751222.1|  PREDICTED: zinc finger protein 622               58.2    1e-07   
dbj|BAE41831.1|  unnamed protein product                              57.4    1e-07   
ref|XP_008206746.1|  PREDICTED: zinc finger protein 622               57.0    1e-07   
ref|XP_003700140.1|  PREDICTED: zinc finger protein 622-like          57.8    1e-07   
gb|KDR13107.1|  hypothetical protein L798_13036                       57.8    1e-07   
dbj|BAO41918.1|  zinc finger protein REH1                             57.8    1e-07   
ref|XP_500651.1|  YALI0B08734p                                        57.8    1e-07   
ref|XP_003287650.1|  hypothetical protein DICPUDRAFT_91955            55.5    1e-07   
ref|XP_006981815.1|  PREDICTED: zinc finger protein 622-like          58.2    1e-07   
emb|CDK28534.1|  unnamed protein product                              57.8    1e-07   
ref|XP_004384106.1|  PREDICTED: zinc finger protein 622               58.2    1e-07   
ref|XP_006608123.1|  PREDICTED: ankyrin repeat and zinc finger do...  58.5    1e-07   
ref|XP_004408395.1|  PREDICTED: zinc finger protein 622               57.8    1e-07   
ref|XP_002556339.1|  KLTH0H10758p                                     57.8    1e-07   
dbj|BAE32946.1|  unnamed protein product                              57.8    1e-07   
ref|XP_006634511.1|  PREDICTED: zinc finger protein 622-like          57.8    1e-07   
ref|XP_002835389.1|  hypothetical protein                             57.4    1e-07   
ref|XP_447653.1|  hypothetical protein                                57.4    1e-07   
gb|EFN64724.1|  Ankyrin repeat and zinc finger domain-containing ...  58.2    2e-07   
ref|NP_653106.1|  zinc finger protein 622                             57.8    2e-07   
gb|AJP89503.1|  Rei1p                                                 57.4    2e-07   
ref|XP_002174832.1|  ribosome biogenesis protein                      57.4    2e-07   
ref|XP_005090744.1|  PREDICTED: zinc finger protein 622-like isof...  57.4    2e-07   
ref|XP_635923.1|  C2H2-type zinc finger-containing protein            57.4    2e-07   
ref|XP_789492.3|  PREDICTED: zinc finger protein 622-like             57.4    2e-07   
ref|XP_005090745.1|  PREDICTED: zinc finger protein 622-like isof...  57.4    2e-07   
ref|XP_008333285.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
ref|XP_008577870.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
ref|XP_002489668.1|  Cytoplasmic pre-60S factor                       57.4    2e-07   
ref|XP_003408198.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
ref|XP_004203710.1|  Piso0_000727                                     57.4    2e-07   
dbj|GAK65063.1|  zinc finger protein 622-like protein                 57.8    2e-07   
ref|XP_008302898.1|  PREDICTED: zinc finger protein 622               58.2    2e-07   
ref|XP_002591925.1|  hypothetical protein BRAFLDRAFT_122363           57.4    2e-07   
gb|EHK26903.1|  hypothetical protein TRIVIDRAFT_79452                 57.8    2e-07   
ref|XP_003452821.1|  PREDICTED: zinc finger protein 622-like          57.4    2e-07   
ref|XP_005746379.1|  PREDICTED: zinc finger protein 622-like isof...  57.4    2e-07   
ref|XP_004569509.1|  PREDICTED: zinc finger protein 622-like          57.4    2e-07   
gb|KGK39602.1|  hypothetical protein JL09_g1188                       57.4    2e-07   
ref|XP_005934147.1|  PREDICTED: zinc finger protein 622-like isof...  57.4    2e-07   
ref|XP_011261642.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.8    2e-07   
ref|XP_005934148.1|  PREDICTED: zinc finger protein 622-like isof...  57.4    2e-07   
ref|XP_011401820.1|  Zinc finger protein                              57.4    2e-07   
gb|EPY75340.1|  zinc finger protein 622                               57.0    2e-07   
ref|XP_007188302.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
ref|XP_004274525.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
ref|XP_004314109.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  57.4    2e-07   
ref|XP_006567709.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.8    2e-07   
ref|XP_001646586.1|  hypothetical protein Kpol_1055p85                57.4    2e-07   
ref|XP_010980281.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
gb|ETE73362.1|  Zinc finger protein                                   57.4    2e-07   
ref|XP_003672357.1|  hypothetical protein NDAI_0J02220                57.0    2e-07   
ref|XP_764670.1|  hypothetical protein                                57.0    2e-07   
ref|XP_003696594.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.8    2e-07   
ref|NP_001133295.1|  Zinc finger protein 622                          57.4    2e-07   
ref|XP_010955570.1|  PREDICTED: zinc finger protein 622               57.4    2e-07   
gb|EHK44731.1|  hypothetical protein TRIATDRAFT_318333                57.4    2e-07   
ref|XP_011261640.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.8    2e-07   
ref|XP_009047384.1|  hypothetical protein LOTGIDRAFT_238085           57.0    2e-07   
emb|CDQ66047.1|  unnamed protein product                              57.4    2e-07   
ref|XP_004678120.1|  PREDICTED: zinc finger protein 622               57.0    2e-07   
gb|KHN95938.1|  C2H2 type zinc finger containing protein              57.4    3e-07   
gb|KFH73074.1|  hypothetical protein MVEG_00299                       57.0    3e-07   
ref|XP_006192295.1|  PREDICTED: zinc finger protein 622               56.6    3e-07   
ref|XP_006190394.1|  PREDICTED: zinc finger protein 622-like          57.0    3e-07   
ref|XP_002745142.1|  PREDICTED: zinc finger protein 622               57.0    3e-07   
ref|XP_394767.2|  PREDICTED: zinc finger protein 622-like isoform 1   56.6    3e-07   
ref|XP_006616919.1|  PREDICTED: zinc finger protein 622-like          56.6    3e-07   
ref|XP_010891189.1|  PREDICTED: zinc finger protein 622               57.0    3e-07   
emb|CDF88959.1|  ZYBA0S03-05908g1_1                                   56.6    3e-07   
ref|XP_003690358.1|  PREDICTED: zinc finger protein 622-like          56.6    3e-07   
gb|EIF48949.1|  putative zinc finger protein                          56.6    3e-07   
ref|NP_001279303.1|  zinc finger protein 622                          57.0    3e-07   
ref|XP_001877316.1|  predicted protein                                56.6    3e-07   
ref|XP_008556264.1|  PREDICTED: zinc finger protein 622               56.6    3e-07   
gb|KEH41235.1|  C2H2-type zinc finger protein                         57.0    3e-07   
ref|XP_003427704.2|  PREDICTED: ankyrin repeat and zinc finger do...  54.7    3e-07   
ref|XP_006804666.1|  PREDICTED: zinc finger protein 622-like          56.6    3e-07   
ref|XP_002548780.1|  hypothetical protein CTRG_03077                  56.6    3e-07   
emb|CDI55393.1|  cytoplasmic protein                                  56.6    3e-07   
ref|XP_008212087.1|  PREDICTED: ankyrin repeat and zinc finger do...  54.7    3e-07   
ref|XP_007102404.1|  PREDICTED: zinc finger protein 622               56.6    3e-07   
ref|XP_005091111.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.0    3e-07   
ref|XP_007863917.1|  hypothetical protein GLOTRDRAFT_38020            56.6    4e-07   
ref|XP_008484842.1|  PREDICTED: zinc finger protein 622               56.2    4e-07   
ref|XP_003647484.1|  hypothetical protein Ecym_6287                   56.2    4e-07   
gb|EFX85155.1|  putative zinc finger protein                          56.2    4e-07   
gb|EJU03628.1|  hypothetical protein DACRYDRAFT_99219                 57.0    4e-07   
gb|EXX52426.1|  Reh1p                                                 56.2    4e-07   
ref|XP_003702638.1|  PREDICTED: ankyrin repeat and zinc finger do...  57.0    4e-07   
ref|XP_008046880.1|  PREDICTED: zinc finger protein 622               56.6    4e-07   
gb|KHJ32345.1|  putative c2h2 type zinc finger containing protein     56.6    4e-07   
dbj|GAN03081.1|  zinc finger protein 622-like protein                 56.2    4e-07   
ref|XP_004761265.1|  PREDICTED: zinc finger protein 622               56.2    4e-07   
gb|KIK67107.1|  hypothetical protein GYMLUDRAFT_850880                56.2    4e-07   
gb|EMG48113.1|  hypothetical protein G210_1381                        56.2    4e-07   
gb|KIY97769.1|  hypothetical protein MNEG_10192                       56.6    4e-07   
emb|CEP08407.1|  hypothetical protein                                 56.2    4e-07   
gb|ETS62591.1|  cytoplasmic protein                                   56.6    4e-07   
gb|KDO67270.1|  hypothetical protein CISIN_1g015261mg                 56.2    5e-07   
gb|AAB82362.1|  Ylr387cp                                              53.1    5e-07   
dbj|GAC74702.1|  C2H2-type Zn-finger protein                          56.2    5e-07   
gb|KEZ39501.1|  Uncharacterized protein SAPIO_CDS9367                 56.2    5e-07   
ref|XP_007448952.1|  PREDICTED: zinc finger protein 622               56.2    5e-07   
dbj|BAN20557.1|  conserved hypothetical protein                       55.8    5e-07   
gb|KFH46098.1|  Cytoplasmic 60S subunit biogenesis factor-like pr...  56.2    5e-07   
ref|XP_002955898.1|  hypothetical protein VOLCADRAFT_96796            56.2    5e-07   
emb|CAF97796.1|  unnamed protein product                              56.2    6e-07   
ref|XP_003976225.1|  PREDICTED: zinc finger protein 622-like          55.8    6e-07   
ref|XP_011341841.1|  PREDICTED: ankyrin repeat and zinc finger do...  56.2    6e-07   
ref|XP_002391275.1|  hypothetical protein MPER_09320                  53.5    6e-07   
ref|XP_002619362.1|  hypothetical protein CLUG_00521                  55.8    6e-07   
gb|EMF16302.1|  hypothetical protein SEPMUDRAFT_145588                56.2    6e-07   
ref|XP_007520611.1|  PREDICTED: zinc finger protein 622               55.8    6e-07   
gb|EME49683.1|  hypothetical protein DOTSEDRAFT_68453                 56.2    6e-07   
emb|CEJ94662.1|  Putative Rei1p                                       55.8    6e-07   
ref|XP_011063459.1|  PREDICTED: ankyrin repeat and zinc finger do...  56.2    7e-07   
ref|XP_003942957.1|  PREDICTED: zinc finger protein 622               55.8    7e-07   
gb|EKC21927.1|  hypothetical protein CGI_10003071                     55.5    7e-07   
gb|EPB85511.1|  hypothetical protein HMPREF1544_07694                 55.5    7e-07   
gb|KEQ98353.1|  hypothetical protein AUEXF2481DRAFT_36864             55.8    7e-07   
gb|KDQ57570.1|  hypothetical protein JAAARDRAFT_130649                55.8    7e-07   
ref|XP_973525.1|  PREDICTED: zinc finger protein 622                  55.5    7e-07   
gb|KDO38064.1|  hypothetical protein CISIN_1g042126mg                 55.5    7e-07   
ref|NP_001274046.1|  zinc finger protein 622                          55.8    7e-07   
ref|XP_011063458.1|  PREDICTED: ankyrin repeat and zinc finger do...  56.2    7e-07   
gb|AJQ00264.1|  Rei1p                                                 55.5    8e-07   
ref|XP_003955170.1|  hypothetical protein KAFR_0A06000                55.5    8e-07   
gb|KIK03531.1|  hypothetical protein K443DRAFT_94942                  55.5    8e-07   
ref|XP_011415469.1|  PREDICTED: zinc finger protein 622-like isof...  55.5    8e-07   
gb|EER41616.1|  zinc finger protein                                   55.5    8e-07   
gb|EKC21925.1|  hypothetical protein CGI_10003069                     55.5    8e-07   
gb|KEQ60198.1|  hypothetical protein M437DRAFT_55327                  55.8    8e-07   
ref|XP_001538262.1|  predicted protein                                55.5    9e-07   



>ref|XP_007161307.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
 gb|ESW33301.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
Length=413

 Score =   143 bits (360),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA+EK K
Sbjct  1    MPGLTCNACNAEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAQEKNK  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_003550140.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
 ref|XP_006601093.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=407

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLYTCG
Sbjct  61   LGETPMLYTCG  71



>gb|KHN31608.1| Zinc finger protein [Glycine soja]
Length=407

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLYTCG
Sbjct  61   LGETPMLYTCG  71



>ref|XP_010049815.1| PREDICTED: zinc finger protein 622 [Eucalyptus grandis]
 gb|KCW82616.1| hypothetical protein EUGRSUZ_C04005 [Eucalyptus grandis]
Length=414

 Score =   142 bits (358),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF+DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A+EKKK
Sbjct  1    MPGLTCNACNKEFEDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAQEKKK  60

Query  228  LTETPMLYTCG  260
             ++TPMLY+CG
Sbjct  61   SSQTPMLYSCG  71



>ref|XP_003538077.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
Length=407

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLY+CG
Sbjct  61   LGETPMLYSCG  71



>ref|XP_003550141.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN +FKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTKFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLYTCG
Sbjct  61   LGETPMLYTCG  71



>gb|KHN13054.1| Zinc finger protein [Glycine soja]
Length=405

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN +FKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTKFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLYTCG
Sbjct  61   LGETPMLYTCG  71



>ref|XP_007011584.1| Zinc finger protein 622 isoform 3 [Theobroma cacao]
 gb|EOY29203.1| Zinc finger protein 622 isoform 3 [Theobroma cacao]
Length=286

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEFKDDAEQKLHY+S+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK K
Sbjct  1    MPGLTCNACNKEFKDDAEQKLHYRSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   RNETPMLYSCG  71



>ref|XP_003538078.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLY CG
Sbjct  61   LGETPMLYCCG  71



>gb|KHN13053.1| Zinc finger protein 622 [Glycine soja]
Length=346

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKDD EQKLHYK EWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKPEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLY CG
Sbjct  61   LGETPMLYCCG  71



>gb|KJB55203.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=237

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>ref|XP_007011582.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 ref|XP_007011583.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29201.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29202.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
Length=407

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEFKDDAEQKLHY+S+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK K
Sbjct  1    MPGLTCNACNKEFKDDAEQKLHYRSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   RNETPMLYSCG  71



>ref|XP_010265409.1| PREDICTED: zinc finger protein 622 [Nelumbo nucifera]
Length=404

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DD +QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS +AEE+ K
Sbjct  1    MPGLTCNACNKEFGDDLQQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSALAEEQNK  60

Query  228  LTETPMLYTCG  260
            L ETPMLY+CG
Sbjct  61   LNETPMLYSCG  71



>gb|KJB55202.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=311

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>gb|KJB55201.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
 gb|KJB55205.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=407

 Score =   137 bits (344),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>emb|CDP12462.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   136 bits (342),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF+D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE L+LARQS +AEEKK 
Sbjct  1    MPGLTCNACNKEFQDEIEQKLHYKSEWHRYNLKRKVAGVPGVTEDLYLARQSALAEEKKN  60

Query  228  LTETPMLYTCG  260
            L ETPMLY+CG
Sbjct  61   LNETPMLYSCG  71



>emb|CDP12454.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   137 bits (344),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF+D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE L+LARQS +AEEKK 
Sbjct  1    MPGLTCNACNKEFQDEIEQKLHYKSEWHRYNLKRKVAGVPGVTEDLYLARQSALAEEKKN  60

Query  228  LTETPMLYTCG  260
            L ETPMLY+CG
Sbjct  61   LNETPMLYSCG  71



>ref|XP_011082078.1| PREDICTED: zinc finger protein 622 [Sesamum indicum]
Length=411

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE LFLARQS +AEE++K
Sbjct  1    MPGLTCNACNKEFVDEVEQKLHYKSEWHRYNLKRKVAGVPGVTETLFLARQSALAEERRK  60

Query  228  LTETPMLYTCG  260
            L ETPM+Y+CG
Sbjct  61   LDETPMVYSCG  71



>gb|KHG19598.1| Zinc finger protein [Gossypium arboreum]
Length=407

 Score =   135 bits (340),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGV EALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVMEALFLARQSALAQEKEK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>ref|XP_008219929.1| PREDICTED: zinc finger protein 622 [Prunus mume]
Length=408

 Score =   134 bits (337),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKE  DDAEQKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQ  +A+EK  
Sbjct  1    MPGLTCNACNKELADDAEQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQDALAQEKNG  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_007222754.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
 gb|EMJ23953.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
Length=408

 Score =   134 bits (336),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKE  DDAEQKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQ  +A+EK  
Sbjct  1    MPGLTCNACNKELVDDAEQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQDALAQEKNG  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_010102859.1| Zinc finger protein [Morus notabilis]
 ref|XP_010111936.1| Zinc finger protein [Morus notabilis]
 gb|EXB94240.1| Zinc finger protein [Morus notabilis]
 gb|EXC32054.1| Zinc finger protein [Morus notabilis]
Length=410

 Score =   134 bits (336),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DD+E KLHYKSEWHRYNLKRKVA VPGVTEALFL RQS +A+EK K
Sbjct  1    MPGLTCNACNKEFTDDSELKLHYKSEWHRYNLKRKVADVPGVTEALFLTRQSALAQEKNK  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_011031356.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFDDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  228  LTETPMLYTC  257
              ETPMLY+C
Sbjct  61   -NETPMLYSC  69



>ref|XP_006382168.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP59965.1| zinc finger family protein [Populus trichocarpa]
Length=408

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFDDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  228  LTETPMLYTC  257
              ETPMLY+C
Sbjct  61   -NETPMLYSC  69



>ref|XP_009338830.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   133 bits (334),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNS  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>gb|KDP33442.1| hypothetical protein JCGZ_07013 [Jatropha curcas]
Length=408

 Score =   133 bits (334),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEFKDD EQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK  
Sbjct  1    MPGLTCNACNKEFKDDTEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDN  60

Query  228  LTETPMLYTC  257
              E+PMLY+C
Sbjct  61   SNESPMLYSC  70



>ref|XP_009368013.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   132 bits (333),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNN  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_009363611.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   132 bits (333),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNN  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_002527963.1| transcription factor, putative [Ricinus communis]
 gb|EEF34375.1| transcription factor, putative [Ricinus communis]
Length=407

 Score =   132 bits (333),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQSV+ +EK K
Sbjct  1    MGGLTCNACNKEFNDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSVLVQEKDK  60

Query  228  LTETPMLYTC  257
             +ETPMLY+C
Sbjct  61   SSETPMLYSC  70



>gb|AFK41799.1| unknown [Lotus japonicus]
Length=410

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNTEFIDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ET MLY+CG
Sbjct  61   ANETAMLYSCG  71



>gb|KJB06568.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=390

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>ref|XP_008352169.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=434

 Score =   132 bits (333),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRK+AGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKIAGVPGVTEALFIARQAALAQEKNS  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>gb|KJB06566.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=392

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>gb|AFK42392.1| unknown [Lotus japonicus]
Length=410

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNTEFIDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ET MLY+CG
Sbjct  61   ANETAMLYSCG  71



>gb|KHG15736.1| Zinc finger protein [Gossypium arboreum]
Length=372

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQTALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>gb|KHG15735.1| Zinc finger protein [Gossypium arboreum]
Length=392

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQTALAEEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   QNETPMLYSCG  71



>ref|XP_004498584.1| PREDICTED: zinc finger protein 622-like [Cicer arietinum]
Length=410

 Score =   132 bits (331),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGL+CNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS +A EK K
Sbjct  1    MPGLSCNACNTEFNDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSALALEKDK  60

Query  228  LTETPMLYTCG  260
              ETPMLY+CG
Sbjct  61   SNETPMLYSCG  71



>ref|NP_001280881.1| zinc finger protein 622 [Malus domestica]
 gb|ADL36644.1| C2H2L domain class transcription factor [Malus domestica]
Length=405

 Score =   132 bits (331),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRK+AGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKIAGVPGVTEALFIARQAALAQEKNS  60

Query  228  LTETPMLYTCG  260
            L+ETPMLY+CG
Sbjct  61   LSETPMLYSCG  71



>ref|XP_004253056.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=415

 Score =   131 bits (330),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNAC+KEF DD EQKLHYKSEWHRYNLKRKVAGVPGV E +FLARQ+ +AEEK+K
Sbjct  1    MPGLTCNACDKEFVDDTEQKLHYKSEWHRYNLKRKVAGVPGVRETIFLARQAALAEEKEK  60

Query  228  LTETPMLYTCG  260
            L+ETP+LY CG
Sbjct  61   LSETPLLYACG  71



>ref|XP_010668047.1| PREDICTED: zinc finger protein 622 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   131 bits (329),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DD +QKLHYKSEWHRYNLKRK+AGVPGVTEAL+LARQS + EEK+K
Sbjct  1    MPGLTCNACNKEFTDDFDQKLHYKSEWHRYNLKRKIAGVPGVTEALYLARQSALDEEKEK  60

Query  228  LTETPMLYTCG  260
            L   PMLY+CG
Sbjct  61   LNAAPMLYSCG  71



>ref|XP_006342459.1| PREDICTED: zinc finger protein 622-like [Solanum tuberosum]
Length=414

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRKVAGVPGV E +FLARQ+ +AEEK+K
Sbjct  1    MPGLSCNACDKEFVDDTEQKLHYKSEWHRYNLKRKVAGVPGVRETIFLARQAALAEEKEK  60

Query  228  LTETPMLYTCG  260
            L+ETP+LY CG
Sbjct  61   LSETPLLYACG  71



>ref|XP_002324955.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF03520.2| zinc finger family protein [Populus trichocarpa]
Length=407

 Score =   130 bits (328),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFNDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  228  LTETPMLYTC  257
              E PMLY+C
Sbjct  61   -NEIPMLYSC  69



>ref|XP_008378248.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=405

 Score =   130 bits (328),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNG  60

Query  228  LTETPMLYTCG  260
            L+E PMLY+CG
Sbjct  61   LSEXPMLYSCG  71



>ref|XP_010914164.1| PREDICTED: zinc finger protein 622-like [Elaeis guineensis]
Length=418

 Score =   129 bits (325),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP LTCNACNKEF D+ EQKLHY+SEWHRYNLKRKVAGVPGVTEALF ARQS +AEE+ K
Sbjct  1    MPVLTCNACNKEFHDEVEQKLHYRSEWHRYNLKRKVAGVPGVTEALFQARQSALAEERNK  60

Query  228  LTETPMLYTCG  260
            L+ TPMLY+C 
Sbjct  61   LSATPMLYSCA  71



>gb|EYU22071.1| hypothetical protein MIMGU_mgv1a007393mg [Erythranthe guttata]
Length=409

 Score =   129 bits (324),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF DD +QKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQS IAEE+  
Sbjct  1    MPGLTCNACNTEFLDDVDQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQSAIAEERGN  60

Query  228  LTETPMLYTCG  260
            L  TPM+Y+CG
Sbjct  61   LNVTPMMYSCG  71



>ref|XP_009800477.1| PREDICTED: zinc finger protein 622-like [Nicotiana sylvestris]
Length=415

 Score =   129 bits (324),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRK+AGV GV E +FLARQS +AEEKKK
Sbjct  1    MPGLSCNACDKEFLDDTEQKLHYKSEWHRYNLKRKIAGVHGVREHIFLARQSALAEEKKK  60

Query  228  LTETPMLYTCG  260
            L+ETP++Y+CG
Sbjct  61   LSETPLIYSCG  71



>gb|KDO67269.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=233

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  228  LTETPMLYTCG  260
               TPM Y+CG
Sbjct  61   -NATPMTYSCG  70



>ref|XP_009616044.1| PREDICTED: zinc finger protein 622 [Nicotiana tomentosiformis]
Length=415

 Score =   128 bits (322),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRK+AGV GV E +FLARQS +AEEKKK
Sbjct  1    MPGLSCNACDKEFLDDTEQKLHYKSEWHRYNLKRKIAGVHGVREHIFLARQSALAEEKKK  60

Query  228  LTETPMLYTCG  260
            L+ETP++Y+CG
Sbjct  61   LSETPLIYSCG  71



>ref|XP_010417208.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=401

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   AVEAPMLYTCG  71



>ref|XP_010429428.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=404

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   AVEAPMLYTCG  71



>ref|XP_010472458.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=403

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   AVEAPMLYTCG  71



>ref|XP_006450152.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 ref|XP_006483574.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
 gb|ESR63392.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 gb|KDO67267.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=410

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  228  LTETPMLYTCG  260
               TPM Y+CG
Sbjct  61   -NATPMTYSCG  70



>gb|KDO67268.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=327

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  228  LTETPMLYTCG  260
               TPM Y+CG
Sbjct  61   -NATPMTYSCG  70



>ref|NP_180026.1| zinc finger domain protein REI1-LIKE 2 [Arabidopsis thaliana]
 gb|AAD25324.1|AF095588_1 C2H2 zinc finger protein FZF [Arabidopsis thaliana]
 gb|AAD18121.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAL32698.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM48014.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC07585.1| C2H2 zinc finger protein FZF [Arabidopsis thaliana]
Length=395

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNK+F+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKDFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLY+CG
Sbjct  61   AVEAPMLYSCG  71



>emb|CAA16545.1| putative zinc finger protein [Arabidopsis thaliana]
 emb|CAB79860.1| putative zinc finger protein [Arabidopsis thaliana]
Length=433

 Score =   126 bits (316),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  42   EEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK  221
            E+MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK
Sbjct  21   EKMPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEK  80

Query  222  KKLTETPMLYTCG  260
             K  E PMLYTC 
Sbjct  81   NKSNEAPMLYTCA  93



>ref|XP_002880589.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56848.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M  L CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSALACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   AVEAPMLYTCG  71



>ref|XP_006293479.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
 gb|EOA26377.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
Length=401

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E PMLY+CG
Sbjct  61   AVEAPMLYSCG  71



>ref|XP_009117121.1| PREDICTED: zinc finger protein 622-like [Brassica rapa]
Length=400

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ +A+E+ K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQAALAQERIK  60

Query  228  LTETPMLYTCG  260
              E P+LYTCG
Sbjct  61   SVEAPLLYTCG  71



>ref|XP_006404984.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
 dbj|BAJ34463.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46437.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
Length=403

 Score =   125 bits (315),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  228  LTETPMLYTCG  260
              E P+LY+CG
Sbjct  61   SNEAPLLYSCG  71



>emb|CDY34766.1| BnaA09g41330D [Brassica napus]
Length=400

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF AR++ +A+E+ K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFDAREAALAQERIK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SVEAPMLYTCG  71



>ref|NP_567875.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AAN12920.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AEE85908.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=404

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLYTC 
Sbjct  61   SNEAPMLYTCA  71



>ref|NP_974652.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AEE85909.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=405

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLYTC 
Sbjct  61   SNEAPMLYTCA  71



>gb|AAK44084.1|AF370269_1 putative zinc finger protein [Arabidopsis thaliana]
Length=404

 Score =   124 bits (312),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFGARQSALAQEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLYTC 
Sbjct  61   SNEAPMLYTCA  71



>ref|XP_008794317.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776891.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=418

 Score =   125 bits (313),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP LTCNACNKEF+D+ EQKLHY+SEWHRYNLKRKVAGVPGVTEALF ARQS +AEE+ +
Sbjct  1    MPVLTCNACNKEFQDEVEQKLHYRSEWHRYNLKRKVAGVPGVTEALFQARQSALAEERNQ  60

Query  228  LTETPMLYTCG  260
            L+ T MLY C 
Sbjct  61   LSATAMLYGCA  71



>ref|XP_002867303.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43562.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SNEAPMLYTCG  71



>gb|KEH39759.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=408

 Score =   124 bits (312),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCN+CN EF  DA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A+E+ K
Sbjct  1    MSGLTCNSCNTEFTHDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAQERDK  60

Query  228  LTETPMLYTCG  260
              E+PMLY+CG
Sbjct  61   SNESPMLYSCG  71



>gb|KFK32629.1| hypothetical protein AALP_AA6G268300 [Arabis alpina]
Length=403

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLT  233
            GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K  
Sbjct  5    GLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVKAI  64

Query  234  ETPMLYTCG  260
            E PMLY+CG
Sbjct  65   EAPMLYSCG  73



>ref|XP_011045006.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score =   124 bits (312),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACNKEF D+AEQKLHYKSEWHRYNLKRKVAGVPGV+EALF+ARQS I +EK+K
Sbjct  1    MPGLTCNACNKEFNDEAEQKLHYKSEWHRYNLKRKVAGVPGVSEALFVARQSAIDKEKEK  60

Query  228  LTETPMLYTC  257
              E PM Y+C
Sbjct  61   -NEIPMFYSC  69



>gb|EPS72142.1| hypothetical protein M569_02614 [Genlisea aurea]
Length=383

 Score =   124 bits (311),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GLTCNACNKE  D+ EQ++HYKSEWHRYNLKRKVAGVPGVTE LF ARQS +A+EK K
Sbjct  1    MAGLTCNACNKELADEVEQRIHYKSEWHRYNLKRKVAGVPGVTEVLFQARQSALADEKGK  60

Query  228  LTETPMLYTCG  260
            L + PMLY CG
Sbjct  61   LDQAPMLYACG  71



>ref|XP_009140559.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=407

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKEFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  228  LTETPMLYTCG  260
              E P+LYTCG
Sbjct  61   SNEAPLLYTCG  71



>emb|CDY20320.1| BnaC04g36360D [Brassica napus]
Length=399

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNKEF+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKEFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  228  LTETPMLYTCG  260
              E P+LYTCG
Sbjct  61   SNEAPLLYTCG  71



>ref|XP_004291236.1| PREDICTED: zinc finger protein 622 [Fragaria vesca subsp. vesca]
Length=408

 Score =   124 bits (310),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CNACNKE KDDAEQ+LHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A EK  
Sbjct  1    MSGLACNACNKELKDDAEQRLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAMEKNG  60

Query  228  LTETPMLYTCG  260
               TPMLY+C 
Sbjct  61   ANATPMLYSCA  71



>emb|CAN62771.1| hypothetical protein VITISV_027109 [Vitis vinifera]
Length=374

 Score =   123 bits (309),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M  LTCNACNKEF  ++EQKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESEQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  228  LTETPMLYTC  257
            L ETPMLY+C
Sbjct  61   LNETPMLYSC  70



>ref|XP_006412594.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
 dbj|BAJ34316.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54047.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
Length=402

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTE LF ARQS +A+E  K
Sbjct  1    MPGLTCNACNMEFDDEAERKLHYKSDWHRYNLKRKVAGVPGVTEELFEARQSALAQENGK  60

Query  228  LTETPMLYTCG  260
              E PMLY+CG
Sbjct  61   SDEAPMLYSCG  71



>ref|XP_010525877.1| PREDICTED: zinc finger protein 622 [Tarenaya hassleriana]
Length=410

 Score =   123 bits (308),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN+EF  DAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS I ++K  
Sbjct  1    MPGLTCNACNQEFNGDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSAIVQQKSS  60

Query  228  LTETPMLYTCG  260
              E+P+LY+CG
Sbjct  61   -DESPLLYSCG  70



>emb|CDY46155.1| BnaA04g14430D [Brassica napus]
Length=399

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CN+CNK+F+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKDFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  228  LTETPMLYTCG  260
              E P+LYTCG
Sbjct  61   SNEAPLLYTCG  71



>ref|XP_006483736.1| PREDICTED: zinc finger protein 622-like, partial [Citrus sinensis]
Length=419

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            +PGLTCNACN+EF DDAE+KLHYKS+W+RYNLKRKVAGVPGVTEALFLARQ+ +A+E K 
Sbjct  10   LPGLTCNACNREFNDDAEKKLHYKSDWYRYNLKRKVAGVPGVTEALFLARQAALAQE-KN  68

Query  228  LTETPMLYTCG  260
              ETPM Y+CG
Sbjct  69   TNETPMTYSCG  79



>emb|CBI20772.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M  LTCNACNKEF  +++QKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESDQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  228  LTETPMLYTC  257
            L ETPMLY+C
Sbjct  61   LNETPMLYSC  70



>ref|XP_002282746.1| PREDICTED: zinc finger protein 622 [Vitis vinifera]
Length=411

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M  LTCNACNKEF  +++QKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESDQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  228  LTETPMLYTC  257
            L ETPMLY+C
Sbjct  61   LNETPMLYSC  70



>ref|XP_004171115.1| PREDICTED: zinc finger protein 622-like, partial [Cucumis sativus]
Length=172

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  224
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  225  KLTETPMLYTCG  260
            K  E  MLY+CG
Sbjct  61   KSRENSMLYSCG  72



>gb|KFK29727.1| hypothetical protein AALP_AA7G170800 [Arabis alpina]
Length=399

 Score =   121 bits (304),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF+D+AE+  HYKS+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFEDEAERGFHYKSDWHRYNLKRKVAGVPGVTEELFEARQSALASEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SDEVPMLYTCG  71



>emb|CDX68744.1| BnaC01g07090D [Brassica napus]
Length=403

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF+++AE+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENEAERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SDEAPMLYTCG  71



>ref|XP_009126994.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=395

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF+++AE+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENEAERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SDEAPMLYTCG  71



>ref|XP_009769243.1| PREDICTED: LOW QUALITY PROTEIN: cytoplasmic 60S subunit biogenesis 
factor SPCC550.15c [Nicotiana sylvestris]
Length=412

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CNACNKEF  + EQKLHYKSEWH YNLKRKVAGVPG+TEALF+ARQS +AEE ++
Sbjct  1    MRGLACNACNKEFFYENEQKLHYKSEWHHYNLKRKVAGVPGLTEALFIARQSALAEENRR  60

Query  228  LTETPMLYTCG  260
            L+ETP+LY+CG
Sbjct  61   LSETPLLYSCG  71



>emb|CDY28267.1| BnaA01g05820D [Brassica napus]
Length=395

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EF++++E+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENESERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  228  LTETPMLYTCG  260
              E PMLYTCG
Sbjct  61   SDEAPMLYTCG  71



>ref|XP_009406616.1| PREDICTED: zinc finger protein 622-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP L CNACNK F D+A+QKLHY+SEWHRYNLKRKVAGVPGVTE LF ARQ  +AEE+ K
Sbjct  1    MPVLMCNACNKGFDDEAQQKLHYRSEWHRYNLKRKVAGVPGVTEELFQARQLALAEERSK  60

Query  228  LTETPMLYTCG  260
            L+ TPMLY C 
Sbjct  61   LSATPMLYGCA  71



>ref|XP_006845651.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
 gb|ERN07326.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
Length=403

 Score =   118 bits (296),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP  TCNACN EF+DDA+QK+HYKSEWHRYNLKRKVAG+PGVTEALF AR S +A+E+ +
Sbjct  1    MPAFTCNACNTEFEDDAQQKIHYKSEWHRYNLKRKVAGIPGVTEALFQARLSALADERTR  60

Query  228  LTETPMLYTCG  260
            L +T M+Y+C 
Sbjct  61   LDQTRMIYSCA  71



>ref|XP_006283853.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
 gb|EOA16751.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
Length=403

 Score =   118 bits (296),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +  EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALDLEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLY+C 
Sbjct  61   SNEAPMLYSCA  71



>ref|XP_009618306.1| PREDICTED: zinc finger protein 622-like [Nicotiana tomentosiformis]
Length=416

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 4/75 (5%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV----IAE  215
            M GL CNACNKEF D+ EQKLHYKSEWHRYNLKRKVA VPG+TEALF+ARQS     +AE
Sbjct  1    MRGLACNACNKEFFDENEQKLHYKSEWHRYNLKRKVARVPGLTEALFVARQSALAEELAE  60

Query  216  EKKKLTETPMLYTCG  260
            E ++L+ETP+LY+CG
Sbjct  61   ENRRLSETPVLYSCG  75



>ref|XP_004136315.1| PREDICTED: zinc finger protein 622-like [Cucumis sativus]
 gb|KGN60160.1| hypothetical protein Csa_3G881730 [Cucumis sativus]
Length=395

 Score =   117 bits (292),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/72 (79%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  224
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  225  KLTETPMLYTCG  260
            K  E  MLY+CG
Sbjct  61   KSRENSMLYSCG  72



>ref|XP_008466318.1| PREDICTED: zinc finger protein 622 [Cucumis melo]
Length=393

 Score =   116 bits (291),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  224
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  225  KLTETPMLYTC  257
            K  ET MLY+C
Sbjct  61   KSRETAMLYSC  71



>emb|CDX76808.1| BnaC08g33940D [Brassica napus]
Length=319

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  242
            CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+ GVPGVTE LF ARQ+ +A+E+ K  E P
Sbjct  2    CNSCNKEFEDDAEQKLHYKSEWHRYNLKRKITGVPGVTEGLFDARQAALAQERIKSFEAP  61

Query  243  MLYTCG  260
            +LYTCG
Sbjct  62   LLYTCG  67



>ref|XP_010438043.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=407

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN CN EF+ + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFEGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLY+C 
Sbjct  61   SNEAPMLYSCA  71



>ref|XP_010447561.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN CN EF  + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFDGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLY+C 
Sbjct  61   SNEAPMLYSCA  71



>ref|XP_010432868.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MPGLTCN CN EF  + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFDGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  228  LTETPMLYTCG  260
              E PMLY+C 
Sbjct  61   SNEAPMLYSCA  71



>gb|ABK25050.1| unknown [Picea sitchensis]
Length=420

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP LTCNACN EF ++A QK HYKSEWHRYNL+RKVAGVPGVTEALF ARQ  +AEE+K+
Sbjct  1    MPILTCNACNAEFNEEAAQKFHYKSEWHRYNLRRKVAGVPGVTEALFQARQQALAEEQKR  60

Query  228  LTETPMLYTC  257
            L    MLY+C
Sbjct  61   LESNRMLYSC  70



>ref|XP_002437507.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
 gb|EER88874.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
Length=404

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNTGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  228  LTETPMLYTCG  260
             + TPMLY+C 
Sbjct  61   AS-TPMLYSCA  70



>ref|XP_004966161.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=405

 Score =   111 bits (278),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  228  LTETPMLYTCG  260
             + TPMLY+C 
Sbjct  61   AS-TPMLYSCA  70



>ref|XP_006656412.1| PREDICTED: zinc finger protein 622-like [Oryza brachyantha]
Length=398

 Score =   110 bits (276),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+V+AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTVLAEGSNS  60

Query  228  LTETPMLYTCG  260
               TPMLY+C 
Sbjct  61   -DSTPMLYSCA  70



>dbj|BAK05098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   110 bits (276),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F+++ EQ+LHY+SEWHRYNLKRKVAGVPGVTEALF+ARQ+V+AE    
Sbjct  1    MPTVTCNACNAAFEEEEEQRLHYRSEWHRYNLKRKVAGVPGVTEALFIARQTVLAEGSNS  60

Query  228  LTETPMLYTCG  260
                PM Y+C 
Sbjct  61   TIAPPMSYSCA  71



>ref|NP_001151247.1| LOC100284880 [Zea mays]
 gb|ACG42118.1| zinc finger protein 622 [Zea mays]
 gb|ACR38026.1| unknown [Zea mays]
 gb|AFW69246.1| Zinc finger protein 622 [Zea mays]
Length=404

 Score =   110 bits (276),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  228  LTETPMLYTCG  260
             + TPMLY+C 
Sbjct  61   AS-TPMLYSCA  70



>gb|EEC81236.1| hypothetical protein OsI_24290 [Oryza sativa Indica Group]
Length=358

 Score =   108 bits (271),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTALAEGSNS  60

Query  228  LTETPMLYTCG  260
               TPMLY+C 
Sbjct  61   -DSTPMLYSCA  70



>ref|NP_001058435.1| Os06g0693500 [Oryza sativa Japonica Group]
 dbj|BAD53867.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF20349.1| Os06g0693500 [Oryza sativa Japonica Group]
 gb|EAZ38119.1| hypothetical protein OsJ_22468 [Oryza sativa Japonica Group]
 dbj|BAG95937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=399

 Score =   108 bits (271),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTALAEGSNS  60

Query  228  LTETPMLYTCG  260
               TPMLY+C 
Sbjct  61   -DSTPMLYSCA  70



>ref|XP_003563458.1| PREDICTED: zinc finger protein 622 [Brachypodium distachyon]
Length=402

 Score =   105 bits (263),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP LTCNACN  F+++ EQ+LHY+SEWHRYNLKRKVAGVPGVTEALF+ARQ+ +AE    
Sbjct  1    MPTLTCNACNAAFEEEEEQRLHYRSEWHRYNLKRKVAGVPGVTEALFMARQTALAEGTNS  60

Query  228  LTETPMLYTCG  260
             +  PM Y+C 
Sbjct  61   AS-APMSYSCA  70



>ref|XP_004244493.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=311

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 7/70 (10%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M  L CN CNKEF D+ EQK+HYKSEWH YNLKRKVAGVPG+TEAL+ ARQS        
Sbjct  1    MKSLICNCCNKEFFDENEQKIHYKSEWHTYNLKRKVAGVPGLTEALYKARQSA-------  53

Query  228  LTETPMLYTC  257
            L ETP+LY+C
Sbjct  54   LLETPLLYSC  63



>ref|XP_010929264.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622-like 
[Elaeis guineensis]
Length=411

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP LTCNACNKEF+D+AEQKLH +S+WHR+NLKR+  G+P VTEALF +R S +AE++ K
Sbjct  1    MPVLTCNACNKEFQDEAEQKLHCRSQWHRFNLKRQAVGLPRVTEALFQSRPSELAEKRSK  60

Query  228  LTETPMLYTCG  260
             +   +LY C 
Sbjct  61   SSAATLLYGCA  71



>ref|XP_002437508.1| hypothetical protein SORBIDRAFT_10g028310 [Sorghum bicolor]
 gb|EER88875.1| hypothetical protein SORBIDRAFT_10g028310 [Sorghum bicolor]
Length=216

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 5/70 (7%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            MP  TCNACN  F DD ++++HY+SEWHR+NLKRKVAGVPGVTEALF A ++ ++     
Sbjct  1    MPTTTCNACNVVFFDDEQKRIHYRSEWHRFNLKRKVAGVPGVTEALFRAWEAALSAGT--  58

Query  228  LTETPMLYTC  257
               TP LYTC
Sbjct  59   ---TPTLYTC  65



>ref|XP_004966160.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=360

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M   TCNACN  F DD +++LHY+S+WH +NLKRKVAGVPGVTEALFLA Q+ +  E   
Sbjct  1    MATATCNACNVRFVDDEQKRLHYRSDWHCFNLKRKVAGVPGVTEALFLAWQAALG-EGST  59

Query  228  LTETPMLYTCG  260
            LT TP+ Y C 
Sbjct  60   LTGTPIQYGCA  70



>ref|XP_001753134.1| predicted protein [Physcomitrella patens]
 gb|EDQ82175.1| predicted protein [Physcomitrella patens]
Length=398

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M GL CNACN+ F D+  QK HYK+EWHRYNL+RKVAGVPGVTEALF  R   +  EK K
Sbjct  1    MRGLACNACNETFADEETQKKHYKTEWHRYNLRRKVAGVPGVTEALFNLRIEALEAEKSK  60

Query  228  LTETPMLYTCG  260
                 +LY C 
Sbjct  61   KEGARLLYKCA  71



>emb|CDX73317.1| BnaC05g27890D [Brassica napus]
Length=211

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  99   EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTC  257
            E+KLHY S+WH YNLKRKVAG PGVTE LF ARQS +A EK K  E PMLYTC
Sbjct  11   ERKLHYSSDWHSYNLKRKVAGAPGVTEELFEARQSALAMEKGKSDEKPMLYTC  63



>emb|CDX80697.1| BnaC08g05310D [Brassica napus]
Length=185

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  99   EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTC  257
            E+KLHY S+WH YNLKRKVAG PGVTE LF A+QS +A EK K  E PMLYTC
Sbjct  74   ERKLHYSSDWHSYNLKRKVAGAPGVTEELFEAKQSALAMEKGKSDERPMLYTC  126



>ref|XP_002985761.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
 gb|EFJ13339.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
Length=394

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  63   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  242
            CNACN +  D+ EQ+ HY+SEWHR+NLKRKVAG+PGV+E LF  R  ++A EK    E  
Sbjct  4    CNACNADL-DEGEQRAHYRSEWHRHNLKRKVAGIPGVSEKLFNLRLELLAAEKNT-QEAR  61

Query  243  MLYTCG  260
            M+YTC 
Sbjct  62   MIYTCA  67



>ref|XP_002974456.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
 gb|EFJ24678.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
Length=398

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  63   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  242
            CNACN +  D+ EQ+ HY+SEWHR+NLKRKVAG+PGV+E LF  R  ++A EK    E  
Sbjct  4    CNACNADL-DEGEQRAHYRSEWHRHNLKRKVAGIPGVSEKLFNLRLELLAAEKNT-QEAR  61

Query  243  MLYTCG  260
            M+YTC 
Sbjct  62   MIYTCA  67



>ref|XP_006591049.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=347

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVA  158
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRK +
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKAS  37



>ref|XP_010149978.1| PREDICTED: zinc finger protein 622 [Eurypyga helias]
 gb|KFV93343.1| Zinc finger protein 622 [Eurypyga helias]
Length=342

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q V+AEE
Sbjct  1    MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRVVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009961992.1| PREDICTED: zinc finger protein 622, partial [Tyto alba]
Length=202

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFV39278.1| Zinc finger protein 622, partial [Tyto alba]
Length=205

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009907485.1| PREDICTED: zinc finger protein 622 [Picoides pubescens]
 gb|KFV76561.1| Zinc finger protein 622 [Picoides pubescens]
Length=468

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C+  FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCHVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009955918.1| PREDICTED: zinc finger protein 622 [Leptosomus discolor]
 gb|KFQ15286.1| Zinc finger protein 622 [Leptosomus discolor]
Length=469

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q+ IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQTAIAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|EOB07815.1| Zinc finger protein 622, partial [Anas platyrhynchos]
Length=469

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            K K+T T
Sbjct  61   KNKVTAT  67



>ref|XP_010084783.1| PREDICTED: zinc finger protein 622 [Pterocles gutturalis]
 gb|KFU97200.1| Zinc finger protein 622 [Pterocles gutturalis]
Length=469

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAIAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|EJW74120.1| hypothetical protein WUBG_14972 [Wuchereria bancrofti]
Length=89

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +3

Query  54   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            GLTC  C   F ++  Q+ HYK++WHRYNLKRK+ G P VTE  F   Q VIA +KK
Sbjct  6    GLTCLCCQSMFANNDLQREHYKTDWHRYNLKRKITGFPIVTEEQF--GQKVIAYKKK  60



>ref|XP_009882040.1| PREDICTED: zinc finger protein 622 [Charadrius vociferus]
 gb|KGL92229.1| Zinc finger protein 622 [Charadrius vociferus]
Length=469

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAIAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005041707.1| PREDICTED: zinc finger protein 622 isoform X1 [Ficedula albicollis]
 ref|XP_005041708.1| PREDICTED: zinc finger protein 622 isoform X2 [Ficedula albicollis]
Length=474

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010175401.1| PREDICTED: zinc finger protein 622 [Caprimulgus carolinensis]
 gb|KFZ45703.1| Zinc finger protein 622 [Caprimulgus carolinensis]
Length=469

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005484357.1| PREDICTED: zinc finger protein 622 [Zonotrichia albicollis]
Length=470

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005422625.1| PREDICTED: zinc finger protein 622 [Geospiza fortis]
Length=471

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|AAK97212.1|AF299386_1 putative Zn-finger protein C47L [Gallus gallus]
Length=374

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   RDKVTAT  67



>ref|XP_005010777.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622 [Anas 
platyrhynchos]
Length=374

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            K K+T T
Sbjct  61   KNKVTAT  67



>ref|XP_009470313.1| PREDICTED: zinc finger protein 622 [Nipponia nippon]
 gb|KFR04938.1| Zinc finger protein 622 [Nipponia nippon]
Length=469

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MTTYTCITCRVAFKDADMQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_008635410.1| PREDICTED: zinc finger protein 622 [Corvus brachyrhynchos]
Length=471

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010129714.1| PREDICTED: zinc finger protein 622 [Buceros rhinoceros silvestris]
 gb|KFO86817.1| Zinc finger protein 622 [Buceros rhinoceros silvestris]
Length=469

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009875577.1| PREDICTED: zinc finger protein 622 [Apaloderma vittatum]
 gb|KFP79648.1| Zinc finger protein 622 [Apaloderma vittatum]
Length=469

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>sp|Q90Y35.1|ZN622_CHICK RecName: Full=Zinc finger protein 622; AltName: Full=Zn-finger 
protein C47 [Gallus gallus]
 gb|AAK97213.1|AF299387_1 putative Zn-finger protein C47S [Gallus gallus]
Length=405

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   RDKVTAT  67



>ref|XP_005530939.1| PREDICTED: zinc finger protein 622 [Pseudopodoces humilis]
Length=470

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFO61817.1| Zinc finger protein 622 [Corvus brachyrhynchos]
Length=467

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010193686.1| PREDICTED: zinc finger protein 622 [Colius striatus]
Length=469

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009568575.1| PREDICTED: zinc finger protein 622 [Cuculus canorus]
 gb|KFO70706.1| Zinc finger protein 622 [Cuculus canorus]
Length=469

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009572955.1| PREDICTED: zinc finger protein 622 [Fulmarus glacialis]
 gb|KFW02129.1| Zinc finger protein 622 [Fulmarus glacialis]
Length=469

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_006027690.1| PREDICTED: zinc finger protein 622 isoform X2 [Alligator sinensis]
Length=488

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  12   MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  71

Query  219  KKKLTET  239
            + K+T T
Sbjct  72   QSKITAT  78



>ref|XP_008937252.1| PREDICTED: zinc finger protein 622 [Merops nubicus]
 gb|KFQ16680.1| Zinc finger protein 622 [Merops nubicus]
Length=467

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009911754.1| PREDICTED: zinc finger protein 622 [Haliaeetus albicilla]
 ref|XP_009911755.1| PREDICTED: zinc finger protein 622 [Haliaeetus albicilla]
 ref|XP_010569760.1| PREDICTED: zinc finger protein 622 [Haliaeetus leucocephalus]
 ref|XP_010569761.1| PREDICTED: zinc finger protein 622 [Haliaeetus leucocephalus]
 gb|KFP93499.1| Zinc finger protein 622 [Haliaeetus albicilla]
Length=469

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_001779994.1| predicted protein [Physcomitrella patens]
 gb|EDQ55203.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  84   FKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCG  260
            F D   QK HYK+EWHRYNL+RKVAGVPGVTEAL   R   +  E K      +LY C 
Sbjct  1    FADKELQKQHYKTEWHRYNLRRKVAGVPGVTEALHNLRIQGLEAEGKTKEGDRVLYKCA  59



>ref|XP_003204860.1| PREDICTED: zinc finger protein 622 [Meleagris gallopavo]
Length=469

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   RDKVTAT  67



>ref|XP_006027689.1| PREDICTED: zinc finger protein 622 isoform X1 [Alligator sinensis]
Length=489

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  12   MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  71

Query  219  KKKLTET  239
            + K+T T
Sbjct  72   QSKITAT  78



>ref|XP_006261028.1| PREDICTED: zinc finger protein 622 isoform X2 [Alligator mississippiensis]
Length=475

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  1    MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QSKITAT  67



>ref|XP_008920936.1| PREDICTED: zinc finger protein 622 [Manacus vitellinus]
 gb|KFW79957.1| Zinc finger protein 622 [Manacus vitellinus]
Length=469

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009286281.1| PREDICTED: zinc finger protein 622 [Aptenodytes forsteri]
 gb|KFM01626.1| Zinc finger protein 622 [Aptenodytes forsteri]
Length=469

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_006261027.1| PREDICTED: zinc finger protein 622 isoform X1 [Alligator mississippiensis]
Length=476

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  1    MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QSKITAT  67



>ref|XP_010225595.1| PREDICTED: zinc finger protein 622 isoform X2 [Tinamus guttatus]
 gb|KGL72339.1| Zinc finger protein 622 [Tinamus guttatus]
Length=471

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_008496309.1| PREDICTED: zinc finger protein 622 [Calypte anna]
Length=351

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDAEIQRAHYKTDWHRYNLKRKVAEMPPVTAENFEERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010225587.1| PREDICTED: zinc finger protein 622 isoform X1 [Tinamus guttatus]
Length=472

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010122778.1| PREDICTED: zinc finger protein 622 [Chlamydotis macqueenii]
 gb|KFP36837.1| Zinc finger protein 622 [Chlamydotis macqueenii]
Length=469

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009820658.1| PREDICTED: zinc finger protein 622 [Gavia stellata]
 gb|KFV49366.1| Zinc finger protein 622 [Gavia stellata]
Length=469

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFR13904.1| Zinc finger protein 622 [Opisthocomus hoazin]
Length=479

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_009505834.1| PREDICTED: zinc finger protein 622 [Phalacrocorax carbo]
 gb|KFW92549.1| Zinc finger protein 622 [Phalacrocorax carbo]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009936853.1| PREDICTED: zinc finger protein 622 [Opisthocomus hoazin]
Length=471

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_010014921.1| PREDICTED: zinc finger protein 622 [Nestor notabilis]
 gb|KFQ42858.1| Zinc finger protein 622 [Nestor notabilis]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005153414.1| PREDICTED: zinc finger protein 622 [Melopsittacus undulatus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005498025.1| PREDICTED: zinc finger protein 622 isoform X1 [Columba livia]
 ref|XP_005498026.1| PREDICTED: zinc finger protein 622 isoform X2 [Columba livia]
 gb|EMC86977.1| Zinc finger protein 622 [Columba livia]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>gb|KFZ65667.1| Zinc finger protein 622 [Podiceps cristatus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009323268.1| PREDICTED: zinc finger protein 622 [Pygoscelis adeliae]
 gb|KFW67768.1| Zinc finger protein 622 [Pygoscelis adeliae]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFQ84619.1| Zinc finger protein 622 [Phoenicopterus ruber ruber]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009476736.1| PREDICTED: zinc finger protein 622 [Pelecanus crispus]
 gb|KFQ49577.1| Zinc finger protein 622 [Pelecanus crispus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|NP_989461.2| zinc finger protein 622 [Gallus gallus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   RDKVTAT  67



>ref|XP_010298371.1| PREDICTED: zinc finger protein 622 [Balearica regulorum gibbericeps]
Length=468

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010291352.1| PREDICTED: zinc finger protein 622 [Phaethon lepturus]
 gb|KFQ69785.1| Zinc finger protein 622 [Phaethon lepturus]
Length=462

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009980421.1| PREDICTED: zinc finger protein 622 [Tauraco erythrolophus]
 gb|KFV13854.1| Zinc finger protein 622 [Tauraco erythrolophus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFO09709.1| Zinc finger protein 622 [Balearica regulorum gibbericeps]
Length=473

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFO96100.1| Zinc finger protein 622 [Calypte anna]
Length=448

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDAEIQRAHYKTDWHRYNLKRKVAEMPPVTAENFEERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_009679581.1| PREDICTED: zinc finger protein 622 [Struthio camelus australis]
 ref|XP_009679588.1| PREDICTED: zinc finger protein 622 [Struthio camelus australis]
 gb|KFV73715.1| Zinc finger protein 622 [Struthio camelus australis]
Length=470

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_010003388.1| PREDICTED: zinc finger protein 622 [Chaetura pelagica]
 gb|KFU95282.1| Zinc finger protein 622 [Chaetura pelagica]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_010185136.1| PREDICTED: zinc finger protein 622 [Mesitornis unicolor]
 gb|KFQ37778.1| Zinc finger protein 622 [Mesitornis unicolor]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|KFP54392.1| Zinc finger protein 622 [Cathartes aura]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_005235847.1| PREDICTED: zinc finger protein 622 [Falco peregrinus]
 ref|XP_005444534.1| PREDICTED: zinc finger protein 622 [Falco cherrug]
Length=467

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFEERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_001645072.1| hypothetical protein Kpol_1035p27 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO17214.1| hypothetical protein Kpol_1035p27 [Vanderwaltozyma polyspora 
DSM 70294]
Length=407

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  48   MPGL-TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA  212
            M G+ TCN+C  +F    +Q+ H K++WHRYNLKR+VA +P +TE  F ++QS +A
Sbjct  1    MSGVYTCNSCGLQFPSGGDQREHMKTDWHRYNLKRRVANLPAITEQTFKSKQSDVA  56



>ref|XP_009702614.1| PREDICTED: zinc finger protein 622 [Cariama cristata]
 gb|KFP59623.1| Zinc finger protein 622 [Cariama cristata]
Length=469

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K++ T
Sbjct  61   QNKISAT  67



>ref|XP_008611697.1| hypothetical protein SDRG_07629 [Saprolegnia diclina VS20]
 gb|EQC34825.1| hypothetical protein SDRG_07629 [Saprolegnia diclina VS20]
Length=392

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ  200
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P VTEA F AR+
Sbjct  2    LTCTACREEFPTYELQKEHFKLDWHRYNLKRKVVGLPAVTEAQFQARK  49



>ref|XP_005290261.1| PREDICTED: zinc finger protein 622 isoform X1 [Chrysemys picta 
bellii]
Length=496

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  219  KKKLTET  239
            + K+T T
Sbjct  91   QNKVTAT  97



>ref|XP_004175197.1| PREDICTED: zinc finger protein 622 [Taeniopygia guttata]
Length=470

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>ref|XP_008166808.1| PREDICTED: zinc finger protein 622 isoform X3 [Chrysemys picta 
bellii]
Length=427

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  219  KKKLTET  239
            + K+T T
Sbjct  91   QNKVTAT  97



>ref|XP_009636175.1| PREDICTED: zinc finger protein 622 [Egretta garzetta]
 gb|KFP15134.1| Zinc finger protein 622 [Egretta garzetta]
Length=470

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFQDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>gb|EMP28578.1| hypothetical protein UY3_14325 [Chelonia mydas]
Length=418

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_005290262.1| PREDICTED: zinc finger protein 622 isoform X2 [Chrysemys picta 
bellii]
Length=466

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_006126162.1| PREDICTED: zinc finger protein 622-like isoform X1 [Pelodiscus 
sinensis]
Length=476

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  12   MASFTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTVENFQERVLAQRAVAEE  71

Query  219  KKKLTET  239
            + K T T
Sbjct  72   QNKDTAT  78



>ref|XP_010398489.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622 [Corvus 
cornix cornix]
Length=473

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FK+   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKEGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKITAT  67



>emb|CCE40769.1| hypothetical protein CPAR2_108040 [Candida parapsilosis]
Length=398

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
             TCN CN +F +  +Q++H KS+WHRYNLKRKVA +P +TE LF
Sbjct  2    FTCNTCNLQFPESNDQRIHMKSDWHRYNLKRKVAQLPPITEELF  45



>ref|XP_006126163.1| PREDICTED: zinc finger protein 622-like isoform X2 [Pelodiscus 
sinensis]
Length=465

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MASFTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTVENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   QNKDTAT  67



>dbj|BAO40726.1| pre-60S factor REI1 [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP72201.1| pre-60S factor REI1 [Kluyveromyces marxianus]
Length=416

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            M G TCN C   F   A Q+ H KS+WHRYNLKR+VA +P +TEA F  + S    EK++
Sbjct  1    MAGYTCNTCGVVFDTAAGQRDHMKSDWHRYNLKRRVADLPSITEATFNEKVSNANAEKEE  60

Query  228  LTET  239
            L ++
Sbjct  61   LDKS  64



>ref|XP_009076748.1| PREDICTED: zinc finger protein 622 [Acanthisitta chloris]
 gb|KFP72291.1| Zinc finger protein 622 [Acanthisitta chloris]
Length=469

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>ref|XP_007067500.1| PREDICTED: zinc finger protein 622 [Chelonia mydas]
Length=496

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  219  KKKLTET  239
            + K+T T
Sbjct  91   QNKVTAT  97



>ref|XP_003868061.1| Rei1 cytoplasmic pre-60S factor [Candida orthopsilosis Co 90-125]
 emb|CCG22626.1| Rei1 cytoplasmic pre-60S factor [Candida orthopsilosis]
Length=393

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
             TCN CN +F +  +Q++H KS+WHRYNLKRKVA +P +TE LF
Sbjct  2    FTCNTCNLQFPESNDQRVHMKSDWHRYNLKRKVAQLPPITEDLF  45



>ref|XP_001899722.1| Zinc finger, C2H2 type family protein [Brugia malayi]
Length=378

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +3

Query  54   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            GLTC  C   F ++  Q+ HYK++WHRYNLKRK+ G P VTE  F  RQ +IA +K+
Sbjct  6    GLTCLCCQSVFANNDLQREHYKTDWHRYNLKRKITGFPIVTEEQF--RQKIIAYKKE  60



>emb|CDQ00177.1| Protein Bm13985, isoform a [Brugia malayi]
Length=378

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +3

Query  54   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            GLTC  C   F ++  Q+ HYK++WHRYNLKRK+ G P VTE  F  RQ +IA +K+
Sbjct  6    GLTCLCCQSVFANNDLQREHYKTDWHRYNLKRKITGFPIVTEEQF--RQKIIAYKKE  60



>emb|CDH17194.1| related to Zinc finger protein REH1 [Zygosaccharomyces bailii 
ISA1307]
Length=410

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  51   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            P  TCN+C  +FK    Q+ H K+EWHRYNLKR+VAG P ++  LF  +  V   EK +
Sbjct  4    PSFTCNSCVIQFKSSDLQRYHMKTEWHRYNLKRRVAGFPPISADLFAEKLQVSEREKAE  62



>emb|CDF91377.1| ZYBA0S11-01486g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=416

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  51   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            P  TCN+C  +FK    Q+ H K+EWHRYNLKR+VAG P ++  LF  +  V   EK +
Sbjct  10   PSFTCNSCVIQFKSSDLQRYHMKTEWHRYNLKRRVAGFPPISADLFAEKLQVSEREKAE  68



>gb|KJB06567.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=363

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  150  KVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCG  260
            +VAGVPGVTEALFLARQ+ +AEEK K  ETPMLY+CG
Sbjct  6    QVAGVPGVTEALFLARQAALAEEKDKQNETPMLYSCG  42



>emb|CAJ83907.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
Length=218

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   QSKETAT  67



>ref|XP_009094102.1| PREDICTED: zinc finger protein 622 [Serinus canaria]
Length=470

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R      +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLALRAVAEE  60

Query  219  KKKLTET  239
            + K+T T
Sbjct  61   QNKVTAT  67



>gb|KDO30833.1| hypothetical protein SPRG_04734 [Saprolegnia parasitica CBS 223.65]
Length=390

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ  200
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P VTEA F AR+
Sbjct  2    LTCTACREEFPTYELQKEHFKLDWHRYNLKRKVVGLPPVTEAQFQARK  49



>ref|XP_710870.1| potential zinc finger protein [Candida albicans SC5314]
 gb|EAK91627.1| potential zinc finger protein [Candida albicans SC5314]
Length=475

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVI--AEEKKK  227
             TCN CN +F    +Q+ H KSEWHRYNLKR+VA +P +TE LF ++ S +   EE K+
Sbjct  76   FTCNTCNLQFPAAEDQRSHMKSEWHRYNLKRRVAQLPPITEDLFNSKVSTLTNTEETKQ  134



>ref|XP_001526946.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK43596.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
Length=440

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK  221
             TCN CN +F    +Q+ H KSEWHRYNLKRKVA +P + E LF ++ +  A +K
Sbjct  2    FTCNTCNLQFPASEDQRTHMKSEWHRYNLKRKVAQLPPINEDLFNSKVAAAAAQK  56



>ref|XP_710858.1| potential zinc finger protein [Candida albicans SC5314]
 gb|EAK91614.1| potential zinc finger protein [Candida albicans SC5314]
Length=476

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVI--AEEKKK  227
             TCN CN +F    +Q+ H KSEWHRYNLKR+VA +P +TE LF ++ S +   EE K+
Sbjct  76   FTCNTCNLQFPAAEDQRSHMKSEWHRYNLKRRVAQLPPITEDLFNSKVSTLTNTEETKQ  134



>ref|XP_003759684.1| PREDICTED: zinc finger protein 622 [Sarcophilus harrisii]
Length=435

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYKS+WHRYNLKRKVA +  VT   F  R   Q  +AEE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKSDWHRYNLKRKVADMAPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_008819991.1| PREDICTED: zinc finger protein 622 isoform X2 [Nannospalax galili]
Length=448

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>gb|ETL81695.1| hypothetical protein L917_18045 [Phytophthora parasitica]
Length=438

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            LTC AC  EF   AEQK H++ +WHRYNLKRKV  +P V+E  F  R   + EEK+
Sbjct  2    LTCTACRLEFASPAEQKDHFRMDWHRYNLKRKVVELPPVSEEQFELRMRKVREEKE  57



>emb|CDO95283.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=404

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
            M G TCN C   F   A Q+ H KS+WHRYNLKRKVA +P +TE++F
Sbjct  1    MAGYTCNTCGVVFDVAAGQREHMKSDWHRYNLKRKVASLPSITESVF  47



>ref|XP_008896708.1| hypothetical protein PPTG_05012 [Phytophthora parasitica INRA-310]
 gb|ETI34676.1| hypothetical protein F443_18859 [Phytophthora parasitica P1569]
 gb|ETK75023.1| hypothetical protein L915_18321 [Phytophthora parasitica]
 gb|ETL28446.1| hypothetical protein L916_18228 [Phytophthora parasitica]
 gb|ETM34900.1| hypothetical protein L914_18131 [Phytophthora parasitica]
 gb|ETN17118.1| hypothetical protein PPTG_05012 [Phytophthora parasitica INRA-310]
 gb|ETO63474.1| hypothetical protein F444_18848 [Phytophthora parasitica P1976]
 gb|ETP04576.1| hypothetical protein F441_18702 [Phytophthora parasitica CJ01A1]
 gb|ETP32701.1| hypothetical protein F442_18675 [Phytophthora parasitica P10297]
Length=438

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            LTC AC  EF   AEQK H++ +WHRYNLKRKV  +P V+E  F  R   + EEK+
Sbjct  2    LTCTACRLEFASPAEQKDHFRMDWHRYNLKRKVVELPPVSEEQFELRMRKVREEKE  57



>ref|XP_004078799.1| PREDICTED: zinc finger protein 622 [Oryzias latipes]
Length=464

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AE+
Sbjct  1    MASYTCISCRVTFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLLQRAVAEQ  60

Query  219  KKKLTETPMLYTCG  260
              +L+E+     CG
Sbjct  61   --QLSESTATEVCG  72



>ref|XP_003143673.1| hypothetical protein LOAG_08093 [Loa loa]
Length=60

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +3

Query  54   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK  221
            GLTC  C   F +   Q+ HYK++WHRYNLKRK+ G   +TE  F  RQ VIA +K
Sbjct  6    GLTCLCCQAVFGNSDLQREHYKTDWHRYNLKRKITGFTIITEEQF--RQKVIAYKK  59



>ref|XP_008819990.1| PREDICTED: zinc finger protein 622 isoform X1 [Nannospalax galili]
Length=471

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_694322.6| PREDICTED: zinc finger protein 622 [Danio rerio]
Length=494

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    CNPILFLNPIHNFEEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEA  182
            C P+ FL    N + M   TC +C  +F D   Q+ HYK++WHRYNLKRKVA +P VT  
Sbjct  27   CGPVNFLYRKSNNQIM-SYTCISCRVQFSDGEVQRAHYKTDWHRYNLKRKVADMPPVTAE  85

Query  183  LFLAR---QSVIAEEKKK  227
             F  R   Q   AE++ +
Sbjct  86   NFQERVLAQRAAAEQQSQ  103



>gb|KFO24852.1| Zinc finger protein 622 [Fukomys damarensis]
Length=472

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_010642309.1| PREDICTED: zinc finger protein 622 [Fukomys damarensis]
Length=475

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_005002367.1| PREDICTED: zinc finger protein 622 isoform X3 [Cavia porcellus]
Length=447

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_003466756.1| PREDICTED: zinc finger protein 622 isoform X1 [Cavia porcellus]
Length=480

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>emb|CDH10948.1| related to Zinc finger protein REH1 [Zygosaccharomyces bailii 
ISA1307]
Length=416

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  51   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
            P  TCN+C  +FK    Q+ H K+EWHRYNLKR+VAG P ++  LF  +  +   EK +
Sbjct  10   PSFTCNSCVIQFKSSDLQRYHMKTEWHRYNLKRRVAGFPPISADLFAEKLQLSEREKAE  68



>ref|XP_005002366.1| PREDICTED: zinc finger protein 622 isoform X2 [Cavia porcellus]
Length=478

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_003340644.1| PREDICTED: zinc finger protein 622 [Monodelphis domestica]
Length=467

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   FKD   Q+ HYKS+WHRYNLKRKVA +  VT   F  R   Q  +AEE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKSDWHRYNLKRKVADMAPVTAENFQERVLAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_005386191.1| PREDICTED: zinc finger protein 622 isoform X2 [Chinchilla lanigera]
Length=478

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRVQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   EGKGTAT  67



>ref|XP_002417147.1| conserved hypothetical protein [Candida dubliniensis CD36]
 emb|CAX44737.1| conserved hypothetical protein [Candida dubliniensis CD36]
Length=401

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA  212
             TCN CN +F    +Q+ H KS+WHRYNLKR+VA +P +TE LF ++ S + 
Sbjct  16   FTCNTCNLQFPAAEDQRSHMKSDWHRYNLKRRVAQLPPITEDLFNSKVSTLT  67



>gb|EDK36114.2| hypothetical protein PGUG_00212 [Meyerozyma guilliermondii ATCC 
6260]
Length=388

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAE  215
            TCN+C  EF D   QK H +S+WHRYNLKR+VA +P V E  F ++ SV A+
Sbjct  4    TCNSCKLEFSDSQGQKEHMRSDWHRYNLKRRVAQLPPVDEETFRSKVSVHAD  55



>ref|XP_005386190.1| PREDICTED: zinc finger protein 622 isoform X1 [Chinchilla lanigera]
Length=476

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRVQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   EGKGTAT  67



>ref|NP_984910.1| AER050Cp [Ashbya gossypii ATCC 10895]
 gb|AAS52734.1| AER050Cp [Ashbya gossypii ATCC 10895]
 gb|AEY97040.1| FAER050Cp [Ashbya gossypii FDAG1]
Length=395

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  60   TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTE  236
            TCNAC  +FK    Q+ H K+EWHRYNLKR++A +P +   +F  +   I+E +K+L E
Sbjct  7    TCNACMIQFKSSDLQRYHMKTEWHRYNLKRRIADLPPIDADIFTQKMQ-ISEREKRLHE  64



>ref|XP_455158.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG97865.1| KLLA0F01727p [Kluyveromyces lactis]
Length=404

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
            M G TCN C   F     Q+ H KS+WHRYNLKR+VAG+P + EA F
Sbjct  1    MAGYTCNTCGVVFDTAVGQREHMKSDWHRYNLKRRVAGLPSIDEATF  47



>ref|XP_004641912.1| PREDICTED: zinc finger protein 622-like [Octodon degus]
Length=478

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AE+
Sbjct  1    MATYTCISCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVHAQRAVAEQ  60

Query  219  KKKLTET  239
            + + T T
Sbjct  61   ESRATAT  67



>ref|XP_004644793.1| PREDICTED: zinc finger protein 622 [Octodon degus]
Length=480

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AE+
Sbjct  1    MATYTCISCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVHAQRAVAEQ  60

Query  219  KKKLTET  239
            + + T T
Sbjct  61   ESRATAT  67



>ref|XP_003668755.1| hypothetical protein NDAI_0B04780 [Naumovozyma dairenensis CBS 
421]
 emb|CCD23512.1| hypothetical protein NDAI_0B04780 [Naumovozyma dairenensis CBS 
421]
Length=440

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  48   MPGL-TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
            M G+ TCN+C  EF    EQ+ H KS+WHRYNLKR+VA +P +TE+ F
Sbjct  1    MSGIYTCNSCVMEFASSIEQRQHMKSDWHRYNLKRRVAQLPPITESTF  48



>ref|NP_001011460.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
 gb|AAH88572.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
Length=466

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   QSKETAT  67



>gb|AES97876.2| hypothetical protein MTR_5g061270 [Medicago truncatula]
Length=203

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  153  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCG  260
            VAGVPGVTEALFLARQ+ +A+E+ +  E+PMLY+CG
Sbjct  13   VAGVPGVTEALFLARQAELAQERDESNESPMLYSCG  48



>gb|AAO13531.1| zinc finger protein Yan [Bufo gargarizans]
Length=468

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   QSKETAT  67



>ref|XP_002907194.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY63758.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=436

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
             TC AC  EF   AEQK H++ +WHRYNLKRKV  +P V+E  F  R   + EEK+
Sbjct  2    FTCTACRLEFASPAEQKDHFRMDWHRYNLKRKVVELPPVSEEQFEFRMRKVREEKE  57



>ref|XP_003681582.1| hypothetical protein TDEL_0E01280 [Torulaspora delbrueckii]
 emb|CCE92371.1| hypothetical protein TDEL_0E01280 [Torulaspora delbrueckii]
Length=423

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  51   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKK  224
            P  TCN+C  +FK    Q+ H K+EWHRYNLKR+VA +P ++ A F A +  ++E+++
Sbjct  4    PNFTCNSCEIQFKSSDSQRYHMKTEWHRYNLKRRVANLPRISAAEF-AEKLQLSEQQR  60



>ref|XP_008864373.1| hypothetical protein H310_02589 [Aphanomyces invadans]
 gb|ETW06298.1| hypothetical protein H310_02589 [Aphanomyces invadans]
Length=407

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTE  236
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P VT   F+AR+   A+    LT 
Sbjct  2    LTCTACREEFATYELQKEHFKLDWHRYNLKRKVVGLPPVTVEQFVARK---ADGTSALTT  58

Query  237  TPML  248
             P +
Sbjct  59   APKV  62



>emb|CDR44718.1| CYFA0S15e01904g1_1 [Cyberlindnera fabianii]
Length=413

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  60   TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF  188
            TCN C+ +F    +Q+ H KSEWHRYNLKR+VAG+P + E LF
Sbjct  4    TCNTCSLQFPLPEDQRTHMKSEWHRYNLKRRVAGLPAIEETLF  46



>ref|XP_009844345.1| hypothetical protein H257_17308 [Aphanomyces astaci]
 gb|ETV66156.1| hypothetical protein H257_17308 [Aphanomyces astaci]
Length=398

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTE  236
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P V+   F AR++  A +K    E
Sbjct  2    LTCTACREEFATYELQKEHFKLDWHRYNLKRKVVGLPPVSVEQFFARKADGAPQK---VE  58

Query  237  TPML  248
             P+L
Sbjct  59   EPVL  62



>ref|XP_008347704.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=381

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  153  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCG  260
            VAGVPGVTEALF+ARQ+ +A+EK  L+E PMLY+CG
Sbjct  12   VAGVPGVTEALFIARQAALAQEKNGLSEXPMLYSCG  47



>ref|XP_447077.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60010.1| unnamed protein product [Candida glabrata]
Length=411

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  57   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  227
             TCN+C+ +F+    Q+ H K+EWHRYNLKR+VA +P ++ ++F  +  +   EK++
Sbjct  5    FTCNSCDIQFQTSDSQRYHMKTEWHRYNLKRRVANLPHISASMFAEKVQMSEREKRE  61



>ref|NP_001079501.1| zinc finger protein 622 [Xenopus laevis]
 gb|AAH43879.1| MGC53766 protein [Xenopus laevis]
Length=471

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P V+   F  R   Q  + EE
Sbjct  1    MASYTCISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVSAENFQERVLAQRAVVEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   QSKETAT  67



>ref|XP_003675200.1| hypothetical protein NCAS_0B07450 [Naumovozyma castellii CBS 
4309]
 emb|CCC68829.1| hypothetical protein NCAS_0B07450 [Naumovozyma castellii CBS 
4309]
Length=422

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  48   MPGL-TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA  212
            M G+ TCN+C  +F     Q+ H KS+WHRYNLKR+VA +P +TEA F ++  V +
Sbjct  1    MSGVYTCNSCVMQFDSSESQRQHMKSDWHRYNLKRRVAQLPPITEATFNSKVQVAS  56



>ref|XP_001486835.1| hypothetical protein PGUG_00212 [Meyerozyma guilliermondii ATCC 
6260]
Length=388

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   TCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAE  215
            TCN+C  EF D   QK H +S+WHRYNLKR+VA +P V E  F ++ SV A+
Sbjct  4    TCNSCKLEFSDLQGQKEHMRSDWHRYNLKRRVAQLPPVDEETFRSKVSVHAD  55



>ref|XP_011308899.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 
1-like isoform X2 [Fopius arisanus]
Length=644

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  6    NPILFLNPIHNFEEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEAL  185
            +P    + + +      L+C+ CNK F+D AEQ+ HYK +WHRYNLK+++ G   +TE  
Sbjct  36   DPETIFSQLEDLTVSDSLSCSFCNKTFEDQAEQRCHYKLDWHRYNLKQRLRGSKSITEDQ  95

Query  186  F  188
            F
Sbjct  96   F  96



>ref|XP_005796649.1| PREDICTED: zinc finger protein 622-like [Xiphophorus maculatus]
Length=459

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEE---  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAA  58

Query  219  KKKLTETPMLYTCG  260
             ++LT      +CG
Sbjct  59   NQQLTHAAATESCG  72



>ref|XP_003614918.1| C2H2 zinc finger protein FZF [Medicago truncatula]
Length=244

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  153  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCG  260
            VAGVPGVTEALFLARQ+ +A+E+ +  E+PMLY+CG
Sbjct  13   VAGVPGVTEALFLARQAELAQERDESNESPMLYSCG  48



>sp|Q7TM96.2|ZN622_RAT RecName: Full=Zinc finger protein 622; AltName: Full=Liver regeneration-related 
protein LRRG121 [Rattus norvegicus]
Length=386

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_003058551.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57006.1| predicted protein [Micromonas pusilla CCMP1545]
Length=320

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +3

Query  45   EMPGLTCN-ACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF--LARQSVIAE  215
            E  GLTCN A    F D  E K HY+S+WHRYNLKRKVAG+P V + LF  +  Q+  A+
Sbjct  8    EDDGLTCNTAPGVTFLDMDELKEHYRSDWHRYNLKRKVAGLPVVGKELFERVMAQAAGAK  67

Query  216  EKKKLTETPML  248
            E  K T T  L
Sbjct  68   EAGKQTGTSHL  78



>gb|EDL82619.1| zinc finger protein 622, isoform CRA_a [Rattus norvegicus]
Length=406

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_004845257.1| PREDICTED: zinc finger protein 622 [Heterocephalus glaber]
Length=477

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +A E
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAAE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_004884669.1| PREDICTED: zinc finger protein 622 [Heterocephalus glaber]
 gb|EHB02941.1| Zinc finger protein 622 [Heterocephalus glaber]
Length=478

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  218
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +A E
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAAE  60

Query  219  KKKLTET  239
            + K T T
Sbjct  61   ESKGTAT  67



>ref|XP_008433012.1| PREDICTED: zinc finger protein 622 [Poecilia reticulata]
Length=459

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +3

Query  48   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEE---  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAA  58

Query  219  KKKLTETPMLYTCG  260
             ++LT      +CG
Sbjct  59   DQQLTHAAATESCG  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571209109800