BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF003N16

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  54.3    2e-06   Solanum lycopersicum
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  54.3    2e-06   Solanum lycopersicum
ref|XP_007039203.1|  Subtilase family protein, putative               54.3    2e-06   
gb|EMT03493.1|  Cucumisin                                             52.8    3e-06   
emb|CAE01679.2|  OSJNBb0089K24.4                                      53.5    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT17675.1|  Subtilisin-like protease                              53.1    6e-06   
gb|EMT21268.1|  Subtilisin-like protease                              52.8    7e-06   
gb|EMS49419.1|  Cucumisin                                             52.8    9e-06   Triticum urartu
dbj|BAJ96374.1|  predicted protein                                    52.0    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90143.1|  predicted protein                                    52.0    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT21267.1|  Subtilisin-like protease                              51.6    2e-05   
dbj|BAJ93156.1|  predicted protein                                    51.6    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS53237.1|  Subtilisin-like protease                              51.6    2e-05   Triticum urartu
ref|XP_003572330.1|  PREDICTED: subtilisin-like protease SBT3.5       51.6    2e-05   Brachypodium distachyon [annual false brome]
dbj|BAJ96317.1|  predicted protein                                    51.2    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH66109.1|  OSIGBa0115D20.2                                      50.4    2e-05   Oryza sativa [red rice]
emb|CAH66112.1|  OSIGBa0115D20.5                                      50.4    3e-05   Oryza sativa [red rice]
gb|EEC67681.1|  hypothetical protein OsI_35120                        51.2    3e-05   Oryza sativa Indica Group [Indian rice]
emb|CAE03676.1|  OSJNBa0042N22.20                                     47.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KJB74658.1|  hypothetical protein B456_012G000900                  50.8    3e-05   Gossypium raimondii
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5       50.8    3e-05   Vitis vinifera
gb|EMT20729.1|  Subtilisin-like protease                              50.4    4e-05   
emb|CAH66111.1|  OSIGBa0115D20.4                                      50.4    4e-05   Oryza sativa [red rice]
emb|CAE01678.2|  OSJNBb0089K24.3                                      50.4    4e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01301.2|  OSJNBa0020P07.18                                     50.4    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46832.1|  Cucumisin                                             49.7    4e-05   Triticum urartu
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3       50.4    4e-05   
ref|XP_003581117.1|  PREDICTED: subtilisin-like protease SBT3.3       50.4    4e-05   Brachypodium distachyon [annual false brome]
gb|EMT29371.1|  Cucumisin                                             49.3    5e-05   
gb|EMS68678.1|  Subtilisin-like protease                              50.1    6e-05   Triticum urartu
gb|EMS61069.1|  Subtilisin-like protease                              50.1    6e-05   Triticum urartu
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5       50.1    7e-05   Vitis vinifera
ref|XP_009420612.1|  PREDICTED: subtilisin-like protease SBT5.4       49.7    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006653122.1|  PREDICTED: xylem serine proteinase 1-like        49.7    8e-05   
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479           49.7    8e-05   
emb|CBI23085.3|  unnamed protein product                              50.1    8e-05   Vitis vinifera
ref|XP_002867836.1|  subtilase family protein                         49.7    8e-05   
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5       49.7    8e-05   
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg           49.7    9e-05   Capsella rubella
emb|CDM82077.1|  unnamed protein product                              49.7    9e-05   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ94791.1|  predicted protein                                    49.3    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_567633.2|  Subtilase family protein                            49.3    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5       49.3    1e-04   Brachypodium distachyon [annual false brome]
gb|AAX95896.1|  hypothetical protein LOC_Os11g15530                   45.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55531.1|  Subtilisin-like protease                              48.9    1e-04   Triticum urartu
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5       48.9    2e-04   Brachypodium distachyon [annual false brome]
gb|ABE66081.1|  subtilase family protein                              48.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg              48.5    2e-04   Erythranthe guttata [common monkey flower]
emb|CDY67954.1|  BnaAnng25710D                                        48.5    2e-04   Brassica napus [oilseed rape]
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  48.5    2e-04   Brassica rapa
gb|EAY91723.1|  hypothetical protein OsI_13365                        45.8    2e-04   Oryza sativa Indica Group [Indian rice]
emb|CDX94251.1|  BnaC02g29110D                                        48.5    2e-04   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5       48.5    2e-04   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like         48.5    2e-04   Oryza brachyantha
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg           48.1    2e-04   
ref|XP_002867838.1|  subtilase family protein                         48.1    2e-04   
ref|XP_009387941.1|  PREDICTED: subtilisin-like protease Glyma18g...  48.1    2e-04   
ref|XP_002447443.1|  hypothetical protein SORBIDRAFT_06g001140        48.1    3e-04   
ref|NP_193895.2|  Subtilase family protein                            48.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567632.1|  Subtilase family protein                            48.1    3e-04   
ref|XP_009387964.1|  PREDICTED: subtilisin-like protease SBT5.3       48.1    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAG98391.1|  unnamed protein product                              45.4    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg           48.1    3e-04   
ref|XP_010436456.1|  PREDICTED: subtilisin-like protease SBT3.5       47.8    3e-04   
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...  47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05597.1|  hypothetical protein F775_15512                       44.7    3e-04   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                   47.8    3e-04   Eucalyptus grandis [rose gum]
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3       47.8    3e-04   Eucalyptus grandis [rose gum]
emb|CDX93811.1|  BnaA09g24110D                                        47.8    3e-04   
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3       47.8    3e-04   
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3       47.8    3e-04   Brassica rapa
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg           47.8    4e-04   Capsella rubella
emb|CAN80173.1|  hypothetical protein VITISV_018392                   47.8    4e-04   Vitis vinifera
ref|NP_001046518.1|  Os02g0270200                                     47.4    4e-04   
emb|CDY54842.1|  BnaC05g51310D                                        47.8    4e-04   Brassica napus [oilseed rape]
ref|XP_002891020.1|  subtilase family protein                         47.8    4e-04   
gb|EEE56708.1|  hypothetical protein OsJ_06199                        47.4    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046522.1|  Os02g0271000                                     47.4    4e-04   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3       47.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002872522.1|  subtilase family protein                         47.4    4e-04   
ref|NP_001172893.1|  Os02g0270933                                     47.8    4e-04   
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg           47.4    4e-04   Eutrema salsugineum [saltwater cress]
ref|NP_001046517.1|  Os02g0269600                                     47.4    5e-04   
gb|EEC72887.1|  hypothetical protein OsI_06697                        47.4    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like         47.4    5e-04   Setaria italica
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg           47.4    5e-04   Eutrema salsugineum [saltwater cress]
gb|EMS63058.1|  Subtilisin-like protease                              47.4    5e-04   Triticum urartu
ref|XP_008351708.1|  PREDICTED: cucumisin-like                        46.2    5e-04   
gb|EMT00503.1|  Subtilisin-like protease                              47.0    5e-04   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                  47.4    6e-04   Arabis alpina [alpine rockcress]
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5       47.0    6e-04   Vitis vinifera
emb|CBI23086.3|  unnamed protein product                              47.0    6e-04   Vitis vinifera
gb|KJB52411.1|  hypothetical protein B456_008G260500                  47.0    6e-04   Gossypium raimondii
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5       47.0    6e-04   Sesamum indicum [beniseed]
ref|XP_008780550.1|  PREDICTED: cucumisin-like                        44.3    6e-04   Phoenix dactylifera
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...  47.0    7e-04   Sisymbrium irio
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5       46.6    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  46.6    8e-04   
ref|XP_002867837.1|  subtilase family protein                         46.6    8e-04   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3       46.6    8e-04   Brassica rapa
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5       47.0    8e-04   
ref|NP_001130788.1|  putative subtilase family protein precursor      46.6    8e-04   Zea mays [maize]
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3       46.6    8e-04   
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4       46.6    8e-04   Phoenix dactylifera
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg           46.6    9e-04   Eutrema salsugineum [saltwater cress]
ref|XP_002874634.1|  subtilase family protein                         46.6    0.001   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg           46.6    0.001   Eutrema salsugineum [saltwater cress]
ref|XP_002891021.1|  predicted protein                                46.6    0.001   Arabidopsis lyrata subsp. lyrata



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A +ESKV+IVYMG RQHDDV+  TS HH +LTSV
Sbjct  28   SQANAESKVHIVYMGRRQHDDVELATSAHHQLLTSV  63



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A +ESKV+IVYMG RQHDDV+  TS HH +LTSV
Sbjct  28   SQANAESKVHIVYMGRRQHDDVELATSAHHQLLTSV  63



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A S S VYIVYMG RQH DV+R+T THH+ML++V
Sbjct  34   ADSNSNVYIVYMGKRQHPDVERLTRTHHEMLSTV  67



>gb|EMT03493.1| Cucumisin [Aegilops tauschii]
Length=287

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG +QHDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYIVYMGEKQHDDPSVVTASHHDVLTSV  55



>emb|CAE01679.2| OSJNBb0089K24.4 [Oryza sativa Japonica Group]
 gb|EAZ29527.1| hypothetical protein OsJ_13598 [Oryza sativa Japonica Group]
Length=756

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  116  YTSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            Y     +S++YIVY+G RQH+D D +T++HHDMLTS+
Sbjct  26   YGLQTDQSRLYIVYLGERQHEDADLVTASHHDMLTSI  62



>gb|EMT17675.1| Subtilisin-like protease [Aegilops tauschii]
Length=738

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +  L + +VYIVY+G RQH+DV  +TS HHD+LTSV
Sbjct  28   SQGLKQRRVYIVYLGERQHEDVSLVTSLHHDLLTSV  63



>gb|EMT21268.1| Subtilisin-like protease [Aegilops tauschii]
Length=740

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHDMLTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSVVTASHHDMLTSV  55



>gb|EMS49419.1| Cucumisin [Triticum urartu]
Length=826

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVY+G ++HDD   +T++HHDMLTSV
Sbjct  19   SAKASSKLYIVYLGEKEHDDPSMVTASHHDMLTSV  53



>dbj|BAJ96374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=734

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+Y+VYMG +QHDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYVVYMGEKQHDDPSVVTASHHDVLTSV  55



>dbj|BAJ90143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=734

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+Y+VYMG +QHDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYVVYMGEKQHDDPSVVTASHHDVLTSV  55



>gb|EMT21267.1| Subtilisin-like protease [Aegilops tauschii]
Length=707

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   + ++HHDMLTSV
Sbjct  21   SATASSKLYIVYMGEKKHDDPSVVIASHHDMLTSV  55



>dbj|BAJ93156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=736

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSAVTASHHDILTSV  55



>gb|EMS53237.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSAVTASHHDILTSV  55



>ref|XP_003572330.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=730

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SKVYIVYMG +QHDD   +T +HHD+LTSV
Sbjct  26   SKVYIVYMGQKQHDDPSEVTVSHHDVLTSV  55



>dbj|BAJ96317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVY+G ++HDD   +T++HHD+LTSV
Sbjct  19   SAKASSKIYIVYLGEKKHDDPSMVTASHHDILTSV  53



>emb|CAH66109.1| OSIGBa0115D20.2 [Oryza sativa Indica Group]
 emb|CAH65954.1| H0716A07.12 [Oryza sativa Indica Group]
Length=323

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+YIVY+G R+HDD D +T +HHDML SV
Sbjct  38   KIYIVYLGERRHDDADVVTGSHHDMLASV  66



>emb|CAH66112.1| OSIGBa0115D20.5 [Oryza sativa Indica Group]
Length=333

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  134  ESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +S++YIVY+G RQ +D D +T++HHDMLTS+
Sbjct  32   QSRLYIVYLGERQQEDADLVTASHHDMLTSI  62



>gb|EEC67681.1| hypothetical protein OsI_35120 [Oryza sativa Indica Group]
Length=752

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +K+YIVY+G R+HDD D +T++HHDML SV
Sbjct  35   TKLYIVYLGERRHDDADLVTASHHDMLASV  64



>emb|CAE03676.1| OSJNBa0042N22.20 [Oryza sativa Japonica Group]
 emb|CAE76047.1| B1248C03.6 [Oryza sativa Japonica Group]
Length=85

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+YI+Y+G R+HDD D +T +HHDML SV
Sbjct  38   KIYIIYLGERRHDDPDIVTGSHHDMLASV  66



>gb|KJB74658.1| hypothetical protein B456_012G000900 [Gossypium raimondii]
Length=778

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 2/36 (6%)
 Frame = +2

Query  125  ALSESK--VYIVYMGARQHDDVDRITSTHHDMLTSV  226
            AL++SK  VYIVYMG RQH DV+ +T THHDML +V
Sbjct  34   ALADSKRNVYIVYMGKRQHLDVELLTRTHHDMLVTV  69



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            T A ++SK++IVY+G RQH D + IT+THH+MLT+V
Sbjct  29   TPAQAKSKIHIVYLGMRQHHDPELITNTHHEMLTTV  64



>gb|EMT20729.1| Subtilisin-like protease [Aegilops tauschii]
Length=827

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++H+D   +T+THHD+LTSV
Sbjct  21   SANASSKLYIVYMGEKKHEDPSVVTATHHDILTSV  55



>emb|CAH66111.1| OSIGBa0115D20.4 [Oryza sativa Indica Group]
Length=751

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +K+YIVY+G R+HDD D +T +HHDML SV
Sbjct  35   TKLYIVYLGERRHDDADLVTDSHHDMLASV  64



>emb|CAE01678.2| OSJNBb0089K24.3 [Oryza sativa Japonica Group]
 gb|EAZ29525.1| hypothetical protein OsJ_13596 [Oryza sativa Japonica Group]
Length=752

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +K+YIVY+G R+HDD D +T +HHDML SV
Sbjct  35   TKLYIVYLGERRHDDADLVTDSHHDMLASV  64



>emb|CAE01301.2| OSJNBa0020P07.18 [Oryza sativa Japonica Group]
Length=755

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+YIVY+G R+HDD D +T +HHDML SV
Sbjct  38   KIYIVYLGERRHDDADVVTGSHHDMLASV  66



>gb|EMS46832.1| Cucumisin [Triticum urartu]
Length=349

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  22   ADASSKLYIVYMGEKKHDDPSMVTASHHDILTSV  55



>ref|XP_003581342.1| PREDICTED: subtilisin-like protease SBT3.3 [Brachypodium distachyon]
Length=740

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  21   SAHASSKLYIVYMGDKKHDDPTVVTASHHDVLTSV  55



>ref|XP_003581117.1| PREDICTED: subtilisin-like protease SBT3.3 [Brachypodium distachyon]
Length=742

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  21   SAHASSKLYIVYMGDKKHDDPTVVTASHHDVLTSV  55



>gb|EMT29371.1| Cucumisin [Aegilops tauschii]
Length=321

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + SK+YIVYMG ++HDD   +T +HHD+LTSV
Sbjct  21   ASSKLYIVYMGGKKHDDPSMVTESHHDVLTSV  52



>gb|EMS68678.1| Subtilisin-like protease [Triticum urartu]
Length=738

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++H DMLTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSMVTASHRDMLTSV  55



>gb|EMS61069.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++H DMLTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSMVTASHRDMLTSV  55



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A ++SKV+IVY+G RQH D + IT+THH+MLT+V
Sbjct  29   SPAQAKSKVHIVYLGKRQHHDPEFITNTHHEMLTTV  64



>ref|XP_009420612.1| PREDICTED: subtilisin-like protease SBT5.4 [Musa acuminata subsp. 
malaccensis]
Length=741

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            T A + +K+YIVY+G R+H++ D +T++HHDMLTS+
Sbjct  26   TEAEAGAKLYIVYLGERKHENPDHVTASHHDMLTSL  61



>ref|XP_006653122.1| PREDICTED: xylem serine proteinase 1-like [Oryza brachyantha]
Length=746

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +  K+Y+VY+G +QHDD +R T++HHDMLT++
Sbjct  37   AAKKLYVVYLGEKQHDDPERTTASHHDMLTAI  68



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G RQHDD D +T +HH ML S+
Sbjct  20   AETKVHIVYLGERQHDDPDSVTESHHQMLWSI  51



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  119   TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
             + A ++SKV+IVY+G RQH D + IT+THH+MLT+V
Sbjct  1157  SPAQAKSKVHIVYLGKRQHHDPEFITNTHHEMLTTV  1192



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  104  NANVYTSAL-SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            N ++   AL S+SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  27   NFHIAAGALDSDSKVYIVYLGEREHDDPELVTASHHQMLESL  68



>ref|XP_010931718.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=740

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + +K+YIVYMG R+H+D + +T++HHD+LTS+
Sbjct  27   AEASTKLYIVYMGERKHEDPNHVTASHHDLLTSI  60



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  NANVYTSALSESKVYIVYMGARQHDDVDRITSTHHDML  217
            N  + TSA  ES++Y V++G RQHDD D +T +HHD+L
Sbjct  28   NIALITSANEESQIYTVHLGMRQHDDPDLVTESHHDIL  65



>emb|CDM82077.1| unnamed protein product [Triticum aestivum]
Length=736

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T+ HHD+LTSV
Sbjct  21   SANASSKLYIVYMGEKKHDDPSVVTAWHHDILTSV  55



>dbj|BAJ94791.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=738

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + SK+YIVYMG ++HDD   +T++HHD+LTSV
Sbjct  24   ASSKLYIVYMGEKKHDDPSMVTASHHDVLTSV  55



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S+SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   SDSKVYIVYLGEREHDDPELVTASHHQMLESL  68



>ref|XP_003572336.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=739

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVY+G ++HDD   +T++HHD+LTSV
Sbjct  21   SANASSKLYIVYLGEKKHDDPTVVTASHHDVLTSV  55



>gb|AAX95896.1| hypothetical protein LOC_Os11g15530 [Oryza sativa Japonica Group]
 gb|AAX96794.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABA92457.1| hypothetical protein LOC_Os11g15530 [Oryza sativa Japonica Group]
Length=73

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  125  ALSESK-VYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A  E+K +YIVY+G RQH+D D +T++HH ML +V
Sbjct  33   APGEAKELYIVYLGERQHEDADLVTASHHTMLATV  67



>gb|EMS55531.1| Subtilisin-like protease [Triticum urartu]
Length=700

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   + ++HHDMLT V
Sbjct  21   SASASSKLYIVYMGEKKHDDPSVVIASHHDMLTPV  55



>ref|XP_003572346.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=736

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + SK+YIVYMG ++HDD   +T++HHD+LT V
Sbjct  20   SASASSKLYIVYMGEKKHDDPTMVTASHHDVLTIV  54



>gb|ABE66081.1| subtilase family protein [Arabidopsis thaliana]
Length=301

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   SNSKVYIVYLGQREHDDPELLTASHHQMLESL  68



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S VYIVY+G RQHDD   +T +HHDMLT++
Sbjct  34   SNVYIVYLGERQHDDPKLVTDSHHDMLTTL  63



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A++ESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  28   AVAESKVHIVYLGQKQHDDPEFVTESHHQMLCSL  61



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A++ESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  28   AVAESKVHIVYLGQKQHDDPEFVTESHHQMLCSL  61



>gb|EAY91723.1| hypothetical protein OsI_13365 [Oryza sativa Indica Group]
Length=143

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  25   ASSRLYIVYMGEKKHDDPSVVTASHHDALTSV  56



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A++ESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  28   AVAESKVHIVYLGEKQHDDPEFVTESHHQMLCSL  61



>ref|XP_010920365.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=722

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A    K+YIVYMG +QH+D + +T++HHDMLTS+
Sbjct  5    AEESRKLYIVYMGEKQHEDPNLVTASHHDMLTSL  38



>ref|XP_006653124.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=749

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+Y+VY+G +QHDD ++ T++HHDMLT++
Sbjct  42   KLYVVYLGPKQHDDPEKTTASHHDMLTTI  70



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  110  NVYTS-ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            NV TS  ++E+KVY+VY+G ++HDD++ +T +HH +L S+
Sbjct  17   NVQTSFVVAETKVYVVYLGEKKHDDIESVTESHHQILWSL  56



>ref|XP_002867838.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44097.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   SNSKVYIVYLGEREHDDPELVTASHHQMLESL  68



>ref|XP_009387941.1| PREDICTED: subtilisin-like protease Glyma18g48580, partial [Musa 
acuminata subsp. malaccensis]
Length=521

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S   +YIVYMG RQH+D + +T++HHDML+SV
Sbjct  31   STKLLYIVYMGERQHEDPNLVTASHHDMLSSV  62



>ref|XP_002447443.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
 gb|EES11771.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
Length=771

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +2

Query  131  SESK-VYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SE K  YI+Y+G R+HDDVD +T++HHD+L S+
Sbjct  44   SEPKQTYIIYLGDREHDDVDLVTASHHDLLASI  76



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   SNSKVYIVYLGQREHDDPELLTASHHQMLESL  68



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S+SKVYIVY+G R+HDD +  T++HH ML S+
Sbjct  35   SDSKVYIVYLGEREHDDPELFTASHHQMLESL  66



>ref|XP_009387964.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S   +YIVYMG RQH+D + +T++HHDML+SV
Sbjct  31   STKLLYIVYMGERQHEDPNLVTASHHDMLSSV  62



>dbj|BAG98391.1| unnamed protein product [Oryza sativa Japonica Group]
Length=129

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+Y+VY+G +QH+D ++ T++HHDMLT++
Sbjct  38   KLYVVYLGDKQHEDPEQTTASHHDMLTAI  66



>ref|XP_006289363.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
 gb|EOA22261.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
Length=789

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A SESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  41   AGSESKVHIVYLGEKQHDDRESVTESHHQMLWSL  74



>ref|XP_010436456.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=561

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   NDSKVYIVYLGKREHDDPELVTASHHQMLESL  68



>ref|NP_174573.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AAF31279.1|AC006424_8 Fourth of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
 gb|AEE31545.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=734

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G +QHDD D +T +HH ML S+
Sbjct  20   AETKVHIVYLGEKQHDDPDSVTESHHQMLWSI  51



>gb|EMT05597.1| hypothetical protein F775_15512 [Aegilops tauschii]
Length=81

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + SK+YIVYMG ++HDD   + ++HHD+LTSV
Sbjct  23   TSSKLYIVYMGEKKHDDPSVVIASHHDILTSV  54



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLT  220
            T  L+ S VYIVYMGARQHD+ + ++ +HH++L+
Sbjct  22   TGVLASSNVYIVYMGARQHDEPELVSESHHEILS  55



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLT  220
            T  L+ S VYIVYMGARQHD+ + ++ +HH++L+
Sbjct  45   TGVLASSNVYIVYMGARQHDEPELVSESHHEILS  78



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A +ESKV+IVY+G +QHDD   +T +HH ML+S+
Sbjct  23   AGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSL  56



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++SKVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   NDSKVYIVYLGKREHDDPELVTASHHQMLESL  68



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A +ESKV+IVY+G +QHDD   +T +HH ML+S+
Sbjct  23   AGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSL  56



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G RQHD+ D +T +HH ML S+
Sbjct  20   AETKVHIVYLGERQHDNPDSVTESHHQMLWSI  51



>emb|CAN80173.1| hypothetical protein VITISV_018392 [Vitis vinifera]
Length=928

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
             +S S V+IVY+G RQH D + IT+THH+MLT+V
Sbjct  847  GISTSPVHIVYLGKRQHHDPEFITNTHHEMLTTV  880



>ref|NP_001046518.1| Os02g0270200 [Oryza sativa Japonica Group]
 dbj|BAF08432.1| Os02g0270200 [Oryza sativa Japonica Group]
Length=496

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  25   ADASSRLYIVYMGEKKHDDPSVVTASHHDALTSV  58



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A +ESKV+IVY+G +QHDD   +T +HH ML+S+
Sbjct  23   AGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSL  56



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A  ESKV+IVY+G +QHDD + +T +HH ML+S+
Sbjct  23   ASDESKVHIVYLGEKQHDDPEFVTESHHQMLSSL  56



>gb|EEE56708.1| hypothetical protein OsJ_06199 [Oryza sativa Japonica Group]
Length=755

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  25   ADASSRLYIVYMGEKKHDDPSVVTASHHDALTSV  58



>ref|NP_001046522.1| Os02g0271000 [Oryza sativa Japonica Group]
 dbj|BAD29425.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08436.1| Os02g0271000 [Oryza sativa Japonica Group]
 gb|EAY85322.1| hypothetical protein OsI_06700 [Oryza sativa Indica Group]
 gb|EAZ22534.1| hypothetical protein OsJ_06201 [Oryza sativa Japonica Group]
 dbj|BAG92819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=738

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  21   ASSRLYIVYMGEKKHDDPSVVTASHHDTLTSV  52



>ref|XP_009391853.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  101  QNANVYTSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            Q A +  +  S   +YIVYMG RQH+D D +T++HHD ++SV
Sbjct  21   QMAALGRTPSSSKLLYIVYMGGRQHEDPDLVTASHHDTMSSV  62



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  128  LSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++ESKVYIVY+G ++HD+ + +T +HH ML+S+
Sbjct  24   VAESKVYIVYLGEKEHDNPESVTESHHQMLSSL  56



>ref|NP_001172893.1| Os02g0270933 [Oryza sativa Japonica Group]
 dbj|BAH91622.1| Os02g0270933 [Oryza sativa Japonica Group]
Length=1200

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  23   ANASSRLYIVYMGEKKHDDPSVVTASHHDALTSV  56



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A ++SKV+IVY+G +QHDD D +T +HH +L+SV
Sbjct  29   SRADAKSKVHIVYLGEKQHDDPDFVTESHHQILSSV  64



>ref|NP_001046517.1| Os02g0269600 [Oryza sativa Japonica Group]
 dbj|BAD28637.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08431.1| Os02g0269600 [Oryza sativa Japonica Group]
 gb|EAY85318.1| hypothetical protein OsI_06696 [Oryza sativa Indica Group]
 gb|EAZ22529.1| hypothetical protein OsJ_06196 [Oryza sativa Japonica Group]
Length=735

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  122  SALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            SA + +K+YIVYMG ++HDD   +T++HHD LT V
Sbjct  23   SASASTKLYIVYMGEKKHDDPSMVTASHHDALTFV  57



>gb|EEC72887.1| hypothetical protein OsI_06697 [Oryza sativa Indica Group]
Length=785

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + S++YIVYMG ++HDD   +T++HHD LTSV
Sbjct  46   ADASSRLYIVYMGEKKHDDPSVVTASHHDALTSV  79



>ref|XP_004978766.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=743

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + SK+YIVYMG ++HDD   +T++HHD+L SV
Sbjct  23   ANASSKLYIVYMGEKKHDDPSVVTASHHDVLASV  56



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  134  ESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            E+KVYIVYMG R+HDD + +T++H DML S+
Sbjct  33   ETKVYIVYMGERKHDDPELVTASHLDMLESL  63



>gb|EMS63058.1| Subtilisin-like protease [Triticum urartu]
Length=741

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            K+YIVY+G ++HDD   +TS+HHDMLT++
Sbjct  32   KLYIVYLGEKKHDDPSLVTSSHHDMLTTI  60



>ref|XP_008351708.1| PREDICTED: cucumisin-like [Malus domestica]
Length=237

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            T   ++S V+IVYMG RQHD+   IT +HHD+L +V
Sbjct  23   TRVAAKSHVHIVYMGDRQHDNTKLITDSHHDLLATV  58



>gb|EMT00503.1| Subtilisin-like protease [Aegilops tauschii]
Length=586

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + SK+YIVYMG ++HDD   + ++HHD+LTSV
Sbjct  23   TSSKLYIVYMGEKKHDDPSVVIASHHDILTSV  54



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  128  LSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +S SKV+IVY+G +QHDD + +T +HH ML+S+
Sbjct  26   ISSSKVHIVYLGEKQHDDPEFVTDSHHQMLSSL  58



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A  +SKV+IVY+G RQH D + IT+ HH+MLT+V
Sbjct  29   SPAQPKSKVHIVYLGKRQHHDPELITNIHHEMLTTV  64



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  119  TSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            + A  +SKV+IVY+G RQH D + IT+ HH+MLT+V
Sbjct  95   SPAQPKSKVHIVYLGKRQHHDPELITNIHHEMLTTV  130



>gb|KJB52411.1| hypothetical protein B456_008G260500 [Gossypium raimondii]
Length=822

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++S V+IVY+G RQHDD  R+T +HHD+L ++
Sbjct  76   AKSTVHIVYLGERQHDDPKRVTDSHHDLLATL  107



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  137  SKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +K YIVYMG R+H DV+ +T +HH+ML SV
Sbjct  46   TKAYIVYMGERKHKDVELVTKSHHEMLASV  75



>ref|XP_008780550.1| PREDICTED: cucumisin-like, partial [Phoenix dactylifera]
Length=115

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +YIVYMG ++H+D D++T++HHD+L S+
Sbjct  1    LYIVYMGEKEHEDPDQVTASHHDLLISL  28



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  134  ESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            E KVY+VY+GA+QHDD   ++ +HH ML SV
Sbjct  32   EKKVYVVYLGAKQHDDPKLVSESHHKMLESV  62



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G RQHD  D +T +HH ML S+
Sbjct  20   AETKVHIVYLGERQHDHPDSVTESHHQMLWSI  51



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G RQHD  D +T +HH ML S+
Sbjct  20   AETKVHIVYLGERQHDHPDSVTESHHQMLWSI  51



>ref|XP_002867837.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44096.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            S +KVYIVY+G R+HDD + +T++HH ML S+
Sbjct  37   SNNKVYIVYIGQREHDDPELVTASHHQMLESL  68



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++SKVYIVY+G R HDD + +T++HH+ML S+
Sbjct  38   NDSKVYIVYLGERVHDDPELVTASHHEMLESL  69



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A +ESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  782  AGAESKVHIVYLGEKQHDDPESVTESHHQMLWSL  815



>ref|NP_001130788.1| putative subtilase family protein precursor [Zea mays]
 gb|ACF79142.1| unknown [Zea mays]
 gb|AFW77339.1| putative subtilase family protein [Zea mays]
Length=775

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++YI+Y+G RQ DD D +T++HHD+L SV
Sbjct  41   QIYIIYLGGRQSDDADLVTASHHDLLASV  69



>ref|XP_008663777.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Zea mays]
Length=779

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            ++YI+Y+G RQ DD D +T++HHD+L SV
Sbjct  45   QIYIIYLGGRQSDDADLVTASHHDLLASV  73



>ref|XP_008804316.1| PREDICTED: subtilisin-like protease SBT5.4 [Phoenix dactylifera]
Length=762

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A + +K+YIVY+G R+H+D +  T++HHD+LTS+
Sbjct  49   AEASTKLYIVYLGERKHEDPNHATASHHDLLTSI  82



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTS  223
            + SKVYIVY+G R+HDD + +T++HH ML S
Sbjct  37   NNSKVYIVYLGEREHDDPEVVTASHHQMLES  67



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  113  VYTSALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            V   A +ESKV+IVY+G +QHDD + +T +HH ML S+
Sbjct  26   VVVQAGAESKVHIVYLGEKQHDDPEFVTKSHHRMLWSL  63



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  131  SESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            +E+KV+IVY+G RQHDD   +T +HH ML S+
Sbjct  25   AETKVHIVYLGERQHDDPASVTESHHQMLWSI  56



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  ALSESKVYIVYMGARQHDDVDRITSTHHDMLTSV  226
            A ++SKV+IVY+G +QHDD + +T +HH ML+S+
Sbjct  23   ASAKSKVHIVYLGEKQHDDPEFVTESHHQMLSSL  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590