BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF003C05

Length=363
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    135   2e-34   
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    131   5e-33   Vitis vinifera
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    130   2e-32   Sesamum indicum [beniseed]
emb|CAN71280.1|  hypothetical protein VITISV_027089                     129   4e-32   Vitis vinifera
emb|CDP01464.1|  unnamed protein product                                128   9e-32   Coffea canephora [robusta coffee]
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    126   6e-31   Solanum tuberosum [potatoes]
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    125   7e-31   Solanum lycopersicum
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    125   1e-30   Solanum tuberosum [potatoes]
ref|XP_007051241.1|  TolB protein-related isoform 2                     122   3e-30   
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                123   6e-30   Erythranthe guttata [common monkey flower]
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    122   1e-29   Solanum lycopersicum
ref|XP_007051240.1|  TolB protein-related isoform 1                     121   3e-29   
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          119   2e-28   Amborella trichopoda
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    119   2e-28   Nicotiana tomentosiformis
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    118   3e-28   Cucumis melo [Oriental melon]
gb|KJB09508.1|  hypothetical protein B456_001G146700                    118   4e-28   Gossypium raimondii
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    117   7e-28   Nicotiana sylvestris
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    116   2e-27   Elaeis guineensis
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    115   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    115   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    115   5e-27   Prunus mume [ume]
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          114   1e-26   
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    114   1e-26   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             114   2e-26   
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    113   2e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   112   5e-26   Citrus sinensis [apfelsine]
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    112   7e-26   Fragaria vesca subsp. vesca
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    110   2e-25   Cucumis sativus [cucumbers]
gb|KCW58168.1|  hypothetical protein EUGRSUZ_H008851                    107   2e-25   Eucalyptus grandis [rose gum]
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     110   2e-25   Eucalyptus grandis [rose gum]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         110   3e-25   Jatropha curcas
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    110   3e-25   Glycine max [soybeans]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    109   6e-25   Eucalyptus grandis [rose gum]
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    108   7e-25   Phoenix dactylifera
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     108   8e-25   Eucalyptus grandis [rose gum]
gb|AJD80981.1|  ABA-activated 1 protein                                 108   1e-24   Lupinus luteus
gb|EPS68684.1|  hypothetical protein M569_06083                         108   1e-24   Genlisea aurea
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     107   2e-24   Eucalyptus grandis [rose gum]
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          107   2e-24   Sorghum bicolor [broomcorn]
ref|XP_010091406.1|  hypothetical protein L484_013861                   107   3e-24   
ref|XP_002515212.1|  conserved hypothetical protein                     107   3e-24   Ricinus communis
ref|NP_192096.1|  tolB-related protein                                  106   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13860.1|  unknown protein                                         106   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396381.1|  hypothetical protein EUTSA_v10029172mg             103   1e-23   
ref|XP_003637684.1|  Protein tolB                                       104   3e-23   
emb|CDX74396.1|  BnaA03g26510D                                          104   3e-23   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    104   3e-23   Brassica rapa
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             103   4e-23   
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             103   4e-23   Phaseolus vulgaris [French bean]
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_003637686.1|  Protein tolB                                       103   5e-23   
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    103   6e-23   Cicer arietinum [garbanzo]
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             103   9e-23   
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             102   2e-22   
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    102   2e-22   Setaria italica
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    101   4e-22   Pyrus x bretschneideri [bai li]
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          100   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    100   8e-22   Zea mays [maize]
gb|EAZ04851.1|  hypothetical protein OsI_27029                          100   9e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001060406.1|  Os07g0638100                                       100   1e-21   
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                  99.8    1e-21   Arabis alpina [alpine rockcress]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922  99.4    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738  97.4    4e-21   Oryza brachyantha
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg           98.2    4e-21   Capsella rubella
dbj|BAJ89339.1|  predicted protein                                    95.9    4e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94262.1|  predicted protein                                    95.5    4e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949  94.4    1e-19   
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199  89.4    8e-18   Brachypodium distachyon [annual false brome]
dbj|BAJ88545.1|  predicted protein                                    83.6    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...  82.0    2e-15   Coccomyxa subellipsoidea C-169
ref|NP_001051846.1|  Os03g0840200                                     76.3    2e-13   
ref|XP_002448903.1|  hypothetical protein SORBIDRAFT_05g001167        71.2    3e-13   
gb|EAY92514.1|  hypothetical protein OsI_14253                        75.1    6e-13   Oryza sativa Indica Group [Indian rice]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                        74.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730  73.9    1e-12   Setaria italica
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622           73.2    3e-12   
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160  72.4    5e-12   
gb|EAY93383.1|  hypothetical protein OsI_15178                        67.8    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018  67.8    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528  67.4    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097  67.0    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...  66.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...  66.6    5e-10   
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405           65.9    8e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    9e-10   Eucalyptus grandis [rose gum]
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                   65.9    9e-10   Eucalyptus grandis [rose gum]
ref|NP_564146.1|  uncharacterized protein                             65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g           65.1    2e-09   Phaseolus vulgaris [French bean]
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336  64.7    2e-09   Elaeis guineensis
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729  64.3    2e-09   Zea mays [maize]
gb|KJB29176.1|  hypothetical protein B456_005G088400                  63.5    6e-09   Gossypium raimondii
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008  63.2    7e-09   Brassica rapa
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096  62.0    2e-08   Cicer arietinum [garbanzo]
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    3e-08   
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456  61.2    3e-08   Sesamum indicum [beniseed]
emb|CDY04661.1|  BnaC05g16990D                                        60.8    4e-08   
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655  60.1    8e-08   Nelumbo nucifera [Indian lotus]
emb|CDY08187.1|  BnaA06g15390D                                        59.7    1e-07   Brassica napus [oilseed rape]
gb|KHN46997.1|  Replication factor C subunit 4                        58.9    1e-07   Glycine soja [wild soybean]
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880        57.8    4e-07   Sorghum bicolor [broomcorn]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg              57.4    7e-07   Erythranthe guttata [common monkey flower]
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865  55.8    2e-06   Glycine max [soybeans]
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                  55.8    2e-06   Arabis alpina [alpine rockcress]
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg           55.5    3e-06   Eutrema salsugineum [saltwater cress]
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                  55.5    3e-06   Arabis alpina [alpine rockcress]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324  54.7    4e-06   Solanum lycopersicum
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763  54.7    5e-06   Populus euphratica
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088  54.3    6e-06   Cucumis melo [Oriental melon]
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg           54.3    6e-06   Eutrema salsugineum [saltwater cress]
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760  53.9    8e-06   Populus euphratica
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g           53.9    9e-06   Populus trichocarpa [western balsam poplar]
emb|CDP10970.1|  unnamed protein product                              53.1    1e-05   Coffea canephora [robusta coffee]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg           53.1    1e-05   Capsella rubella
gb|KDP32822.1|  hypothetical protein JCGZ_12114                       53.1    1e-05   Jatropha curcas
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010  52.8    2e-05   Brassica rapa
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein              52.8    2e-05   
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603           52.8    2e-05   
emb|CDY04662.1|  BnaC05g17000D                                        52.8    2e-05   
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                 52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727  52.0    3e-05   
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978  52.0    3e-05   Nicotiana sylvestris
ref|XP_003630471.1|  Protein tolB                                     51.6    4e-05   
gb|ABR17080.1|  unknown                                               51.2    6e-05   Picea sitchensis
ref|XP_002520326.1|  conserved hypothetical protein                   50.8    9e-05   Ricinus communis
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880  50.8    9e-05   Nicotiana tomentosiformis
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058  50.1    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782           50.1    1e-04   Selaginella moellendorffii
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673  50.1    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...  49.7    2e-04   Tarenaya hassleriana [spider flower]
emb|CDX84088.1|  BnaC08g07650D                                        49.7    2e-04   
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...  49.7    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505  49.3    2e-04   Camelina sativa [gold-of-pleasure]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                 49.3    2e-04   Citrus sinensis [apfelsine]
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406           49.3    2e-04   
emb|CDP10971.1|  unnamed protein product                              49.3    3e-04   Coffea canephora [robusta coffee]
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753  49.3    3e-04   Solanum tuberosum [potatoes]
ref|XP_004160721.1|  PREDICTED: protein TolB-like                     48.9    3e-04   
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890  48.9    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474  48.9    4e-04   Fragaria vesca subsp. vesca
ref|XP_004149439.1|  PREDICTED: protein TolB-like                     48.5    4e-04   Cucumis sativus [cucumbers]
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288  48.1    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010095431.1|  hypothetical protein L484_013388                 48.1    7e-04   
emb|CAN73514.1|  hypothetical protein VITISV_037210                   47.8    8e-04   Vitis vinifera
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814  47.8    8e-04   Vitis vinifera
emb|CDY08186.1|  BnaA06g15400D                                        47.8    0.001   Brassica napus [oilseed rape]



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTI+F++VGR +YGFDIFSV LPS          EHRLTDG+S+NFNG F+DE +T
Sbjct  62   MNPKGTIIFTSVGRPYYGFDIFSVSLPSIIAATTS-WKEHRLTDGISVNFNGQFVDEDET  120

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             V+VSER+G  R+YL +   A++ KP+QL S + +LFHDRP+V+DGRL ++SAH
Sbjct  121  LVYVSERTGYARVYLNQ---ANSPKPKQLPSVADSLFHDRPIVKDGRLYFVSAH  171



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFNGHFLDE  T
Sbjct  28   MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFNGHFLDENQT  84

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             V+VSERSGSPRIY          KP+QLLS  G+L+HDRP+V++GRL ++SAH
Sbjct  85   LVYVSERSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFVSAH  135



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP-ASEHRLTDGVSINFNGHFLDEGD  198
            M+P GTIVF++VGR +YGFD+FS+QLPS+ +      +SEH LTDG+SINFNG F+DEG 
Sbjct  1    MEPTGTIVFTSVGRPYYGFDLFSLQLPSNLDASLLDFSSEHPLTDGISINFNGQFVDEGK  60

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            T V++SER+GS RI+L    S     PQ L SP  +LFHDRP++++ RL +ISAH
Sbjct  61   TLVYISERTGSARIFLN---SPGNANPQLLHSPPESLFHDRPLIKNHRLYFISAH  112



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFNGHFLDE  T
Sbjct  28   MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFNGHFLDENQT  84

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             V+VSE SGSPRIY          KP+QLLS  G+L+HDRP+V++GRL ++SAH
Sbjct  85   LVYVSEXSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFVSAH  135



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 12/121 (10%)
 Frame = +1

Query  4    KPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            KP    MDP GTIVFSTVG + YGFDIFSV+LP+         ++ RLTDGVSINFNG F
Sbjct  62   KPSNFSMDPSGTIVFSTVGVTQYGFDIFSVKLPN--------LTQRRLTDGVSINFNGQF  113

Query  184  LDEG-DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
            LDE  ++ VFVSERSGSPRIYL +       +P+ L SP  +LFHDRPV+++ R  +ISA
Sbjct  114  LDENEESLVFVSERSGSPRIYLSK---PELSEPELLPSPPESLFHDRPVIKNQRAYFISA  170

Query  361  H  363
            H
Sbjct  171  H  171



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 9/119 (8%)
 Frame = +1

Query  19   IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  186
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  187  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            DE  T VFVSERSG+PRIYL+  R +S  + +QL +   +LF DRP +R+ RL YISAH
Sbjct  97   DEDQTLVFVSERSGAPRIYLR--RPSSQVQIEQLPTSIDSLFLDRPFLRNRRLYYISAH  153



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 9/119 (8%)
 Frame = +1

Query  19   IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  186
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  187  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            DE  T VFVSERSG+PRIYL+    +S  + +QL +P  +LF DRP +R+ +L YISAH
Sbjct  97   DEDQTLVFVSERSGAPRIYLRH--PSSQVQMEQLPTPIDSLFLDRPFLRNKQLYYISAH  153



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EHRLTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLNS--PITEHRLTDGASVNFNGQFIDEDQTLV  63

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            FVSERSG+PRIYL+++ S     P  +     +LF D P++R+ RL YISAH
Sbjct  64   FVSERSGAPRIYLRQHPSGIELIPTSI----NSLFLDCPILRNNRLYYISAH  111



>ref|XP_007051241.1| TolB protein-related isoform 2, partial [Theobroma cacao]
 gb|EOX95398.1| TolB protein-related isoform 2, partial [Theobroma cacao]
Length=481

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 5/114 (4%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             VF+SERSGSPRIYL         KP+QL S   +LFHDRP++++ RL +ISAH
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAH  159



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTIVF++VGR  YGFD++SV LPS+        +E RLTD  S+NFNG F+D+  T
Sbjct  1    MEPTGTIVFTSVGRPDYGFDVYSVHLPSN-SLSHWNFTEQRLTDCASVNFNGQFVDDDST  59

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             VF+SER+GS RI+L  NR  +A  P+QL SP  +LFHDRP +++GRL +ISAH
Sbjct  60   LVFISERTGSARIFL--NRPGNAA-PEQLHSPPESLFHDRPFIKNGRLYFISAH  110



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EH LTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLNS--PITEHCLTDGASVNFNGQFIDEDQTLV  63

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            FVSERSG+PRI+L    S     P  +     TLF DRP++R+ RL YISAH
Sbjct  64   FVSERSGAPRIHLSRRHSGIELIPISI----NTLFLDRPILRNNRLYYISAH  111



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 5/114 (4%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             VF+SERSGSPRIYL         KP+QL S   +LFHDRP++++ RL +ISAH
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAH  159



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  198
            M   GTI+FSTVGR+ YGFDIF+V + +         +E RLTDG S+NFNG F D+ D 
Sbjct  1    MMGKGTIIFSTVGRASYGFDIFAVTVHNLLNGAAANWTERRLTDGKSVNFNGQFTDDEDG  60

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            T VF+SER+G+ +IYLQ  +  +   P+QLL  SG+LFHDRP  R+GR+ ++SAH
Sbjct  61   TVVFISERNGASKIYLQLPKCET---PKQLLGASGSLFHDRPTFRNGRVFFVSAH  112



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 12/123 (10%)
 Frame = +1

Query  19   IMD---PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQD--RRPASEHRLTDGVSINFNGHF  183
            IMD   PHG+I+FSTVGR++YGFDIFS++ P SF         +E RLTDG S+NFNG F
Sbjct  38   IMDSQSPHGSIIFSTVGRTNYGFDIFSLKSPFSFFNSPLHTFPTEQRLTDGTSVNFNGQF  97

Query  184  LDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG---TLFHDRPVVRDGRLLYI  354
            +DE  T VFVSERSGSPRIYLQ  R +  G+ +QL  P G   + F DRP++R+  L YI
Sbjct  98   VDEDQTLVFVSERSGSPRIYLQ--RPSHLGEIEQL--PDGSPDSPFLDRPLLRNKCLYYI  153

Query  355  SAH  363
            SAH
Sbjct  154  SAH  156



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 10/113 (9%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  204
            +P G ++F+T+G + YGFDIFSV L S       P  E RLTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTIGLNQYGFDIFSVALNS-------PTVERRLTDGISVNFNAQFLNNQLSV  55

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            VF+SERSGS RIYL ++ ++S   P+ L S  G+ FHDRP+VR+GRLL+ISAH
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVRNGRLLFISAH  105



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 13/118 (11%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP----ASEHRLTDGVSINFNGHFLD  189
            MDP G +VF++VGRS YGFDIF+V L      ++ P     SEHRLTDG+SIN+N  F++
Sbjct  57   MDPKGIVVFTSVGRSQYGFDIFTVNL------NQTPITGSTSEHRLTDGISINYNAQFVN  110

Query  190  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            E  + VF+SERSG PRIYL         KP+QL S   +LFHDRP+++   L +ISAH
Sbjct  111  EDQSIVFISERSGCPRIYLTRR---GLSKPEQLPSVPDSLFHDRPIIKSHHLYFISAH  165



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +1

Query  31   HGTIVFSTVGRSHYGFDIFSVQLPSSFEQDR----RPASEHRLTDGVSINFNGHFLDEGD  198
            HG+I+FSTVGR++YGFDIF ++ P SF   +    +  +EHRLTDG S+NFNG F+DE  
Sbjct  7    HGSIIFSTVGRTNYGFDIFCLKSPFSFLDSQLHSTQYPTEHRLTDGSSVNFNGQFVDEDQ  66

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG---TLFHDRPVVRDGRLLYISAH  363
            T VFVSERSGSPRIYLQ     S  K +QL  P G   +LF DRP++ + RL YISAH
Sbjct  67   TLVFVSERSGSPRIYLQR---PSQLKIEQL--PDGSPDSLFLDRPLLGNKRLYYISAH  119



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTIVFSTVG  +YGFD+FS  LP++ +      +E R TDGVS+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPANLDAAVNKVTERRHTDGVSVNFNAQFVDEGPT  60

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              FVSER+GSPR+Y+ ++      KP+ L +   +L HDRP V++G + ++SAH
Sbjct  61   VAFVSERTGSPRLYVAQSPDH---KPKPLPNIPESLHHDRPTVKNGLVYFVSAH  111



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD-EGDTF  204
            P GTI+F+TVGR++YGFD+FS  +PS        A+E RLTDGVS+NFNGHF D +G + 
Sbjct  4    PRGTIIFTTVGRTYYGFDLFSFHIPS--------ATERRLTDGVSVNFNGHFSDGDGHSV  55

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            VFVSER+ S R+Y     + +   P+QL     +LFHDRPVVRD RL ++SAH
Sbjct  56   VFVSERTASARVYRTRPDNPT---PEQLPGAPDSLFHDRPVVRDNRLYFVSAH  105



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTIVF+TVG  HYGFD+FSV +    +      +E R TDG S+NFN  F+DEGD+
Sbjct  1    MEPQGTIVFTTVGLPHYGFDVFSVPVSPDLDDPAAQLTERRHTDGTSVNFNAQFVDEGDS  60

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              FVSER+GS R++   +R  +   P  L + S +LFHDRP VR+GR+ ++SAH
Sbjct  61   IAFVSERTGSARLFRSSSRDPA---PVPLPAFSDSLFHDRPTVRNGRVFFVSAH  111



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 7/119 (6%)
 Frame = +1

Query  10   PIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-  186
            PI + DP GT+VFSTVGR HYGFD+FS+ L S+F      ASEHRL+DG+S+NFN  F  
Sbjct  49   PITMNDPKGTVVFSTVGRPHYGFDLFSLPLHSAFNN---LASEHRLSDGISVNFNAQFAN  105

Query  187  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            D+  + VF+SER+G P IYL          P+ L S  G+LFHDRP++++  L +ISAH
Sbjct  106  DDPHSVVFISERTGLPAIYLTR---PGLPTPKLLHSEPGSLFHDRPILKNDILYFISAH  161



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  216
            TIVFSTVGR  YGFDIFSV +P + + D R  +E RLTDG S+N+NGHF +E  T VFVS
Sbjct  6    TIVFSTVGRPSYGFDIFSVTVPKNLD-DMRDWTERRLTDGKSVNYNGHFTEEDGTVVFVS  64

Query  217  ERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            ERSG  ++Y+Q     +  KP +L S   +LFHD P + +GRL ++SA+
Sbjct  65   ERSGCSKLYIQ---LPNTNKPLELPSVPDSLFHDHPTINNGRLFFVSAN  110



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 80/117 (68%), Gaps = 7/117 (6%)
 Frame = +1

Query  16   MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  195
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  196  D-TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            D T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAH
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAH  157



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 80/117 (68%), Gaps = 7/117 (6%)
 Frame = +1

Query  16   MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  195
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  196  D-TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            D T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAH
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNDKLFFISAH  157



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 9/110 (8%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  213
            G+IVFSTVGR+ YGFDIF V L     QD   A+EH LTDG+SINFNG F+D+ +T VF+
Sbjct  17   GSIVFSTVGRTEYGFDIFCVSL-----QDT--ATEHCLTDGISINFNGQFVDDNNTLVFI  69

Query  214  SERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            SER+G P++YL   R  S+  P++L S   +LFHDRP++    L ++SAH
Sbjct  70   SERNGVPQVYLT--RPNSSDSPEKLPSAPRSLFHDRPILYGDCLYFVSAH  117



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 79/115 (69%), Gaps = 7/115 (6%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  198
            M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  D 
Sbjct  1    MEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQDQ  57

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAH
Sbjct  58   TIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAH  109



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 10/118 (8%)
 Frame = +1

Query  10   PIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD  189
            P M   P GT+VFST+GR  YGFD+FS++L SS         EHRLTDG SINFN  F D
Sbjct  36   PKMEQQPKGTLVFSTIGRPQYGFDLFSLRLHSS-------NLEHRLTDGRSINFNAQFAD  88

Query  190  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
               + VF+SER+GSP I+L    + +   PQ L S  G+LFHDRPV+++ +L +ISAH
Sbjct  89   SHQSIVFISERTGSPAIFLTRPGNPT---PQLLHSVPGSLFHDRPVIKNRKLYFISAH  143



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 10/113 (9%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  204
            +P G ++F+TVG + YGFDIFSV L S          E +LTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTVGLNQYGFDIFSVPLNSL-------TVERQLTDGISVNFNAQFLNNQLSV  55

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            VF+SERSGS RIYL ++ ++S   P+ L S  G+ FHDRP+V +GRLL+ISAH
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVTNGRLLFISAH  105



>gb|KCW58168.1| hypothetical protein EUGRSUZ_H008851, partial [Eucalyptus grandis]
Length=251

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 19/121 (16%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  195
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDG+SINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGLSINFNAQFASAGDDE  54

Query  196  -----DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
                 +  VFVSER+G PR+YL  +      +P+ L S  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLARS---GFSQPEPLPSAPGSLFHDRPILRNGLLYFISA  111

Query  361  H  363
            H
Sbjct  112  H  112



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 19/121 (16%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  195
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDGVSINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGVSINFNAQFASAGDDE  54

Query  196  -----DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
                 +  VFVSER+G PR+YL     +   +P+ LLS  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLAR---SGFSQPEPLLSAPGSLFHDRPILRNGLLYFISA  111

Query  361  H  363
            H
Sbjct  112  H  112



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLDE-G  195
            M+P GTIVF+TVGR +YGFD+F V+LPS+ +  +   S E+RLTDGVSINFN  F++E  
Sbjct  47   MNPTGTIVFTTVGRPNYGFDVFFVRLPSNLKDFKFSNSDENRLTDGVSINFNAQFINEHN  106

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             + V+VSER+G  RIYL +   +   + ++L     +LFHDRP++++ RL ++SAH
Sbjct  107  QSIVYVSERTGCSRIYLSK---SGVSETERLPFVPESLFHDRPIIKNNRLYFVSAH  159



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = +1

Query  19   IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD  198
            ++ P GTIVF+TVGR  YGFD+FSV L +  +      ++HRLTDGVSINFN  F++  +
Sbjct  49   MLPPAGTIVFNTVGRVQYGFDVFSVDL-NHQQPPPHATADHRLTDGVSINFNAQFINPQN  107

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              VFVSER+GSPR Y+ +  +    KPQ L      LFHDRP+V++G+L ++S H
Sbjct  108  DVVFVSERTGSPRFYITKPDT----KPQPLPFLPNALFHDRPIVKNGKLYFVSTH  158



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 19/124 (15%)
 Frame = +1

Query  16   MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  186
            ++ +P GT++F+TVGR ++GFD+FS+ L S          E RLTDG+SINFN  F    
Sbjct  44   LMDEPTGTVLFTTVGRPYFGFDVFSLDLAS--------GRERRLTDGLSINFNAQFASAG  95

Query  187  -----DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY  351
                 D+ +  VFVS+R+G PR+YL   RS S+ +P+ L S  G+LFHDRPV+R+GRL +
Sbjct  96   GEDGEDDPEAVVFVSDRTGCPRVYLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYF  152

Query  352  ISAH  363
            ISAH
Sbjct  153  ISAH  156



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            M+P GTIVFSTVG  +YGFD+FS  LP+  +       E R TDG S+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPADLDAAVNKLRERRHTDGTSVNFNAQFVDEGQT  60

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              FVSER+GS ++YL E+      KP+ L +   +L  DRP V++G + ++SAH
Sbjct  61   VAFVSERTGSSQLYLAESPDH---KPKPLPTTLESLHQDRPTVKNGLVYFVSAH  111



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 19/121 (16%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  186
            +P GT++F+TVGR ++GFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPTGTVLFTTVGRPYFGFDVFSLDLAS--------GRERRLTDGLSINFNAQFASAGGED  54

Query  187  --DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
              D+ +  VFVS+R+G PR+YL   RS S+ +P+ L S  G+LFHDRPV+R+GRL +ISA
Sbjct  55   GEDDPEAVVFVSDRTGCPRVYLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYFISA  111

Query  361  H  363
            H
Sbjct  112  H  112



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = +1

Query  19   IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD---  189
            ++ P GTIVF+TVGR  YGFD+FSV L     Q     ++HRLTDGVSINFN  F+D   
Sbjct  1    MLPPAGTIVFNTVGRPQYGFDVFSVDL---HHQPPHAVTDHRLTDGVSINFNAQFIDNDE  57

Query  190  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            E ++ VF+SER+GSPR YL    +    KPQ L     +LFHDR  +++G++ ++S H
Sbjct  58   EQNSIVFISERTGSPRCYL----TRPGNKPQPLPFVPNSLFHDRATIKNGKMYFVSTH  111



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 11/111 (10%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-GDTFVF  210
            GT++FSTV R  YGFD+FSV L  +        SE  LTDGVS+NFN  F D+ G + VF
Sbjct  2    GTVIFSTVDRQFYGFDVFSVGLTPN-------TSEQLLTDGVSVNFNAQFADDVGKSIVF  54

Query  211  VSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            +SER+G+PRI+L  +  +    PQ+L S  G+LFHDRP+V +GRL +ISAH
Sbjct  55   ISERTGAPRIFLLRDGDS---PPQELGSVRGSLFHDRPIVNNGRLYFISAH  102



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 79/122 (65%), Gaps = 20/122 (16%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  186
            +P GT++F+T+G  +YGFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPKGTVLFTTIGCPYYGFDVFSLDLTSH--------REPRLTDGLSINFNAQFASVSASD  54

Query  187  ---DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYIS  357
               DE +  VFVSE +G PR+YL   RS S+ +PQ LLS  G+LFHDRPV+R+ RL +IS
Sbjct  55   EDDDEPEAVVFVSEWTGCPRVYL--TRSGSS-QPQPLLSAPGSLFHDRPVLRNRRLYFIS  111

Query  358  AH  363
            AH
Sbjct  112  AH  113



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 7/121 (6%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA------SEHRLTDGVSINFNGHF  183
            M+P GTIVF++VG +++GFD+FSV +P+    +           E R TDGVS+NFN  F
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSVAVPTPASAEAEAGVSAQELDERRHTDGVSVNFNAQF  60

Query  184  LDE-GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
             D+ GD   FVSER+G+  ++L     + + +P+ L +  G+LFHDRP VR GR+ ++SA
Sbjct  61   ADDAGDAVAFVSERTGAASLFLSRPPGSESDRPEPLPAAEGSLFHDRPTVRGGRVYFVSA  120

Query  361  H  363
            H
Sbjct  121  H  121



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 11/114 (10%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  201
            MDP GTIVF+TVGR  YGFD+FS+ L  S         E RL+D +SINFNG F D  D 
Sbjct  1    MDPKGTIVFTTVGRPSYGFDLFSLPLDHS-------GPERRLSDALSINFNGQFSDSDDV  53

Query  202  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             VFVSER+GSPR+YL         +P+ L     +LFHDRPV+++G+L +ISAH
Sbjct  54   -VFVSERTGSPRVYLTR---PGLPRPKSLPFVPESLFHDRPVLKNGKLYFISAH  103



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLD----  189
            +P GT+VF+TVGR  YGFD+FS++LPS         S EH LTDG SIN+N  F+     
Sbjct  3    NPKGTVVFTTVGRPSYGFDVFSIKLPSDLNSFHFSNSDEHCLTDGTSINYNAQFVTQQHH  62

Query  190  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            +  + V++SERSG P +YL +    +  KP+QL S   +LFHDRP++++ RL +ISAH
Sbjct  63   QNQSIVYISERSGFPAMYLSK---PNLSKPEQLPSAPESLFHDRPIIKNDRLYFISAH  117



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 13/114 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  204
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  55

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            VFVSER+GS RIY  + RS  + KP+Q+     + FHDRP++ ++ RL +ISAH
Sbjct  56   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAH  106



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 13/114 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  204
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  9    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  60

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            VFVSER+GS RIY  + RS  + KP+Q+     + FHDRP++ ++ RL +ISAH
Sbjct  61   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAH  111



>ref|XP_006396381.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
 gb|ESQ37834.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
Length=430

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 12/113 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            FVSER+GS RI+          KP+QL     + FHDRPV+ ++ RL +ISAH
Sbjct  56   FVSERAGSARIFRTR---PGDSKPEQLPGAPQSFFHDRPVITQNNRLYFISAH  105



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 71/113 (63%), Gaps = 11/113 (10%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-TF  204
            P GTIVFST+GR+ YGFD+F   L +    D      H LTDG+SINFN  F D+   T 
Sbjct  4    PIGTIVFSTIGRAQYGFDVFYTNLKNHSNHD------HCLTDGISINFNAQFTDDDQKTI  57

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            VFVSER+GSPR YL    S    +P+ L SP   +F DRP +R+G+L ++S H
Sbjct  58   VFVSERTGSPRFYL----SKLGNEPELLPSPLNAVFLDRPTIRNGKLYFVSTH  106



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 14/117 (12%)
 Frame = +1

Query  22   MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  195
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            +  VFVSER+GS RI+    R  ++ KP+QL     + FHDRP++ +D  L +ISAH
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAH  106



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 14/117 (12%)
 Frame = +1

Query  22   MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  195
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            +  VFVSER+GS RI+    R  ++ KP+QL     + FHDRP++ +D  L +ISAH
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAH  106



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 12/113 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            FVSER+GS RI+    R   + KP+QL     + FHDRPV+ ++ RL +ISAH
Sbjct  56   FVSERAGSARIF--RTRPGDS-KPEQLPGAPQSFFHDRPVITQNNRLYFISAH  105



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 11/118 (9%)
 Frame = +1

Query  19   IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP---ASEHRLTDGVSINFNGHFLD  189
            ++ P GT+VF+TVGR  YGFD+FSV L     + R P   +++HRLTDG+SINFN  F+ 
Sbjct  32   MLPPPGTVVFNTVGRPQYGFDVFSVDL----HRHRPPPHASTDHRLTDGLSINFNAQFIS  87

Query  190  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              +  VFVSER+GSPR Y+    +    KPQ L      LF DRP++R+G L ++S H
Sbjct  88   HQNDVVFVSERTGSPRFYI----TRPDNKPQPLSFLPNALFLDRPIIRNGNLYFVSTH  141



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 13/113 (12%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT-SGDDVV  54

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            FVSER+GS RI+    R  ++ +P+QL    G+ FHDRP+V +  RL +ISAH
Sbjct  55   FVSERNGSARIF--RTRPGNS-EPEQLPGAPGSYFHDRPIVTQSNRLYFISAH  104



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTIVF+TVGR+ YGFD+F   L ++        ++HRLTDG+S+NFN  F ++  T V
Sbjct  4    PSGTIVFNTVGRTQYGFDVFYTHLNNNH-------NDHRLTDGISVNFNAQFTNDHQTIV  56

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTLFHDRPVVRDGRLLYISAH  363
            FVSER+GSPR YL    + S  KP+ LL   P+ TLF D P++++ ++ + S H
Sbjct  57   FVSERTGSPRFYL----TRSENKPELLLPSLPNNTLFQDCPIIKNSKIYFSSTH  106



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 12/121 (10%)
 Frame = +1

Query  16   MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP---ASEHRLTDGVSINFNGHFL  186
            M  +  GTIVF+TVGR+ YGFD+FSV L     Q+  P   + EH LTDG S+NFN  F 
Sbjct  1    MANELTGTIVFNTVGRAQYGFDVFSVNL-----QNDTPFQISHEHCLTDGTSVNFNAQFT  55

Query  187  D--EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  360
            +  +  + VF+SER+GSPRIY+ +    +  +P   +S S  LFHDRP++++ +L ++SA
Sbjct  56   ESKQNQSIVFISERTGSPRIYITQPEKENPVEPLAFVSES--LFHDRPIIKNEKLYFVSA  113

Query  361  H  363
            H
Sbjct  114  H  114



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  204
            P GT+VFSTVGR HYGFD+FS  LP  F  +   A EHRL+DG+S+NFN  F  D+  + 
Sbjct  4    PKGTVVFSTVGRPHYGFDLFS--LPLHFSSNNL-ALEHRLSDGISVNFNAQFANDDPHSV  60

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            VF+SER+G P IYL          P+ L S  G+LFHDRP++++  L +ISAH
Sbjct  61   VFISERTGLPAIYLTR---PGLPTPKLLHSEPGSLFHDRPILKNDILYFISAH  110



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  204
            P GTI+F+TVGR+HYGFD+FS+ + +        A E RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIAT--------AVERRLTDGVSVNFNAQFVNDKSDDV  55

Query  205  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAH  363
            VFVSER+GS RIY          +P+QL     + FHDRP++ +  RL +ISAH
Sbjct  56   VFVSERNGSARIY---KTRPGISEPEQLPGAPESYFHDRPIITQSNRLYFISAH  106



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 7/118 (6%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDE  192
            M+P GTIVF++ G S +GFD+FSV +P +   D   A    E R TDGVS+NFN  F D+
Sbjct  1    MEPTGTIVFASFGVSRFGFDVFSVAVPPAAPDDVPDAKMLDERRHTDGVSVNFNAQFADD  60

Query  193  G-DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
              D   FVSER+G+  ++L    S    +P+ L +  G+LFHDRP VR GR+ ++SAH
Sbjct  61   ASDAVAFVSERTGAASLFLSRPGSE---RPEPLPAAEGSLFHDRPTVRGGRVYFVSAH  115



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 13/124 (10%)
 Frame = +1

Query  10   PIMIMDPHGTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGH  180
            P M  DP GT+VFSTVGR +YGFDIF++ +   PSS         E RL+DG SINFN  
Sbjct  53   PTMNTDPKGTVVFSTVGRPNYGFDIFALPILLHPSS----TNIGPERRLSDGRSINFNAQ  108

Query  181  FLD---EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY  351
            F D   E  + VF+SER+G P IYL          PQ L S  G+LFHDRP++++  L +
Sbjct  109  FADNNHEPHSLVFISERTGFPAIYLTR---PGLPHPQVLHSEPGSLFHDRPIIKNHTLYF  165

Query  352  ISAH  363
            +SAH
Sbjct  166  VSAH  169



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 8/116 (7%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  195
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+ G
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAH
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAH  110



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 77/119 (65%), Gaps = 9/119 (8%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASE----HRLTDGVSINFNGHFLD  189
            M+P GTIVF++VG +++GFD+FS  +P+    +   ++E     R TDG+S+NFN  F D
Sbjct  1    MEPAGTIVFASVGVTNFGFDVFSATVPAPTSAEAGVSAEDLDERRHTDGISVNFNAQFAD  60

Query  190  E-GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            + GD   FVSER+G+  ++L    S    +P  L +  G+LFHDRP VR GR+ ++SAH
Sbjct  61   DAGDAVAFVSERTGAASLFL----SRPGSEPDPLPAAEGSLFHDRPTVRGGRVYFVSAH  115



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 8/116 (7%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  195
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+ G
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAH
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAH  110



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 8/116 (7%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  195
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+ G
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAH
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAH  110



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 11/113 (10%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+F+T+GR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F ++ +  V
Sbjct  4    PRGTIIFTTIGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFTND-NNIV  54

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY-ISAH  363
            FVSER+GS R+Y +        KP+QL     + FHDRP++     LY ISAH
Sbjct  55   FVSERAGSARLY-KTRPGTENSKPEQLPGAPDSFFHDRPILTHNNTLYFISAH  106



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 13/113 (12%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSLER--------RLTDGVSVNFNAQFT-SGDNVV  54

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY-ISAH  363
            FVSER+GS  I+    R  ++ +P+QL     + FHDRP+V    +LY ISAH
Sbjct  55   FVSERNGSATIF--RTRPGNS-EPEQLPGAPDSYFHDRPIVTQSNILYFISAH  104



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-GD  198
            M+P GTIVF+TVG + +GFD+FS  +P    Q   P +E R TDGVS+NFN  F+D+  +
Sbjct  1    MEPTGTIVFATVGVTSFGFDVFSSPVPPPPLQSTAPGAERRHTDGVSVNFNAQFVDDAAE  60

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
               FVSER G+  +++       A   + L +  G+LFHDRP VR GR+ ++SAH
Sbjct  61   EVAFVSERGGAAGLFVCRPGDERA---EPLPAVEGSLFHDRPTVRGGRMYFVSAH  112



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  207
            P GTI+++TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIYTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT--GDDVV  53

Query  208  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV--RDGRLLYISAH  363
            FVSER+GS R+Y          +P+QL     + FHDRP++  +  +L +ISAH
Sbjct  54   FVSERTGSARVYRTR---PGKPEPEQLPGAPDSYFHDRPIIVSQSNKLYFISAH  104



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  198
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
               FVSER+GS  ++L    S  A     L    G+LFHDRP VR GRL ++S+H
Sbjct  66   EVAFVSERTGSAGLFLCRPESERA---VPLPVVEGSLFHDRPAVRGGRLYFVSSH  117



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +1

Query  25   DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  198
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  199  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
               FVSER+GS  ++L    S  A     L    G+LFHDRP VR GRL ++S+H
Sbjct  66   EVAFVSERTGSAGLFLCRPESERA---VPLPVVEGSLFHDRPAVRGGRLYFVSSH  117



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 69/116 (59%), Gaps = 9/116 (8%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFE-QDRRPASEHRLTDGVSINFNGHFLD---EG  195
            P GT+VFSTVGR HYGFDIF+  LP+           E RL+DG SINFN  F D   E 
Sbjct  4    PKGTVVFSTVGRPHYGFDIFA--LPTLLHPSSTNIGPERRLSDGRSINFNAQFADNSHEP  61

Query  196  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             + VF+SER+G P IYL          PQ   S  G+LFHDRP+ ++  L ++SAH
Sbjct  62   HSLVFISERTGFPAIYLTR---PGLPHPQLXHSEPGSLFHDRPIJKNHTLYFVSAH  114



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 68/117 (58%), Gaps = 9/117 (8%)
 Frame = +1

Query  28   PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRL-TDGVSINFNGHFLD----E  192
            P GTI F++VG + +GFD+FSV +P S E         R  TDGVS+NFN  F D    E
Sbjct  9    PTGTIAFASVGVTSFGFDVFSVAVPQSPETTTAEELAERCHTDGVSVNFNAQFTDDEAGE  68

Query  193  GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAH  363
             +   FVSER+GS  ++L        G+   L +   +LFHDRP +R GRL ++SAH
Sbjct  69   EEEVAFVSERTGSAALFLCR----PGGRATPLPAVEESLFHDRPTLRRGRLYFVSAH  121



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (56%), Gaps = 18/126 (14%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  213
            GTIVF+T+GRS Y FD++++ L  S      PA+E RLTDG S+N+NG+F    D  +FV
Sbjct  31   GTIVFTTLGRSRYAFDVYALPLAPSLSIPASPAAELRLTDGASVNYNGNFAPSSDALLFV  90

Query  214  SERSGSPRIYLQENRSASAGKPQQLLSPSG----------------TLFHDRPVV-RDG-  339
            SER+GS  IYL     +S+ + + L    G                    DRP + RDG 
Sbjct  91   SERNGSLNIYLSPAPPSSSSRREALQLEDGDSSPAAPPMPLLPWDPVALRDRPALTRDGS  150

Query  340  RLLYIS  357
            RL+Y+S
Sbjct  151  RLVYVS  156



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 4/112 (4%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  216
            T+V++TVGR+ Y FDI++  + +  + +   A+E +LTDGVS+N+NG F  +G+  +FVS
Sbjct  76   TVVYATVGRAQYAFDIYTKLMGNERDPELANAAETQLTDGVSVNYNGAFAGDGEALLFVS  135

Query  217  ERSGSPRIYLQENRSASAGKPQQL--LSPSGTLFHDRPVVR-DGRLLYISAH  363
            ER G+  +Y       + G    L  L+ S TL  DRP+   DGR++++S H
Sbjct  136  ERDGNMELYKGHAEGVTGGHRPSLKRLTYSPTL-QDRPIYSPDGRIIFVSTH  186



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  213
            GTIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FV
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFV  86

Query  214  SERSGSPRIYLQ  249
            SER+GS  +YL 
Sbjct  87   SERNGSLNLYLS  98



>ref|XP_002448903.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
 gb|EES07891.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
Length=98

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPA------SEHRLTDGVSINFNG  177
            M+P GTIVF++VG +++GFD+FS+ +  P+S E             E   T+GVS+NFN 
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSIVVLTPASAEAKAEAGVSAQELDEQHHTNGVSVNFNA  60

Query  178  HFLDE-GDTFVFVSERSGSPRIYL  246
             F D+ GD  VFVSER+G+  ++L
Sbjct  61   QFADDAGDAVVFVSERTGAASLFL  84



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH-RLTDGVSINFNGHFLDEGDTFVF  210
            GTIVF+T+GRS Y FDIFS+ L  S      PA+E  RLTDGVS+N+NG+F    D+ +F
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS---PHNPAAEELRLTDGVSVNYNGNFAPASDSILF  84

Query  211  VSERSGSPRIYLQ  249
            VSER+GS  +YL 
Sbjct  85   VSERNGSLNLYLS  97



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  216
            TIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FVS
Sbjct  29   TIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFVS  87

Query  217  ERSGSPRIYLQ  249
            ER+GS  +YL 
Sbjct  88   ERNGSLNLYLS  98



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 67/125 (54%), Gaps = 17/125 (14%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  213
            GTIVF+T+GRS Y FDIF++ L         PA+E RLTDG S+N+NG+F    D+ +FV
Sbjct  30   GTIVFTTLGRSRYAFDIFALPLTPLSSSSSSPAAEVRLTDGASVNYNGNFAPSSDSLLFV  89

Query  214  SERSGSPRIY---------------LQENRSASAGKPQQLLSPSGTLFHDRP-VVRDG-R  342
            SER+G+  +Y                 E   A+A  P  LL        DRP +  DG  
Sbjct  90   SERNGTLNLYAFPVPSASGSGARREALEVPEAAAALPSPLLPWDPIALKDRPSLTPDGAH  149

Query  343  LLYIS  357
            L+Y+S
Sbjct  150  LVYVS  154



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 21/127 (17%)
 Frame = +1

Query  16   MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  195
            M  D  GT+VF++VGRSHY FD F++ + +          E  LTDGVS+NFN  F+++ 
Sbjct  1    MANDGGGTVVFASVGRSHYAFDAFALDIAT--------LKEEVLTDGVSVNFNAQFVEDD  52

Query  196  ---DTFVFVSERSGSPRIYLQENRSASAG---------KPQQLLSPSGTLFHDRPVVR-D  336
                  +FVSER+G+  I+L+     S           K   L +  G L+ DRP V   
Sbjct  53   PKPSAVIFVSERTGASNIFLRRQSLTSKSDRDDHSSTLKLGSLDAGDGFLYCDRPCVAGG  112

Query  337  GRLLYIS  357
            GR+++ S
Sbjct  113  GRIIFAS  119



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 69/130 (53%), Gaps = 23/130 (18%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLP-----SSFEQDRRPASEHRLTDGVSINFNGHFLD--EG  195
            TIVF+T+GRS Y FDIF+V L      +    D+  A+E RLTDG S+N+NG+F      
Sbjct  77   TIVFTTLGRSRYAFDIFAVPLNRGDHLALSPSDKSAAAEVRLTDGASVNYNGNFAASPSS  136

Query  196  DTFVFVSERSGSPRIY--------------LQENRSASAGKPQQLLSPSGTLFHDRP-VV  330
            D  +FVSER+GS  +Y              L+E    S+ +   LL        DRP + 
Sbjct  137  DALLFVSERNGSLNLYLSPIPSSPTSRREALEEKEEDSSAQISPLLPWDPVALKDRPSLT  196

Query  331  RDG-RLLYIS  357
             DG RL+Y+S
Sbjct  197  PDGTRLVYVS  206



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF--LDEGDTFV  207
            GTIVF+T+GRS Y F IFS+ L  S      PA+E  LTDGVS+N+NG+F      D+ +
Sbjct  24   GTIVFTTLGRSRYEFSIFSLPLSPS---PHNPATELYLTDGVSVNYNGNFAPTSHSDSIL  80

Query  208  FVSERSGSPRIYLQ  249
            FVS+R+GS  +YL 
Sbjct  81   FVSKRNGSLNLYLS  94



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 68/134 (51%), Gaps = 28/134 (21%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            TI+F+T+GR  + FDIF+  LP++ ++   PA EHRLTDG SINFNGHF           
Sbjct  31   TILFTTIGRPTFEFDIFT--LPTN-KRPPSPADEHRLTDGTSINFNGHFASPSPALISLL  87

Query  202  ---------------FVFVSERSGSPRIYLQENRSASAGKPQQLLS--PSG---TLFHDR  321
                            ++V+ER G+P +      ++ +    QL S   SG       D+
Sbjct  88   PNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRAQLFSGDKSGMAVNWMQDK  147

Query  322  PVVRDGRLLYISAH  363
            PV+ +  L+Y+S H
Sbjct  148  PVLTNEYLVYVSTH  161



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 22/92 (24%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-----EHRLTDGVSINFNGHF-----  183
            GTI+F+T+GRS Y FDIFS+ + SS  + RRP +     EHRLTDGVS+NFNG+F     
Sbjct  28   GTIIFTTLGRSRYNFDIFSLPIASSSSR-RRPIAVDRHGEHRLTDGVSVNFNGYFPSLAS  86

Query  184  -----------LDEGDTFVFVSERSGSPRIYL  246
                           D+ ++VSER+GS  IYL
Sbjct  87   SSFLSSLLPSSSSSVDSLLYVSERNGSSAIYL  118



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 66/138 (48%), Gaps = 36/138 (26%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF        
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  202  ------------------FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG------TL  309
                               ++V+ER G+P +      S S  + +  L P G        
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYNV-VSNSGSRVRAQLFPGGESGMAVNS  144

Query  310  FHDRPVVRDGRLLYISAH  363
              D+PV+ +  L+Y+S H
Sbjct  145  MKDKPVLTNEYLVYVSTH  162



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (49%), Gaps = 34/137 (25%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF        
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  202  ------------------FVFVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTL---F  312
                               ++V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  313  HDRPVVRDGRLLYISAH  363
             D+PV+ +  L+Y+S H
Sbjct  146  QDKPVLTNEYLVYVSTH  162



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (49%), Gaps = 34/137 (25%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF        
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  202  ------------------FVFVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTL---F  312
                               ++V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  313  HDRPVVRDGRLLYISAH  363
             D+PV+ +  L+Y+S H
Sbjct  146  QDKPVLTNEYLVYVSTH  162



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 31/136 (23%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTD  S+NFNGHF           
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDAKSVNFNGHFASPSPALISLL  89

Query  202  ------------FVFVSERSGSPRIY---LQENRSAS-------AGKPQQLLSPSGTLFH  315
                         ++V+ER G+P +Y   + +++S S       +G+ QQ      ++  
Sbjct  90   PNKSQIQPQDLHLIYVTERDGTPSLYYDVVHDDKSGSRVQVPLFSGEEQQSGMNVNSM-K  148

Query  316  DRPVVRDGRLLYISAH  363
            D PV+    L+Y+S H
Sbjct  149  DTPVLTSDYLVYVSTH  164



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 68/146 (47%), Gaps = 40/146 (27%)
 Frame = +1

Query  40   IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  201
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  202  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSP--  297
                         ++V+ER+GS  IY                  RSA    P ++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  298  -SGT---LFHDRPVVRDGRLLYISAH  363
             SGT      DRP +    L+Y+S H
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTH  192



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 68/146 (47%), Gaps = 40/146 (27%)
 Frame = +1

Query  40   IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  201
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  202  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSP--  297
                         ++V+ER+GS  IY                  RSA    P ++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  298  -SGT---LFHDRPVVRDGRLLYISAH  363
             SGT      DRP +    L+Y+S H
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTH  192



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 29/135 (21%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTDG SINFNG+F           
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDGKSINFNGYFASPSTALISLL  89

Query  202  ------------FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG---------TLFHD  318
                         ++V+ER+G+P +      S + G   Q+   SG             D
Sbjct  90   PKRTQIQPQDVHLIYVTERAGTPSLNYDVVHSDNVGSRIQVPLFSGEEQQSGMNVNSMKD  149

Query  319  RPVVRDGRLLYISAH  363
             PV+ +G L+++S H
Sbjct  150  TPVLTNGYLVHVSTH  164



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 67/138 (49%), Gaps = 31/138 (22%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  201
             TI+F+T+GR+ Y FDI+ + +    +Q   P  E +LTDG S+NFNGHF+         
Sbjct  28   ATIIFTTLGRAFYAFDIYYLPI---HQQPVNPDQELQLTDGHSVNFNGHFISNASAIQLP  84

Query  202  -------FVFVSERSGSPRIYL---------QENRSASAGKPQQLLSP------SGTLFH  315
                    V+V+ER+GSP IY              S +A + Q  L P      S     
Sbjct  85   THSPPLQLVYVTERNGSPTIYYDAVYTSTTRSTKESVTAERIQIPLLPNKPTDTSQLSIK  144

Query  316  DRP-VVRDGR-LLYISAH  363
            D+P V  DG  L+Y+S H
Sbjct  145  DKPSVTPDGEFLIYVSTH  162



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 70/140 (50%), Gaps = 33/140 (24%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA--------SEHRLTDGVSINFNGHFLDE  192
            TI+F+T+GRS YGFDIFSV  P +F               +E +LTDGVS+N+NG F   
Sbjct  27   TILFTTLGRSRYGFDIFSV--PFTFSSSSSCLHSISIEHHNELQLTDGVSVNYNGFFPSN  84

Query  193  GDTFVFVSERSGSPRIYLQE--------NRSASAGKPQQLLSP------SGTLF------  312
              + +++SER+G   +YL           R  +   P +L SP      S + F      
Sbjct  85   SSSLLYISERNGYCNVYLDHLSLPQSSPLRREALQLPSRLQSPLLPTPSSSSAFRSPPPI  144

Query  313  --HDRPVVRDG-RLLYISAH  363
               DRP +  G RL+Y+S H
Sbjct  145  SMKDRPSLISGDRLIYVSTH  164



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 66/128 (52%), Gaps = 25/128 (20%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD---T  201
            GTIVF+T+GRS Y FD+F++ + P S       ++E RLTDG S+N+NG+F        +
Sbjct  26   GTIVFTTLGRSRYAFDVFALTIAPLSAA-----SAELRLTDGASVNYNGNFAPSSSGPPS  80

Query  202  FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSPSGTLFHDRP-VVRD  336
             +FVSER+GS  +YL               E     +  P  LL        DRP +  D
Sbjct  81   LLFVSERNGSLNLYLTPVPTSASARRRDALEEEEEDSAPPTPLLPWDPIALKDRPSLTPD  140

Query  337  G-RLLYIS  357
            G  L+Y+S
Sbjct  141  GAHLVYVS  148



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 72/151 (48%), Gaps = 45/151 (30%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  201
            GTIVF+T+GRS+Y +DI++  LP+S      P++E R+TDG S+NFNGHF     +    
Sbjct  32   GTIVFTTLGRSNYAWDIYT--LPTS--DPPSPSNELRVTDGESVNFNGHFPSTSPSSVLS  87

Query  202  --------------------FVFVSERSGSPRIYLQ--------ENRSASAGK-PQQLLS  294
                                 V+V+ER+G P IY            RS SA + P +L +
Sbjct  88   LLHNRSLIRTPGPQAPPPLQLVYVTERNGMPNIYYDALYYGAPGSTRSRSALEVPVRLQA  147

Query  295  PSGTL--------FHDRPVVRDGRLLYISAH  363
            P   L          DRP +    L+Y+S H
Sbjct  148  PLLGLEESKNRVSMKDRPSLSGENLIYVSTH  178



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 66/139 (47%), Gaps = 36/139 (26%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTDG SINFNGH         
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDGKSINFNGHLASPSPALI  88

Query  202  ------------------FVFVSERSGSPRIYLQ----ENRSASAGKP---QQLLSPSGT  306
                               ++V+ER G+P ++      +N+      P   +Q    S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  307  LFHDRPVVRDGRLLYISAH  363
               D PVV +  L+Y+S H
Sbjct  149  SMKDTPVVTNEHLVYVSTH  167



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = +1

Query  40   IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE---GD----  198
            I+F+T+GR++Y FDI+S  LP        P  E ++TDG S+NFNGHFL      D    
Sbjct  28   IIFTTLGRAYYAFDIYS--LPIHLNHSTNPHQELQITDGNSVNFNGHFLSNQFPADHNPP  85

Query  199  --TFVFVSERSGSPRIY  243
                V+V+ER+G P IY
Sbjct  86   PLQLVYVTERNGFPSIY  102



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 66/138 (48%), Gaps = 32/138 (23%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            TI+FST GR  + FDIF+  LP++ ++   PA EHRLTDG S+NFNGHF           
Sbjct  33   TILFSTTGRPTFEFDIFT--LPTN-KRPPSPADEHRLTDGNSVNFNGHFASPSPALISLL  89

Query  202  ---------------FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFH-------  315
                            ++V+ER G+P +      + ++G    +   SG   H       
Sbjct  90   PNSSRIQPHDSSLVHLIYVTERDGTPSLNYDVVHNDNSGSRVHVPLFSGDEQHSGMAVNS  149

Query  316  --DRPVVRDGRLLYISAH  363
              D PV+ +  L+Y+S H
Sbjct  150  MKDTPVLTNKHLVYVSTH  167



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 73/155 (47%), Gaps = 43/155 (28%)
 Frame = +1

Query  7    PPIMIMDPHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            P ++ +   GT I F+T+GRS Y FDIF+  LP++      P+ E RLTDG S+NFNG+F
Sbjct  12   PLLLAVGGGGTSIAFATLGRSSYAFDIFA--LPTA-----SPSKEIRLTDGNSVNFNGYF  64

Query  184  ---------------LDEGDTFVFVSERSGSPRIYLQE---------------NRSASAG  273
                            D+    V+++ER+GS +IYL                   SA + 
Sbjct  65   PSSSSLSMLPHLSKNTDQATHIVYITERNGSSKIYLDALYDTPPIRSGSRSLVEGSAEST  124

Query  274  KPQQLL-----SPSGTLFHDRPVVRDGRLLYISAH  363
            + Q LL     +       D+P +    L+Y+S H
Sbjct  125  RLQVLLLGDEQTGGRVSMKDKPSLVGQSLIYVSTH  159



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 64/139 (46%), Gaps = 36/139 (26%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+G S + FDIF++         RRP S   EHRLTDG SINFNGH         
Sbjct  32   TILFTTMGSSTFEFDIFTLH------TSRRPPSPSDEHRLTDGKSINFNGHLASPSPALI  85

Query  202  ------------------FVFVSERSGSPRIYLQENRSASAGKPQQ--LLSP-----SGT  306
                               ++V+ER G+P ++     S + G   Q  LLS      S  
Sbjct  86   SLLPNTSGVQPQDKTLLHLIYVTERDGAPTLHYDVVHSDNKGTNVQVPLLSEQQSGMSVN  145

Query  307  LFHDRPVVRDGRLLYISAH  363
               D PV+ +  L+Y+S H
Sbjct  146  SMKDTPVLTNEHLVYVSTH  164



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 67/144 (47%), Gaps = 38/144 (26%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            +IVF+T+GRS Y FDIF+  LP+S      P  E ++TDG S+NFNGHF     +     
Sbjct  30   SIVFTTLGRSRYAFDIFT--LPTS-SHTPSPVDELQITDGESVNFNGHFPSPSSSSILSN  86

Query  202  ----------------FVFVSERSGSPRIYLQEN------RSASAGKPQQ----LLSPS-  300
                             V+V+ER GS  IYL         R ++   P +    LL+P  
Sbjct  87   LLSNRTLTLDPHPLQFIVYVTERHGSSNIYLDAYYHHSPIRRSALETPCRIQVPLLNPEQ  146

Query  301  ---GTLFHDRPVVRDGRLLYISAH  363
               G    DRP +    L+Y+S H
Sbjct  147  SNGGISLKDRPSLSGYYLIYVSTH  170



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 65/139 (47%), Gaps = 36/139 (26%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDT--  201
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTD  SINFNGH         
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDRKSINFNGHLASPSPALI  88

Query  202  ------------------FVFVSERSGSPRIYLQ----ENRSASAGKP---QQLLSPSGT  306
                               ++V+ER G+P ++      +N+      P   +Q    S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  307  LFHDRPVVRDGRLLYISAH  363
               D PVV +  L+Y+S H
Sbjct  149  SMKDTPVVTNEHLVYVSTH  167



>gb|KHN46997.1| Replication factor C subunit 4 [Glycine soja]
Length=422

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 69/130 (53%), Gaps = 20/130 (15%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFS--VQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
             TI+F+T+GR+ Y FDI+S  V +    +Q   P+ E  LTDG S+NFNGHFL       
Sbjct  49   ATIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  108

Query  202  ---------FVFVSERSGSPRIYLQENRSASAGKPQ---QLLSP--SGTLFHDRP-VVRD  336
                      V+V+ER+G P I+     S+S    +    LLS   S     D+P V  D
Sbjct  109  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  168

Query  337  GR-LLYISAH  363
            G+ LLY+S+H
Sbjct  169  GQYLLYVSSH  178



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-----DEGD  198
            GTIVF+T+GRS Y FDIF++ L          ++E RLTDGVS+N+NG+F       E  
Sbjct  24   GTIVFTTLGRSRYAFDIFALPLSPLSSAAA--SAELRLTDGVSVNYNGNFAPSSSSSEPP  81

Query  199  TFVFVSERSGSPRIYLQE-NRSASAGKPQQLL  291
            + +FVSER+GS  +Y      SASA + ++ L
Sbjct  82   SLLFVSERNGSLNLYRTPVPLSASAARRREAL  113



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 18/84 (21%)
 Frame = +1

Query  40   IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF------------  183
            I F+T+GRS YGFDI++  LP++      P  E RLTDG S+N+NG+F            
Sbjct  43   IAFATLGRSSYGFDIYA--LPTTTTTIASP-EEIRLTDGNSVNYNGYFPSSSSLSVFPLL  99

Query  184  ---LDEGDTFVFVSERSGSPRIYL  246
                D    F++V+ER+GS +IYL
Sbjct  100  PDQPDPTTHFIYVTERNGSSQIYL  123



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 70/130 (54%), Gaps = 20/130 (15%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT--  201
             +I+F+T+GR+ Y FDI+S+ +P   +Q +  +   E  LTDG S+NFNGHFL       
Sbjct  65   ASIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  124

Query  202  ---------FVFVSERSGSPRIYLQENRSASAGKPQ---QLLSP--SGTLFHDRP-VVRD  336
                      V+V+ER+G P I+     S+S    +    LLS   S     D+P V  D
Sbjct  125  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  184

Query  337  GR-LLYISAH  363
            G+ LLY+S+H
Sbjct  185  GQYLLYVSSH  194



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 71/154 (46%), Gaps = 51/154 (33%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------  183
            TI+F+T+GRSHY FDIFS+    P S       + E +LTDG S+NFNG+F         
Sbjct  33   TIIFTTLGRSHYEFDIFSLSTTHPPSI------SVELQLTDGESVNFNGYFPSPSPALIS  86

Query  184  ---------LDEGDT--FVFVSERSGSPRIYL-------------QENRSASAGKPQQLL  291
                     L++      ++V+ER+G+  IY               + RS     P ++ 
Sbjct  87   LLPDETLIQLEDSSPLHLIYVTERNGTSSIYYDLVSSSNYSDTTSNQRRSVLEAAPSRVQ  146

Query  292  SP-------SGTL---FHDRPVVRDGRLLYISAH  363
             P       SGT+   F D+P +    L+Y+S H
Sbjct  147  IPLLSSSHRSGTIVNSFKDKPSLIGEFLVYVSTH  180



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 30/136 (22%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            TI+F+T+GR  + FD+F+  LP+S  +   P+ EHR+T G SI+FNGHF           
Sbjct  33   TILFTTLGRPTFEFDLFT--LPTS-HRPPSPSDEHRITAGKSIHFNGHFASPSPALISLI  89

Query  202  ---------------FVFVSERSGSPRI---YLQENRSASAGK----PQQLLSPSGTLFH  315
                            ++V+ER G+P +    +Q + S ++ +    P+     +     
Sbjct  90   PKNSGIHSQDPSLLHLIYVTERYGAPTLSYDVVQADYSKTSAQVPLLPELQSGMTVNSMK  149

Query  316  DRPVVRDGRLLYISAH  363
            D PV+ +  L+Y+S H
Sbjct  150  DTPVLTNEHLVYVSTH  165



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            +I F+T+GR  + FDIF+  LP++      P++EHRLTDG SINFNGHF
Sbjct  27   SIFFTTLGRPTFEFDIFT--LPTTNHPPPSPSNEHRLTDGKSINFNGHF  73



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 64/133 (48%), Gaps = 31/133 (23%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNGHF           
Sbjct  23   SIIFTTLGRSSYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGHFPATLPPSLLSR  75

Query  184  ------LDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQ--LLSP-----SGTLFHDRP  324
                  ++ G   ++V+ER+G+  ++           P Q  L  P           D+P
Sbjct  76   LPDDDSVNSGFHLIYVTERNGTHHVFYDAVFHDILEFPSQTRLQVPLVGFEQSVSMKDKP  135

Query  325  VVRDGRLLYISAH  363
             +    L+Y+S H
Sbjct  136  SLSGEFLIYVSTH  148



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 67/150 (45%), Gaps = 42/150 (28%)
 Frame = +1

Query  28   PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  198
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PRGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  199  ---------------------TFVFVSERSGSPRI-----YLQENRSASAGK----PQQL  288
                                   ++V+ER GS  I     Y+   RSA +      P+++
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  289  LSP-----SGTLFHDRPVVRDGRLLYISAH  363
              P      G    D+P V    L+Y+S H
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTH  172



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (46%), Gaps = 39/146 (27%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            +IVF+T+GRS Y FDI++  LP+    +   A E  +TDG S+NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANNNPSSADEILITDGQSVNFNGYFPSSSSFSSLIS  85

Query  184  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  297
               ++  +F      V+V+ER+G  RI+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDLELVYVTERNGISRIFYDAVFGGTGVSARRRSELEIPHRLQIPLLDEE  145

Query  298  ----SGTLFHDRPVVRDGRLLYISAH  363
                    F DRP +    L+Y+S H
Sbjct  146  QKNEVRVSFKDRPSLSGDYLVYVSTH  171



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 72/161 (45%), Gaps = 54/161 (34%)
 Frame = +1

Query  25   DPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFLDE  192
            +P+G  TIVF+T+GRSHY FDIF++    P S  +      E ++TDG S+NFNG+F   
Sbjct  25   NPNGGDTIVFTTLGRSHYEFDIFALSTTHPPSISR------ELQITDGESVNFNGYFPSP  78

Query  193  GDT--------------------FVFVSERSGSPRIY------------LQENRSASAGK  276
              T                     ++V+ER+G+  IY             +  R +    
Sbjct  79   SPTLISLLPDETLTQLEDSSPLHLIYVTERNGTSSIYYDLVYGGGGDSDFKRKRRSVLES  138

Query  277  PQQLLSP---------SGTL---FHDRPVVRDGRLLYISAH  363
            P ++  P         SGT    F D+P +    L+Y+S H
Sbjct  139  PSRIQVPLLSIANHHRSGTKVNSFKDKPSLSGEFLVYVSTH  179



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 68/150 (45%), Gaps = 42/150 (28%)
 Frame = +1

Query  28   PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-  201
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF     + 
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  202  ----------------------FVFVSERSGSPRI-----YLQENRSASAGK----PQQL  288
                                   ++V+ER GS  I     Y+   RSA +      P+++
Sbjct  83   LSRLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  289  LSP-----SGTLFHDRPVVRDGRLLYISAH  363
              P      G    D+P V    L+Y+S H
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTH  172



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 68/150 (45%), Gaps = 42/150 (28%)
 Frame = +1

Query  28   PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  198
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGDPPTK--TNELRITDGESVNFNGHFPSPSSSL  82

Query  199  ---------------------TFVFVSERSGSPRIYL--------QENRSASAGK-PQQL  288
                                   ++V+ER GS  I+         +  RS SA + P+++
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDIPRSARSRSALEIPKRV  142

Query  289  LSP-----SGTLFHDRPVVRDGRLLYISAH  363
              P      G    D+P V    L+Y+S H
Sbjct  143  QVPLLDGKGGISMKDKPTVSGDYLVYVSTH  172



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 28/92 (30%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT---  201
            +IVF+T+GRS Y FDI+S+ L  +      PAS  E RLTDGVS+NFNG+F         
Sbjct  38   SIVFATLGRSSYHFDIYSLPLWVA------PASSNELRLTDGVSVNFNGYFPSPSSVSML  91

Query  202  -----------------FVFVSERSGSPRIYL  246
                             FV+V+ER+G+  ++L
Sbjct  92   FRAPDWTPADVSPPPLHFVYVTERNGNSHVFL  123



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 69/150 (46%), Gaps = 45/150 (30%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF----------L  186
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F          L
Sbjct  35   TIIFTTLGRSRYEFDIFTL----STAQPPSVSGELRITDGASVNFNGYFPSPSPALISLL  90

Query  187  DEGDTF----------VFVSERSGSPRIYLQ----------ENRSASAGKPQQ----LLS  294
             +   F          ++V+ER+G+  +Y              R +    P +    LLS
Sbjct  91   PDETLFQLEDSSPLHLIYVTERNGTSSVYYDLIYGVDSDSINKRRSMLEAPSRVQVPLLS  150

Query  295  ----PSGTL---FHDRPVVRDGRLLYISAH  363
                PSG     F D+P +    L+Y+S H
Sbjct  151  GFDQPSGMTVNSFKDKPSLSGDFLVYVSTH  180



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 68/147 (46%), Gaps = 41/147 (28%)
 Frame = +1

Query  37   TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  186
            +I+F+T+G RS Y FDIF+  LP+       PA+E ++TDG S+NFNGHF          
Sbjct  29   SIIFATLGSRSDYAFDIFT--LPTQGPPPT-PANELQITDGRSLNFNGHFPSPSSSLLSL  85

Query  187  ------------DEGDTFVFVSERSGSPRIYL--------QENRSASAGK---PQQLLSP  297
                         E  + V+V+ER GS  IY         +  R  SA +   P ++  P
Sbjct  86   LSNQTLTSATQNSEPVSLVYVTERGGSSNIYYDTVYFSIPRSTRLRSALEIEIPVRVQVP  145

Query  298  -----SGTLFHDRPVVRDGRLLYISAH  363
                  G    D+P V    L+Y+S H
Sbjct  146  LLKGIDGISMKDKPTVSGDYLIYVSTH  172



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 68/153 (44%), Gaps = 51/153 (33%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF--------  183
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F        
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPSPSPALI  85

Query  184  --------LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPQQLLSPSGTL---  309
                    +  GD+     ++V+ER+G+  IY   L      S  K + +L  +  +   
Sbjct  86   SLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEATSRVQIP  145

Query  310  ---------------FHDRPVVRDGRLLYISAH  363
                           F D+P +    L+Y+S H
Sbjct  146  LLSNADHRSGNTVNSFKDKPSLSGEFLVYVSTH  178



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 70/151 (46%), Gaps = 45/151 (30%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  201
            G+IVF+T+GRS Y +DIF+  LP+    +  P++E ++TDG S+NFNGHF     +    
Sbjct  31   GSIVFTTLGRSDYAWDIFT--LPTLDPPN--PSNELQITDGESVNFNGHFPSASSSSILS  86

Query  202  --------------------FVFVSERSGSPRIYL--------QENRSASAGK-PQQLLS  294
                                 ++V+ER G   IY         +  RS SA + P ++ +
Sbjct  87   LLHNRSLLHPPGPQAPSPLQLIYVTERKGMSNIYYDALYHGAPRSTRSRSALEIPVRVQA  146

Query  295  PSGTL--------FHDRPVVRDGRLLYISAH  363
            P   L          DRP +    L+Y+S H
Sbjct  147  PLLGLEESKNRISMKDRPSLSGENLIYVSTH  177



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 67/172 (39%), Gaps = 63/172 (37%)
 Frame = +1

Query  31   HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRR-PASEHRLTDGVSINFNGHFLD-----  189
             GT+ F++VGR+HY FD+F +   P   E     P  E R TDGVS+N+NG  +D     
Sbjct  27   EGTVAFASVGRAHYAFDVFLLDFRPWELENASLGPHLEFRATDGVSVNYNGALVDDSQRR  86

Query  190  ------------EGD----TFVFVSERSGSPRI------------------YLQENRSAS  267
                        +GD      ++VSER G+  +                   ++     S
Sbjct  87   VIFEALDFRGEQQGDGSQGILIYVSERDGAAEVRFNLFYQGQRDRGERSLGNIESGSQES  146

Query  268  AGKPQQLLSPSG----------------------TLFHDRPVVRDGRLLYIS  357
             G  +  L   G                      T  +DRP V DGR++++S
Sbjct  147  HGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTALYDRPSVADGRVIFVS  198



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 71/158 (45%), Gaps = 51/158 (32%)
 Frame = +1

Query  25   DPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---  183
            +P+G  TIVF+T+GRS Y FDIF++    P S       + E R+TDG S+NFNG+F   
Sbjct  27   NPNGGDTIVFTTLGRSRYEFDIFALSTTHPPSI------SGEIRITDGESVNFNGYFPSP  80

Query  184  -------------LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPQQLLSPSG  303
                         +  GD+     ++V+ER+G+  IY   L      S  K + +L    
Sbjct  81   SPALISLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEAQS  140

Query  304  TL------------------FHDRPVVRDGRLLYISAH  363
             +                  F D+P +    L+Y+S H
Sbjct  141  RVQIQLLTNADNRSGNTVNSFKDKPSLSGEFLVYVSTH  178



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 69/150 (46%), Gaps = 45/150 (30%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            TI+F+T+GRSHY FDIF++    S  Q    + E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSHYEFDIFAL----STTQPPSVSGELRITDGESVNFNGYFPSPSPALLSLL  88

Query  184  -----LDEGDT----FVFVSERSGSPRIY----------LQENRSASAGKPQQLLSP---  297
                 +   D+     ++V+ER+G+  +Y           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSLYYDLVYGGNSDFKTKRRSVLEAPSRVQVPLLS  148

Query  298  -----SGTL---FHDRPVVRDGRLLYISAH  363
                 SG     F D+P +    ++Y+S H
Sbjct  149  RFDHLSGMTVNSFKDKPSLSGEFIVYVSTH  178



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 39/141 (28%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNGHF ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGHFPNKTRIQS  80

Query  202  ---------FVFVSERSGSPRIYLQ----ENRSASAGKPQQL------LSPSGTL-----  309
                      ++V+ER+G   I+       + +AS+G+   L        P  +L     
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSXTASSGRRSTLEVSXRVQVPLLSLEQGQN  140

Query  310  ---FHDRPVVRDGRLLYISAH  363
                 DRP +    L+Y+S H
Sbjct  141  RLSMKDRPTLTGDYLVYVSTH  161



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 71/146 (49%), Gaps = 37/146 (25%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-----  186
            ++ + +I+F+T+GRS Y FDIF++ + S  E +     E +LTDG S+NFNG+FL     
Sbjct  31   LNANTSIIFTTLGRSSYAFDIFALPIYSPTESN-----ELQLTDGNSVNFNGYFLATLPP  85

Query  187  ------------DEGDTF--VFVSERSGSPRIYLQE-----NRSA--------SAGKPQQ  285
                        +E   F  ++V+ER+G+  I+        +R A         + + Q 
Sbjct  86   SLVSRLPDHSLNNETPPFHLIYVTERNGTHHIFYDAVFHGTSRRAILDFPARTESTRVQV  145

Query  286  LLSPSGTLFHDRPVVRDGRLLYISAH  363
             L  +     D+P +    L+Y+S H
Sbjct  146  PLVGAHVSLKDKPSLVGESLIYVSTH  171



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 62/134 (46%), Gaps = 30/134 (22%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  201
            +I+F+T+GR  Y FDI+S+ +   +        E +LTDG S+NFNG FL    +     
Sbjct  33   SIIFTTLGRPDYAFDIYSLPIHHHYHH-----QELQLTDGHSVNFNGQFLPNLTSIKLLT  87

Query  202  --------FVFVSERSGSPRIYLQENRSASAG---------KPQQLLSPSGTL-FHDRP-  324
                     V+V+ER+G P IY     + +            P  L      L   D+P 
Sbjct  88   HQDPPPLQLVYVTERTGFPTIYYDAVYTTTTKINDRIQLPLLPNHLTQTQSQLSIKDKPS  147

Query  325  VVRDGR-LLYISAH  363
            +  DG+ L+Y+S H
Sbjct  148  LSSDGQYLIYVSTH  161



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 23/93 (25%)
 Frame = +1

Query  31   HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDE-----  192
             GT+ F++VGR+HY FDI+++ L P  F  +     E  +TDG S+N NG +L       
Sbjct  37   QGTLAFASVGRAHYAFDIYTLPLQPLRFSTN---LEETLVTDGESVNHNGQYLQGPGIQT  93

Query  193  --------------GDTFVFVSERSGSPRIYLQ  249
                           +   FVSER G P +YL 
Sbjct  94   LMHRLNINTTSTPVENVMAFVSERDGFPELYLN  126



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 42/147 (29%)
 Frame = +1

Query  37   TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-----  198
            +I+F+T+G RS   FDIF+  LP++   D   ++E ++TDG S++FNGHF          
Sbjct  32   SIIFATLGSRSSNAFDIFA--LPTTTPPDS--SNEIQITDGKSLSFNGHFPSPTSLVSLF  87

Query  199  -----------------TFVFVSERSGSPRIYLQ----------ENRSASAGKPQQLL--  291
                             T ++V+ER GS  IYL            +RSA    P+  +  
Sbjct  88   PNQTLIHSSAHQNSASITVIYVTERGGSSTIYLDVLSYDTARSARSRSALETPPRVQIPL  147

Query  292  ---SPSGTLFHDRPVVRDGRLLYISAH  363
               +  G  F D+P +    L+Y+S H
Sbjct  148  LKGNNVGVSFKDKPTINGNYLVYLSTH  174



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +1

Query  22   MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            ++ H +I+F+T+GRS Y FDIF++    S  Q +    E +LTDG S+NFNG+F
Sbjct  34   LNAHTSIIFTTLGRSSYAFDIFALPTTHSPIQSK----ELQLTDGNSVNFNGYF  83



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 25/92 (27%)
 Frame = +1

Query  40   IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH----RLTDGVSINFNGHF--------  183
            IVF+T+GRS Y FDI++  LP    +     S H    ++TDG+S+NFNGHF        
Sbjct  34   IVFTTLGRSRYNFDIYT--LPIFTTKSSASISNHHQELKVTDGISVNFNGHFPINSTSIF  91

Query  184  --LDEGDT---------FVFVSERSGSPRIYL  246
              L++ ++          ++V+ER+GS  IY 
Sbjct  92   SLLNQPNSPPSPTTNIQLIYVTERNGSFNIYF  123



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 66/172 (38%), Gaps = 63/172 (37%)
 Frame = +1

Query  31   HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRR-PASEHRLTDGVSINFNGHFLD-----  189
             GT+ F++VGR+ Y FD+F +   P   E     P  E R TDGVS+N+NG  +D     
Sbjct  27   EGTVAFASVGRARYAFDVFLLDFRPWELENASLGPHLEFRATDGVSVNYNGALVDDSQRR  86

Query  190  ------------EGDT----FVFVSERSGSPRI------------------YLQENRSAS  267
                        +GD      ++VSER G+  +                   ++     S
Sbjct  87   VIFEALDFRGEQQGDASQGILIYVSERDGAAEVRFNLFYQGQRDRGERSLGNIESGSQES  146

Query  268  AGKPQQLLSPSG----------------------TLFHDRPVVRDGRLLYIS  357
             G  +  L   G                      T  +DRP V DGR++++S
Sbjct  147  HGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTALYDRPSVADGRVIFVS  198



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            +IVF+T+GR  Y FDIF+  LP+        + E R+TDGV +NFNGHF
Sbjct  12   SIVFTTLGRPSYEFDIFT--LPTRHRSPPSDSGELRITDGVPVNFNGHF  58



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 30/94 (32%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  183
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  184  --------LDEGDT------FVFVSERSGSPRIY  243
                    L + +T       ++++ER+G+  IY
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIY  130



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 59/126 (47%), Gaps = 34/126 (27%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF------LD  189
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F      L 
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPIYYDLLH  85

Query  190  EGD--------TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRL  345
             GD        + +  + R   P +   E+RS +              F D+P +    L
Sbjct  86   GGDPDSKSKRRSMLEATSRVQIPLLSNAEHRSGNTVNS----------FKDKPSLSGEFL  135

Query  346  LYISAH  363
            +Y+S H
Sbjct  136  VYVSTH  141



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 30/94 (32%)
 Frame = +1

Query  34   GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  183
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  184  --------LDEGDT------FVFVSERSGSPRIY  243
                    L + +T       ++++ER+G+  IY
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIY  130



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 4/49 (8%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F
Sbjct  35   TIIFTTLGRSRYEFDIFAL----STAQPPSVSGEFRITDGESVNFNGYF  79



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHF  183
            +I+F+T+GRS Y FDI+++ +      DR   A+E ++TDG S+NFNGHF
Sbjct  31   SIIFTTLGRSDYAFDIYTLPI-----SDRPTTANEIKITDGESVNFNGHF  75



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 68/150 (45%), Gaps = 45/150 (30%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            TI+F+T+GRS Y FDIF++    S       ++E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSRYEFDIFTL----STTHPPSDSNELRITDGESVNFNGYFPSPTPALISLL  88

Query  184  -----LDEGDT----FVFVSERSGSPRIYL----------QENRSASAGKPQQLLSP---  297
                 +   D+     ++V+ER+G+  IY           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSIYYDLIYGGDSDSKMKRRSVLEAPSRVQVPLLS  148

Query  298  -----SGTL---FHDRPVVRDGRLLYISAH  363
                 SG     F D+P +    L+Y+S H
Sbjct  149  GFDHQSGMTVNSFKDKPSLSGEFLVYVSTH  178



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 31/95 (33%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT---  201
            +IVF+T+GR+ Y FDI+S+ L  +      PAS  E +LTDGVS+NFNG+F         
Sbjct  38   SIVFTTLGRASYCFDIYSLPLWVA------PASSNELQLTDGVSVNFNGYFPSPSSVSVL  91

Query  202  --------------------FVFVSERSGSPRIYL  246
                                 V+V+ER+GS  ++L
Sbjct  92   FGAPDRTPADVSPPPPPPLHLVYVTERNGSSHVFL  126



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 7/49 (14%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  183
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNG+F
Sbjct  24   SIIFTTLGRSTYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGNF  65



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 39/146 (27%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  184  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  297
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  298  ----SGTLFHDRPVVRDGRLLYISAH  363
                +   F DRP +    L+Y+S H
Sbjct  146  QKNEAKVSFKDRPSLSGDYLVYVSTH  171



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 68/141 (48%), Gaps = 39/141 (28%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  201
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNG+F ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGNFPNKTRIQS  80

Query  202  ---------FVFVSERSGSPRIYLQ----ENRSASAGKPQQLLS------PSGTL-----  309
                      ++V+ER+G   I+       + +AS+G+   L        P  +L     
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSPTASSGRRSTLEVSDRVQIPLLSLEQGQN  140

Query  310  ---FHDRPVVRDGRLLYISAH  363
                 DRP +    L+Y+S H
Sbjct  141  RLSMKDRPTLTGDYLVYVSTH  161



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 64/147 (44%), Gaps = 35/147 (24%)
 Frame = +1

Query  16   MIMDPHG--TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF--  183
            +  + HG  +IVF+T GR  Y FDIF++ +         P +E R+TDG S+NFNGHF  
Sbjct  42   ITAEDHGPSSIVFTTNGRLDYYFDIFTLPV----AHPTHPIAETRITDGQSVNFNGHFPS  97

Query  184  ---------------LDEGDTFVFVSERSGSPRIYLQE-------NRSASAGKPQQ----  285
                            D     ++V+ER+G   I+          +R  SA +       
Sbjct  98   STFFPNQTRLRSPNRPDPSLQIIYVTERNGFSNIFYDAVYFDDSPSRKRSALEVVDRVQL  157

Query  286  -LLSPSGTLFHDRPVVRDGRLLYISAH  363
             LL        D+P +    L+Y+S H
Sbjct  158  PLLGSDRVSMKDKPSLTGEYLVYVSTH  184



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 39/146 (27%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  184  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  297
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  298  ----SGTLFHDRPVVRDGRLLYISAH  363
                +   F DRP +    L+Y+S H
Sbjct  146  QKNEARVSFKDRPSLSGDYLVYVSTH  171



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 46/151 (30%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  183
            TI+F+T+GRS Y FDIF++    S  +    + E R+TDG S+NFNG+F           
Sbjct  36   TIIFTTLGRSRYEFDIFAL----STAKPPSVSDELRITDGESVNFNGYFPSPSPALISLL  91

Query  184  LDEGDT---------FVFVSERSGSPRIYL-----------QENRSASAGKPQQLLSP--  297
             DE             ++V+ER+G+  +Y            +  R +    P ++  P  
Sbjct  92   PDETQIQLEDSSPLHLIYVTERNGTSSLYYDLIYGGVDSDSKRRRRSVLEAPSRVQVPLL  151

Query  298  ------SGTL---FHDRPVVRDGRLLYISAH  363
                  SG     F D+P +    L+Y+S H
Sbjct  152  SGFDQRSGMTVNSFKDKPSLSGEFLVYVSTH  182



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 8/51 (16%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP--ASEHRLTDGVSINFNGHF  183
            +IVF+T+GR  Y FDIF+  LP+    DR P  ++E ++TDG S+NFNGHF
Sbjct  32   SIVFTTLGRLDYAFDIFT--LPT----DRPPTISNEIQITDGESVNFNGHF  76



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 30/88 (34%)
 Frame = +1

Query  55   VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------------  183
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLL  100

Query  184  -------LDEGDTFVFVSERSGSPRIYL  246
                    DE    ++V+ER+GS  IYL
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYL  128



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 43/88 (49%), Gaps = 30/88 (34%)
 Frame = +1

Query  55   VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------------  183
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLV  100

Query  184  -------LDEGDTFVFVSERSGSPRIYL  246
                    DE    ++V+ER+GS  IYL
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYL  128



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 10/52 (19%)
 Frame = +1

Query  37   TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF  183
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYF  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561481202700