BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF004A11

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                135   3e-35   Erythranthe guttata [common monkey flower]
ref|NP_001078387.1|  adenosylhomocysteinase 1                           131   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             133   9e-35   Solanum lycopersicum
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             133   9e-35   Solanum tuberosum [potatoes]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   132   1e-34   Populus tomentosa [Chinese white poplar]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       132   1e-34   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     132   1e-34   Nicotiana tabacum [American tobacco]
ref|NP_001289538.1|  adenosylhomocysteinase                             132   1e-34   Nicotiana sylvestris
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             132   1e-34   Populus euphratica
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   Glycine max [soybeans]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    132   2e-34   Arabis alpina [alpine rockcress]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    132   2e-34   Arabis alpina [alpine rockcress]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              132   2e-34   Populus trichocarpa [western balsam poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    132   2e-34   Phalaenopsis sp.
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   Nicotiana sylvestris
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     132   2e-34   Populus tomentosa [Chinese white poplar]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      132   2e-34   Petunia x hybrida [garden petunia]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   
gb|AEI54335.1|  adenosylhomocysteinase                                  132   2e-34   Glycine max [soybeans]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   Phoenix dactylifera
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   Nicotiana tomentosiformis
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               132   2e-34   Capsicum annuum
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             132   2e-34   Vitis vinifera
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   132   2e-34   Ricinus communis
emb|CDY50423.1|  BnaCnng19320D                                          132   3e-34   Brassica napus [oilseed rape]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                132   3e-34   Brassica rapa
ref|NP_001031628.1|  adenosylhomocysteinase 1                           131   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54286.1|  adenosylhomocysteinase                                  132   3e-34   Phaseolus vulgaris [French bean]
emb|CDY01177.1|  BnaA04g06420D                                          132   3e-34   
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                131   3e-34   Erythranthe guttata [common monkey flower]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        131   3e-34   Kalanchoe daigremontiana
emb|CDP11183.1|  unnamed protein product                                131   3e-34   Coffea canephora [robusta coffee]
emb|CDY58805.1|  BnaC08g46780D                                          131   3e-34   Brassica napus [oilseed rape]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     131   4e-34   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    131   4e-34   Catharanthus roseus [chatas]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           131   4e-34   Brassica rapa
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      131   4e-34   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            131   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            131   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                              131   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             131   4e-34   Capsella rubella
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            131   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62888.1|  adenosylhomocysteinase                                  131   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  131   5e-34   Sesamum indicum [beniseed]
emb|CDY47309.1|  BnaAnng08830D                                          131   5e-34   Brassica napus [oilseed rape]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          131   5e-34   Amborella trichopoda
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              131   5e-34   Populus tomentosa [Chinese white poplar]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             131   5e-34   Arabidopsis lyrata subsp. lyrata
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  131   5e-34   Populus euphratica
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     131   5e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   131   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   130   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   130   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   130   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   130   6e-34   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   130   6e-34   Populus tomentosa [Chinese white poplar]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             131   6e-34   
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  130   7e-34   
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     130   7e-34   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     130   7e-34   Populus tomentosa [Chinese white poplar]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                130   8e-34   Tarenaya hassleriana [spider flower]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   130   9e-34   Populus tomentosa [Chinese white poplar]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                130   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           130   9e-34   Tarenaya hassleriana [spider flower]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                130   1e-33   Erythranthe guttata [common monkey flower]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   130   1e-33   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     130   1e-33   Populus tomentosa [Chinese white poplar]
ref|XP_003601687.1|  Adenosylhomocysteinase                             130   1e-33   Medicago truncatula
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     130   1e-33   Eucalyptus grandis [rose gum]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                130   1e-33   Cucumis melo [Oriental melon]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             130   1e-33   Cicer arietinum [garbanzo]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    130   1e-33   Medicago sativa [alfalfa]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             130   1e-33   
gb|ABR16138.1|  unknown                                                 130   1e-33   Picea sitchensis
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  130   1e-33   Solanum lycopersicum
gb|ABR16547.1|  unknown                                                 130   1e-33   Picea sitchensis
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     130   1e-33   Eucalyptus grandis [rose gum]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                130   1e-33   
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    130   1e-33   
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         130   1e-33   Jatropha curcas
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                130   1e-33   Eucalyptus grandis [rose gum]
gb|ABR16573.1|  unknown                                                 130   1e-33   Picea sitchensis
gb|ACN40278.1|  unknown                                                 130   1e-33   Picea sitchensis
gb|ABR17322.1|  unknown                                                 130   1e-33   Picea sitchensis
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  130   1e-33   Eucalyptus grandis [rose gum]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    130   1e-33   Linum usitatissimum
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     130   1e-33   Populus tomentosa [Chinese white poplar]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             130   1e-33   Elaeis guineensis
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  129   2e-33   Nelumbo nucifera [Indian lotus]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   129   2e-33   Populus tomentosa [Chinese white poplar]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               129   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             129   2e-33   Oryza brachyantha
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             129   2e-33   Nelumbo nucifera [Indian lotus]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   129   2e-33   Populus tomentosa [Chinese white poplar]
emb|CDX85127.1|  BnaC07g07790D                                          129   2e-33   
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   129   2e-33   Populus tomentosa [Chinese white poplar]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    129   2e-33   Mesembryanthemum crystallinum
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      129   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       129   2e-33   Nicotiana suaveolens
ref|XP_006373090.1|  adenosylhomocysteinase family protein              129   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           129   3e-33   Brassica rapa
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    129   3e-33   Lupinus luteus
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    129   3e-33   Lupinus luteus
gb|KHN12344.1|  Adenosylhomocysteinase                                  128   3e-33   Glycine soja [wild soybean]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             129   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        125   3e-33   
emb|CDP15078.1|  unnamed protein product                                129   3e-33   Coffea canephora [robusta coffee]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     129   4e-33   Populus tomentosa [Chinese white poplar]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             129   4e-33   Phaseolus vulgaris [French bean]
gb|ABK25129.1|  unknown                                                 129   4e-33   Picea sitchensis
gb|ABK24229.1|  unknown                                                 129   4e-33   Picea sitchensis
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                128   4e-33   Solanum tuberosum [potatoes]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  128   4e-33   Nelumbo nucifera [Indian lotus]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     128   4e-33   Populus tomentosa [Chinese white poplar]
gb|EPS72602.1|  adenosylhomocysteinase                                  129   4e-33   Genlisea aurea
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              126   5e-33   Allium cepa
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   128   5e-33   Populus tomentosa [Chinese white poplar]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     128   5e-33   Phaseolus vulgaris [French bean]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   128   6e-33   Populus tomentosa [Chinese white poplar]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       128   6e-33   Gentiana triflora
ref|XP_010097949.1|  hypothetical protein L484_026840                   128   6e-33   Morus notabilis
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             128   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             128   6e-33   Sesamum indicum [beniseed]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  128   7e-33   Phoenix dactylifera
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             128   7e-33   Sesamum indicum [beniseed]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      128   7e-33   Gossypium hirsutum [American cotton]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    127   7e-33   Gossypium raimondii
gb|KHG17040.1|  Adenosylhomocysteinase                                  127   8e-33   Gossypium arboreum [tree cotton]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    127   8e-33   Gossypium raimondii
dbj|BAH19670.1|  AT4G13940                                              126   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             127   9e-33   Selaginella moellendorffii
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   127   1e-32   Populus tomentosa [Chinese white poplar]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    127   1e-32   Gossypium raimondii
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    127   1e-32   
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    127   1e-32   Pinus pinaster [cluster pine]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             127   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                127   2e-32   Brassica rapa
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  127   2e-32   Vitis vinifera
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        127   2e-32   
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     127   2e-32   Cucumis sativus [cucumbers]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    126   2e-32   Gossypium raimondii
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             127   2e-32   Elaeis guineensis
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             127   2e-32   
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   126   2e-32   Citrus sinensis [apfelsine]
gb|EMS57067.1|  Adenosylhomocysteinase                                  126   2e-32   Triticum urartu
emb|CDX77483.1|  BnaA07g06210D                                          126   2e-32   
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             126   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  126   2e-32   Malus domestica [apple tree]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       126   3e-32   Prunus mume [ume]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  126   3e-32   Pyrus x bretschneideri [bai li]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    126   3e-32   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  126   3e-32   Gossypium arboreum [tree cotton]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             126   3e-32   Citrus sinensis [apfelsine]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             126   3e-32   Prunus persica
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   126   3e-32   Citrus sinensis [apfelsine]
gb|EMT01272.1|  Adenosylhomocysteinase                                  126   3e-32   
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             126   3e-32   Glycine max [soybeans]
gb|EMS57266.1|  Adenosylhomocysteinase                                  128   3e-32   Triticum urartu
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             125   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       126   4e-32   
dbj|BAE71233.1|  putative adenosylhomocysteinase                        125   4e-32   Trifolium pratense [peavine clover]
gb|AGT16642.1|  Adenosylhomocysteinase                                  125   5e-32   Saccharum hybrid cultivar R570
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             125   5e-32   Setaria italica
gb|ACN34730.1|  unknown                                                 125   5e-32   Zea mays [maize]
ref|NP_001148534.1|  adenosylhomocysteinase                             125   5e-32   
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             125   5e-32   Setaria italica
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     125   6e-32   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             125   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             125   8e-32   Phoenix dactylifera
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             125   8e-32   Citrus clementina [clementine]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  124   9e-32   Musa acuminata subsp. malaccensis [pisang utan]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    124   9e-32   Triticum aestivum [Canadian hard winter wheat]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       124   1e-31   Gentiana triflora
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             124   1e-31   Cucumis melo [Oriental melon]
ref|XP_003629610.1|  Adenosylhomocysteinase                             124   1e-31   Medicago truncatula
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  124   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  124   1e-31   Malus domestica [apple tree]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  124   2e-31   Fragaria vesca subsp. vesca
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                123   2e-31   Brassica rapa
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    123   3e-31   Arabis alpina [alpine rockcress]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             123   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       123   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189023.1|  adenosylhomocysteinase 2                              123   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           123   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                123   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    123   3e-31   Camelina sativa [gold-of-pleasure]
emb|CDY50106.1|  BnaC01g43540D                                          123   4e-31   Brassica napus [oilseed rape]
emb|CDY53211.1|  BnaC03g74050D                                          122   4e-31   Brassica napus [oilseed rape]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     122   5e-31   Nicotiana tabacum [American tobacco]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        122   6e-31   Cicer arietinum [garbanzo]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    122   7e-31   Petroselinum crispum
ref|NP_001234012.1|  adenosylhomocysteinase                             122   9e-31   
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             121   2e-30   Phaseolus vulgaris [French bean]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    120   5e-30   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             120   5e-30   Cucumis sativus [cucumbers]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                119   1e-29   
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  118   1e-29   Gossypium arboreum [tree cotton]
ref|XP_001755929.1|  predicted protein                                  118   2e-29   
ref|XP_001755926.1|  predicted protein                                  118   2e-29   
ref|XP_001755906.1|  predicted protein                                  118   2e-29   
gb|KJB19538.1|  hypothetical protein B456_003G108500                    117   5e-29   Gossypium raimondii
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                117   5e-29   Chlorella variabilis
ref|XP_010024046.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    115   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010024045.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    115   2e-28   
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     115   3e-28   Eucalyptus grandis [rose gum]
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              113   1e-27   Volvox carteri f. nagariensis
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      112   3e-27   Polytomella sp. Pringsheim 198.80
ref|XP_010024042.1|  PREDICTED: adenosylhomocysteinase-like             111   4e-27   Eucalyptus grandis [rose gum]
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      109   7e-27   Chlamydomonas incerta
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     111   7e-27   Eucalyptus grandis [rose gum]
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  110   2e-26   Chlamydomonas reinhardtii
gb|ABR16332.1|  unknown                                                 110   2e-26   Picea sitchensis
ref|XP_011397211.1|  Adenosylhomocysteinase                             110   3e-26   Auxenochlorella protothecoides
ref|NP_001067845.2|  Os11g0455500                                       108   8e-26   
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    108   8e-26   Ostreococcus tauri
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       108   9e-26   Chlamydomonas sp. ICE-L
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       108   1e-25   Dunaliella salina
ref|XP_001419579.1|  predicted protein                                  107   2e-25   Ostreococcus lucimarinus CCE9901
gb|KIZ05177.1|  adenosylhomocysteinase                                  109   2e-25   Monoraphidium neglectum
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    102   8e-24   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  102   9e-24   Coccomyxa subellipsoidea C-169
ref|XP_002505983.1|  adenosylhomocysteinase                             102   1e-23   Micromonas commoda
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    102   1e-23   
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     102   1e-23   Eucalyptus grandis [rose gum]
ref|XP_003057172.1|  adenosylhomocysteinase                             101   3e-23   Micromonas pusilla CCMP1545
ref|XP_010024052.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    100   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010024051.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    100   4e-23   Eucalyptus grandis [rose gum]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    100   5e-23   Eucalyptus grandis [rose gum]
ref|XP_010024040.1|  PREDICTED: adenosylhomocysteinase-like           99.4    1e-22   Eucalyptus grandis [rose gum]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                  99.0    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                   99.0    3e-22   
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                   95.1    8e-22   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                   96.7    2e-21   
ref|XP_001023087.1|  adenosylhomocysteinase family protein            95.9    3e-21   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                 95.5    5e-21   
ref|WP_036503718.1|  S-adenosyl-L-homocysteine hydrolase              95.5    5e-21   
gb|EJL28004.1|  adenosylhomocysteinase                                95.1    7e-21   
ref|XP_005708566.1|  adenosylhomocysteinase                           95.1    8e-21   
ref|WP_028480610.1|  S-adenosyl-L-homocysteine hydrolase              94.4    1e-20   
ref|XP_001756025.1|  predicted protein                                92.0    1e-20   
ref|WP_037501611.1|  S-adenosyl-L-homocysteine hydrolase              94.4    1e-20   
ref|WP_027513444.1|  S-adenosyl-L-homocysteine hydrolase              94.0    1e-20   
ref|WP_035024933.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  94.0    1e-20   
ref|WP_039843422.1|  S-adenosyl-L-homocysteine hydrolase              94.0    2e-20   
ref|WP_019170924.1|  S-adenosyl-L-homocysteine hydrolase              94.0    2e-20   
ref|WP_013528332.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  94.0    2e-20   
ref|WP_023810629.1|  S-adenosyl-L-homocysteine hydrolase              93.6    2e-20   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase              94.0    3e-20   
ref|WP_029057724.1|  S-adenosyl-L-homocysteine hydrolase              93.2    3e-20   
ref|XP_002177758.1|  adenosylhomocysteinase                           93.2    3e-20   
ref|WP_010542950.1|  S-adenosyl-L-homocysteine hydrolase              93.2    4e-20   
ref|WP_041768851.1|  S-adenosyl-L-homocysteine hydrolase              92.8    4e-20   
ref|WP_037036486.1|  S-adenosyl-L-homocysteine hydrolase              92.8    4e-20   
gb|EEA95364.1|  adenosylhomocysteinase                                92.8    5e-20   
gb|AEV35160.1|  Adenosylhomocysteinase                                92.8    5e-20   
ref|WP_024847056.1|  S-adenosyl-L-homocysteine hydrolase              92.8    5e-20   
ref|WP_022718432.1|  S-adenosyl-L-homocysteine hydrolase              92.8    5e-20   
ref|WP_027039962.1|  S-adenosyl-L-homocysteine hydrolase              92.8    5e-20   
ref|WP_029940623.1|  S-adenosyl-L-homocysteine hydrolase              92.4    6e-20   
ref|WP_017184412.1|  S-adenosyl-L-homocysteine hydrolase              92.4    6e-20   
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                   89.7    6e-20   
ref|WP_039352085.1|  adenosylhomocysteinase                           92.0    6e-20   
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                   89.7    7e-20   
ref|WP_037531002.1|  S-adenosyl-L-homocysteine hydrolase              92.4    7e-20   
ref|WP_044331133.1|  S-adenosyl-L-homocysteine hydrolase              92.4    7e-20   
ref|WP_025502770.1|  S-adenosyl-L-homocysteine hydrolase              92.0    8e-20   
ref|WP_008887166.1|  S-adenosyl-L-homocysteine hydrolase              92.0    8e-20   
ref|WP_020087971.1|  S-adenosyl-L-homocysteine hydrolase              92.0    1e-19   
ref|WP_010164156.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  92.0    1e-19   
ref|XP_002776364.1|  adenosylhomocysteinase, putative                 89.7    1e-19   
ref|WP_028737896.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
ref|WP_034852586.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
gb|AAA26094.1|  adenosylhomocysteine hydrolase                        91.7    1e-19   
ref|WP_013065796.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
ref|WP_013846693.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
ref|WP_023924304.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
ref|WP_041000040.1|  S-adenosyl-L-homocysteine hydrolase              91.7    1e-19   
ref|WP_006965090.1|  Adenosylhomocysteinase                           91.7    1e-19   
ref|WP_042637580.1|  S-adenosyl-L-homocysteine hydrolase              91.3    1e-19   
ref|WP_034481371.1|  S-adenosyl-L-homocysteine hydrolase              91.3    2e-19   
ref|WP_044211631.1|  adenosylhomocysteinase                           90.9    2e-19   
ref|WP_029724830.1|  S-adenosyl-L-homocysteine hydrolase              91.3    2e-19   
ref|WP_039343835.1|  adenosylhomocysteinase                           90.9    2e-19   
ref|WP_034510780.1|  S-adenosyl-L-homocysteine hydrolase              91.3    2e-19   
ref|WP_034716837.1|  adenosylhomocysteinase                           90.9    2e-19   
ref|WP_025560120.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  91.3    2e-19   
ref|WP_024271286.1|  S-adenosylhomocysteine hydrolase                 91.3    2e-19   
ref|WP_022683191.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_029347442.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_004127529.1|  Hypothetical protein                             90.9    2e-19   
ref|WP_027152036.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_043975355.1|  S-adenosyl-L-homocysteine hydrolase              91.3    2e-19   
ref|WP_026615254.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_034469479.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_026619449.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_028753826.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_018236125.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
ref|WP_044229607.1|  adenosylhomocysteinase                           90.5    2e-19   
ref|WP_027380615.1|  adenosylhomocysteinase                           90.5    2e-19   
ref|WP_036635601.1|  S-adenosyl-L-homocysteine hydrolase              90.9    3e-19   
ref|WP_029350387.1|  S-adenosyl-L-homocysteine hydrolase              90.5    3e-19   
ref|WP_027166955.1|  S-adenosyl-L-homocysteine hydrolase              90.5    3e-19   
ref|WP_026986030.1|  hypothetical protein                             88.6    3e-19   
gb|KIS32139.1|  S-adenosyl-L-homocysteine hydrolase                   90.5    3e-19   
ref|WP_041252454.1|  adenosylhomocysteinase                           90.1    3e-19   
ref|WP_028032027.1|  S-adenosyl-L-homocysteine hydrolase              90.5    3e-19   
gb|ACU07022.1|  Adenosylhomocysteinase                                90.5    3e-19   
emb|CDG33446.1|  Adenosylhomocysteinase                               90.1    3e-19   
ref|WP_014076680.1|  S-adenosyl-L-homocysteine hydrolase              90.5    3e-19   
ref|WP_026227710.1|  S-adenosyl-L-homocysteine hydrolase              90.5    3e-19   
ref|XP_001423621.1|  hypothetical protein                             90.5    3e-19   
ref|WP_027715052.1|  hypothetical protein                             90.5    4e-19   
ref|WP_031388366.1|  adenosylhomocysteinase                           89.7    4e-19   
ref|WP_008872784.1|  Adenosylhomocysteinase                           90.1    4e-19   
ref|WP_006325629.1|  Adenosylhomocysteinase                           90.1    4e-19   
ref|WP_002687931.1|  S-adenosyl-L-homocysteine hydrolase              89.7    4e-19   
ref|WP_038064175.1|  S-adenosyl-L-homocysteine hydrolase              90.1    5e-19   
ref|WP_027377561.1|  adenosylhomocysteinase                           89.7    5e-19   
ref|WP_002664110.1|  S-adenosyl-L-homocysteine hydrolase              89.7    5e-19   
ref|WP_041003676.1|  S-adenosyl-L-homocysteine hydrolase              90.1    5e-19   
ref|WP_024898422.1|  S-adenosyl-L-homocysteine hydrolase              90.1    5e-19   
ref|WP_021317840.1|  S-adenosyl-L-homocysteine hydrolase              89.7    5e-19   
ref|WP_026869144.1|  adenosylhomocysteinase                           89.4    5e-19   
ref|WP_037447629.1|  S-adenosyl-L-homocysteine hydrolase              89.7    5e-19   
ref|WP_023914316.1|  S-adenosyl-L-homocysteine hydrolase              89.7    5e-19   
ref|WP_009490432.1|  S-adenosyl-L-homocysteine hydrolase              89.7    5e-19   
ref|WP_008834401.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_037195540.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_006201269.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_015459987.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_040986847.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_038302894.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_013654916.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_019960547.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_037555008.1|  S-adenosyl-L-homocysteine hydrolase              89.7    6e-19   
ref|WP_007795805.1|  S-adenosyl-L-homocysteine hydrolase              89.7    7e-19   
ref|WP_010599929.1|  S-adenosyl-L-homocysteine hydrolase              89.4    7e-19   
ref|WP_043142682.1|  hypothetical protein                             83.6    7e-19   
ref|WP_006724187.1|  S-adenosyl-L-homocysteine hydrolase              89.7    7e-19   
ref|WP_022998977.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  89.4    7e-19   
ref|WP_034158458.1|  S-adenosyl-L-homocysteine hydrolase              89.7    7e-19   
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase              89.7    7e-19   
ref|WP_037418523.1|  S-adenosyl-L-homocysteine hydrolase              89.4    7e-19   
ref|WP_006935537.1|  S-adenosyl-L-homocysteine hydrolase              89.4    7e-19   
gb|KIX21766.1|  adenosylhomocysteinase                                89.4    7e-19   
ref|WP_022680057.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_025583078.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_034801698.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  89.4    8e-19   
ref|WP_007528758.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_007813750.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_038148717.1|  S-adenosyl-L-homocysteine hydrolase              87.8    8e-19   
ref|WP_044003281.1|  adenosylhomocysteinase                           89.0    8e-19   
ref|WP_026206556.1|  adenosylhomocysteinase                           89.4    8e-19   
ref|WP_023796903.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_027230903.1|  S-adenosyl-L-homocysteine hydrolase              89.4    8e-19   
ref|WP_029556181.1|  S-adenosyl-L-homocysteine hydrolase              89.4    9e-19   
ref|WP_026988234.1|  hypothetical protein                             87.4    9e-19   
ref|XP_001617956.1|  hypothetical protein NEMVEDRAFT_v1g176873        87.4    9e-19   
ref|WP_041414801.1|  S-adenosyl-L-homocysteine hydrolase              89.4    9e-19   
ref|WP_015338200.1|  adenosylhomocysteinase                           89.4    9e-19   
ref|WP_037131525.1|  S-adenosyl-L-homocysteine hydrolase              89.4    9e-19   
ref|WP_034844132.1|  adenosylhomocysteinase                           89.0    9e-19   
ref|WP_037102260.1|  S-adenosyl-L-homocysteine hydrolase              89.4    9e-19   
gb|EEG40705.1|  Adenosylhomocysteinase                                87.4    9e-19   
ref|WP_011540479.1|  S-adenosyl-L-homocysteine hydrolase              89.4    9e-19   
ref|WP_028385278.1|  adenosylhomocysteinase                           89.0    1e-18   
ref|WP_011995864.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_018859427.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_037434745.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_014245567.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_025657914.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_038660164.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
gb|KFE33445.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-18   
ref|WP_040962131.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_014330407.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_021346826.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_016199592.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_009084409.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.6    1e-18   
ref|WP_042482948.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_037390518.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_014166747.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|XP_002788757.1|  conserved hypothetical protein                   89.0    1e-18   
ref|WP_039480820.1|  adenosylhomocysteinase                           88.6    1e-18   
ref|WP_025145589.1|  adenosylhomocysteinase                           88.6    1e-18   
ref|WP_016556880.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_040972841.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
gb|AFL54411.1|  adenosylhomocysteinase AhcY                           89.0    1e-18   
ref|WP_011582886.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_012709865.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_012067452.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  89.0    1e-18   
ref|WP_024588180.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_022694004.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_038380756.1|  S-adenosyl-L-homocysteine hydrolase              86.7    1e-18   
ref|WP_035000346.1|  S-adenosyl-L-homocysteine hydrolase              89.0    1e-18   
ref|WP_029282660.1|  adenosylhomocysteinase                           88.6    1e-18   
gb|EJF91108.1|  adenosylhomocysteinase                                88.6    1e-18   
ref|XP_002784976.1|  adenosylhomocysteinase, putative                 85.1    1e-18   
ref|WP_026951335.1|  adenosylhomocysteinase                           88.6    1e-18   
ref|WP_041495401.1|  adenosylhomocysteinase                           88.6    1e-18   
ref|XP_008893590.1|  adenosylhomocysteinase                           89.0    1e-18   
ref|WP_037522953.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_029296562.1|  adenosylhomocysteinase                           88.6    1e-18   
ref|WP_025292599.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_009539181.1|  Adenosylhomocysteinase                           88.2    1e-18   
ref|WP_032130687.1|  adenosylhomocysteinase                           88.2    1e-18   
ref|WP_042372317.1|  hypothetical protein                             83.2    1e-18   
ref|WP_038075471.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_007066628.1|  S-adenosyl-L-homocysteine hydrolase              88.6    1e-18   
ref|WP_041942262.1|  adenosylhomocysteinase                           88.2    1e-18   
ref|WP_023677552.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
gb|EEQ96976.1|  adenosylhomocysteinase                                89.0    2e-18   
ref|WP_028980447.1|  adenosylhomocysteinase                           88.2    2e-18   
ref|WP_022728103.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
gb|ADX67468.1|  Adenosylhomocysteinase                                88.6    2e-18   
ref|WP_020606693.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_007009098.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_027357796.1|  adenosylhomocysteinase                           88.6    2e-18   
ref|WP_009806758.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_034970529.1|  adenosylhomocysteinase                           88.2    2e-18   
ref|WP_012091050.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.6    2e-18   
ref|WP_044347377.1|  adenosylhomocysteinase                           88.6    2e-18   
ref|WP_012048882.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.6    2e-18   
ref|WP_007698591.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.6    2e-18   
ref|WP_010657682.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_034975682.1|  adenosylhomocysteinase                           88.2    2e-18   
ref|WP_009211082.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_018620959.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_006472521.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_031439895.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_021587566.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.6    2e-18   
ref|WP_028981527.1|  adenosylhomocysteinase                           88.2    2e-18   
ref|WP_023785461.1|  S-adenosyl-L-homocysteine hydrolase              88.6    2e-18   
ref|WP_024349467.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_028793258.1|  adenosylhomocysteinase                           87.8    2e-18   
ref|WP_008993970.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_031394782.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_017978608.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_037530116.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_017665216.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_013169144.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_036282530.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_004672622.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.2    2e-18   
ref|WP_029064235.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_006217178.1|  adenosylhomocysteinase                           88.2    2e-18   
ref|WP_039367418.1|  adenosylhomocysteinase                           87.8    2e-18   
gb|ADZ88026.1|  adenosylhomocysteinase                                88.2    2e-18   
gb|ETZ21451.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    2e-18   
ref|WP_026914682.1|  adenosylhomocysteinase                           87.8    2e-18   
ref|WP_028031618.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   
ref|WP_004684548.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  88.2    2e-18   
ref|WP_039617076.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-18   



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 2/78 (3%)
 Frame = +2

Query  20   FSAHSL--PMALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQP  193
            FS  SL  PMAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQP
Sbjct  81   FSLLSLFPPMALLVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQP  140

Query  194  FKGARITGSLHITIDTAV  247
            FKGARITGSLH+TI TAV
Sbjct  141  FKGARITGSLHMTIQTAV  158



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALIVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALIVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQANFGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CRAEFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP QPFKGARITGS
Sbjct  1    MALVVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALVVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALVVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALVVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALVVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR+EFGPSQP KGARITGS
Sbjct  1    MALIVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CRAEFGP+QPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLEVE+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CRAEFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALVVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  104  MALIVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  163

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  164  LHMTIQTAV  172



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  1    MALLVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AE EMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKV+DMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+T+ TAV
Sbjct  61   LHMTVQTAV  69



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDM+QA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  63   MALLVEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS  122

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  123  LHMTIQTAV  131



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+T+ TAV
Sbjct  61   LHMTVQTAV  69



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH TI TAV
Sbjct  61   LHTTIQTAV  69



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VE TTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKTT GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+LIVEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MSLIVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VE TTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VE TTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+LIVEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MSLIVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA RAEFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKTT GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MSLLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA RAEFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTT GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAE+GPSQPFKGA+ITGS
Sbjct  1    MALVVEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT  GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAE+GP+QPFKGARITGS
Sbjct  1    MALIVEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKTT GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIV+KTT+GREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  77   MALIVDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS  136

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  137  LHMTIQTAV  145



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGP+QPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR+EFGPSQPFKGARI+GS
Sbjct  1    MALLVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MSLLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGA+ITGS
Sbjct  1    MSLLVEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
             H+TI TAV
Sbjct  61   FHMTIQTAV  69



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTA  244
            LH+TI TA
Sbjct  61   LHMTIQTA  68



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALAVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIVEKT+ GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALIVEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FG LE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGR YKVKD+SQA+FGRLE+E+AEVEMPGLM+CRAEFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA R+EFGPSQPFKGA+ITGS
Sbjct  4    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGS  63

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  64   LHMTIQTAV  72



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA R+EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDT  241
            LH+TI T
Sbjct  61   LHMTIPT  67



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQP KGARITGS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALPVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKTT+GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MSLSVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA R EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+LIV+KT+SGREYKVKDMSQA+FGRLE+++AEVEMPGLMACR EFGPSQPFKGA+ITGS
Sbjct  1    MSLIVDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+IT S
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  35   LPMALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARIT  214
             PMAL+VEKTT+GRE+KVKDMSQA+FGRLE+E+AEVEMPGLM+ R+EFGPSQPFKGARIT
Sbjct  81   FPMALLVEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARIT  140

Query  215  GSLHITIDTAV  247
            GSLH+TI TAV
Sbjct  141  GSLHMTIQTAV  151



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEV+MPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            L +TI TAV
Sbjct  61   LLMTIQTAV  69



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPG M+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKTT+GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MSLSVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGR YKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKT SGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MSLSVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT++GREYKVKD+SQA+FGRLE+E+AEVEMPGLM+CRAEFGPSQPF GARITGS
Sbjct  1    MALVVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFG SQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR+E+GPSQPFKGARI+GS
Sbjct  1    MALLVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFG SQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRL +E+AEVEMPGLMACR  FGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGARITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFG SQPFKGA+ITGS
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL V+KT+ GREYKVKDMSQA+FGRLE+++AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MALSVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+ EKT SGRE+KVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGP+QPFKGARITGS
Sbjct  1    MALLAEKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPF GARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGLM+CR EFGP QPFKGA+ITGS
Sbjct  1    MSLLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+LIVEKT +GRE KVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARITGS
Sbjct  1    MSLIVEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR+E+GPSQP KGARI+GS
Sbjct  1    MALLVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQP KGARITGS
Sbjct  23   MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGS  82

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  83   LHMTIQTAV  91



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK+ SGRE+KVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGA+ITGS
Sbjct  1    MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+++AEVEMPGLMACR EFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGP+QPFKGA+ITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK+ SGRE+KVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGA+ITGS
Sbjct  1    MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK+ SGRE+KVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGA+ITGS
Sbjct  1    MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+++AEVEMPGLMACR EFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDM+QA+FGRLE+E+AEVEMPGLM+ R EFGPSQPFKGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGARI+GS
Sbjct  310  MALSVEKTASGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGS  369

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  370  LHMTIQTAV  378



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT++GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALLVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKTT+GREYKVKD+SQA+FGRLE+E+AE+EMPGL++CR EFGPSQPFKGARITGS
Sbjct  1    MSLTVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR EFGPSQPF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPS+PF GARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKTTSGREYKVKDMS A+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MSLTVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI T V
Sbjct  61   LHMTIQTGV  69



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C AEFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+V KT+SGREYKVKD+SQA+FGRLE+E+AEVEMPGLMACR+EFGPSQP KGARI+GS
Sbjct  1    MALLVGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL V+K+ SGRE+KVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGPSQPFKGA+ITGS
Sbjct  1    MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT++GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGP++PF GARI+GS
Sbjct  1    MALLVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT+SGREYKVKD+ QA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGARI+GS
Sbjct  1    MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+V+KTT+GREYKVKDMSQA+FGRLE+E+AEVEMPGLM+ R EFGPSQPFKGA+ITGS
Sbjct  1    MSLLVDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+V+KT++GREYKVKDM+QA+FGRLE+++AEVEMPGLMACR E+GPSQPFKGA+ITGS
Sbjct  1    MSLLVDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L VEKT +GREYKV+D+SQA+FGRLE+E+AE+EMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MSLTVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  35   LPMALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARIT  214
            +  +L VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQPFKGA+IT
Sbjct  1    MATSLSVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKIT  60

Query  215  GSLHITIDTAV  247
            GSLH+TI TAV
Sbjct  61   GSLHMTIQTAV  71



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK++SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++CR EFGPSQP KGARITGS
Sbjct  1    MALSVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEK +SGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA R EFGPSQPFKGARITGS
Sbjct  1    MALSVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMSQA+FGRLE+E+AEVEMPGL++C  EFGPSQP KGARITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  59   KTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGSLHITID  238
            KTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMACR EFGPSQPFKGA+ITGSLH+TI 
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  239  TAV  247
            TAV
Sbjct  61   TAV  63



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+LIVEKT +GREYKVKD+SQA+FGRLE+E+AE+EMPGL++ R EFGPSQPFKGARITGS
Sbjct  1    MSLIVEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL VEKT +GREYKVKDMS A+FGRLE+E+AEVEMPGLM+CR EFGPSQPFKGARITGS
Sbjct  1    MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGS  60

Query  221  LHITIDTAV  247
            LH+TI T V
Sbjct  61   LHMTIQTGV  69



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKTTSGREYKVKDMSQA+FGRLE+E+AEVEMPGLMA RAEFGPSQP KGA+IT S
Sbjct  1    MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCS  60

Query  221  LHITIDTA  244
            LH+TI TA
Sbjct  61   LHMTIQTA  68



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL+VEKT+SGREYKVKDMS A+FGR+E+E+AEVEMPGL++CR EFG SQPFKG RITGS
Sbjct  1    MALLVEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+V+KT++GREYKVKDM+QA+FGRLE+++AEVEMPGLMACR E+GP+ PFKGA+ITGS
Sbjct  1    MSLLVDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M+L+V+KT++GREYKVKDM+QA+FGRLE+++AEVEMPGLMACR E+GP+ PFKGA+ITGS
Sbjct  1    MSLLVDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL + +T +GREYKVKD+SQA+FGRLE+E+AEVEMPGLMACRAEFGP+QP K ARITGS
Sbjct  1    MALTISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MALIV +T +GRE+KVKD++QA+FGRLE+E+AEVEMPGLMACRAEFGP+QP K ARITGS
Sbjct  1    MALIVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M L VEKT SGREYKV+DMSQA+FGRLE+++AEVEMPGLM+CR EFG +QPFKGA+ITGS
Sbjct  1    MELSVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M L VEKT SGREYKV+DMSQA+FGRLE+++AEVEMPGLM+CR EFG +QPFKGA+ITGS
Sbjct  1    MELSVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            M L VEKT SGREYKV+DMSQA+FGRLE+++AEVEMPGLM+CR EFG +QPFKGA+ITGS
Sbjct  1    MELSVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  41   MALIVEKTTSGREYKVKDMSQANFGRLEVEIAEVEMPGLMACRAEFGPSQPFKGARITGS  220
            MAL V +T +GRE+KVKD++QA+FGRLE+E+AEVEMPGLMACRAEFGP+QP K ARITGS
Sbjct  1    MALTVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGS  60

Query  221  LHITIDTAV  247
            LH+TI TAV
Sbjct  61   LHMTIQTAV  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175