BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF003B23

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   114   3e-28   Nicotiana sylvestris
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 112   1e-27   Nicotiana tabacum [American tobacco]
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   112   1e-27   Nicotiana tomentosiformis
ref|NP_001275065.1|  major intrinsic protein 2                          111   2e-27   Solanum tuberosum [potatoes]
gb|AFQ23186.1|  aquaporin PIP2;1                                        110   1e-26   Eustoma exaltatum subsp. russellianum [bluebells]
ref|NP_001289846.1|  probable aquaporin PIP2-1                          108   4e-26   
gb|AAB18227.1|  MipC                                                    108   5e-26   Mesembryanthemum crystallinum
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   107   2e-25   Cicer arietinum [garbanzo]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   105   4e-25   Nicotiana sylvestris
gb|ABB13430.2|  plasma membrane intrinsic protein                       105   4e-25   Olea europaea
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   104   1e-24   Nicotiana tomentosiformis
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          103   2e-24   Solanum tuberosum [potatoes]
ref|XP_003606384.1|  Aquaporin PIP2-7                                   102   3e-24   
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     101   4e-24   Eucalyptus grandis [rose gum]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   102   1e-23   Medicago truncatula
emb|CAB45651.1|  putative plasma membrane intrinsic protein             101   2e-23   Pisum sativum [garden pea]
gb|KJB62460.1|  hypothetical protein B456_009G418100                  99.8    2e-23   Gossypium raimondii
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             100   2e-23   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   100   2e-23   Citrus sinensis [apfelsine]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   100   3e-23   Eucalyptus grandis [rose gum]
gb|KJB56129.1|  hypothetical protein B456_009G107200                    100   3e-23   Gossypium raimondii
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             100   3e-23   Citrus clementina [clementine]
emb|CDP07111.1|  unnamed protein product                                100   3e-23   Coffea canephora [robusta coffee]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   100   4e-23   Tarenaya hassleriana [spider flower]
gb|KHG00060.1|  putative aquaporin PIP2-2                               100   4e-23   Gossypium arboreum [tree cotton]
gb|AJF34896.1|  plasma membrane intrinsic protein 2-2                 95.9    7e-23   Stipa purpurea
gb|KJB56128.1|  hypothetical protein B456_009G107200                  99.8    8e-23   Gossypium raimondii
gb|KJB62459.1|  hypothetical protein B456_009G418100                  99.4    9e-23   Gossypium raimondii
gb|ABK60196.1|  PIP2 protein                                          99.4    9e-23   Gossypium hirsutum [American cotton]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                       99.4    1e-22   Ricinus communis
ref|NP_001240223.1|  prolactin-inducible protein                      99.0    1e-22   Glycine max [soybeans]
gb|ADK25057.1|  plasma membrane intrinsic protein                     99.0    1e-22   Glycine max [soybeans]
gb|AEC45513.1|  plasma membrane intrinsic protein                     99.0    1e-22   Hevea brasiliensis [jebe]
gb|AFK47400.1|  unknown                                               99.0    2e-22   Lotus japonicus
gb|AFK35635.1|  unknown                                               96.3    2e-22   Medicago truncatula
gb|AIA83106.1|  putative aquaporin PIP2                               97.8    3e-22   Citrus trifoliata [hardy orange]
gb|KHG29841.1|  putative aquaporin PIP2-2                             97.8    4e-22   Gossypium arboreum [tree cotton]
gb|KJB16798.1|  hypothetical protein B456_002G2484002                 93.6    4e-22   Gossypium raimondii
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                      97.8    4e-22   Brachypodium distachyon [annual false brome]
gb|AHG32324.1|  PIP2-3                                                97.4    4e-22   Pisum sativum [garden pea]
gb|KHN05685.1|  Aquaporin PIP2-7                                      97.4    4e-22   Glycine soja [wild soybean]
gb|KJB16797.1|  hypothetical protein B456_002G2484002                 94.7    5e-22   Gossypium raimondii
gb|AAO39007.1|  plasma intrinsic protein 2,1                          97.1    6e-22   Juglans regia
gb|KHN38765.1|  Aquaporin PIP2-7                                      97.1    6e-22   Glycine soja [wild soybean]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                      97.1    6e-22   Glycine max [soybeans]
gb|AAO39008.1|  plasma intrinsic protein 2,2                          97.1    6e-22   Juglans regia
gb|ACU23034.1|  unknown                                               94.7    6e-22   Glycine max [soybeans]
ref|NP_001105026.1|  aquaporin PIP2-4                                 97.1    7e-22   Zea mays [maize]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                       96.7    8e-22   Jatropha curcas
gb|KJB36606.1|  hypothetical protein B456_006G166800                  95.5    9e-22   Gossypium raimondii
gb|ACG33001.1|  aquaporin PIP2.2                                      96.3    1e-21   Zea mays [maize]
gb|KJB11821.1|  hypothetical protein B456_002G2484001                 96.3    1e-21   Gossypium raimondii
gb|ABK60195.2|  PIP2 protein                                          96.3    1e-21   Gossypium hirsutum [American cotton]
ref|NP_001105025.1|  aquaporin PIP2-3                                 96.3    1e-21   Zea mays [maize]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650        95.9    2e-21   Sorghum bicolor [broomcorn]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                 95.9    2e-21   Setaria italica
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg           95.5    2e-21   Eutrema salsugineum [saltwater cress]
gb|AFK47442.1|  unknown                                               95.5    2e-21   Medicago truncatula
gb|ACJ85173.1|  unknown                                               95.5    2e-21   Medicago truncatula
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715           95.5    2e-21   
gb|AGD98714.1|  aquaporin protein 11                                  95.5    2e-21   Camellia sinensis [black tea]
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                               95.1    3e-21   Gossypium hirsutum [American cotton]
dbj|BAA23744.1|  HvPIP2;1                                             95.1    3e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAE02729.1|  PIP aquaporin                                        95.1    3e-21   Hordeum vulgare [barley]
gb|AAB67868.1|  plasma membrane major intrinsic protein 1             95.1    3e-21   Beta vulgaris [beet]
ref|NP_001289999.1|  aquaporin PIP2-1                                 95.1    3e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|AAC17529.1|  aquaporin 2                                           95.1    3e-21   Samanea saman [cow-tamarind]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                        95.1    3e-21   Gossypium arboreum [tree cotton]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                       95.1    4e-21   Ricinus communis
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2         94.7    4e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003591905.1|  Aquaporin PIP                                    94.7    4e-21   
gb|AEO13898.1|  aquaporin 7                                           94.7    4e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1             94.4    5e-21   Nicotiana tomentosiformis
gb|EMT09900.1|  Putative aquaporin PIP2-2                             94.7    5e-21   
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                      94.4    5e-21   Phoenix dactylifera
gb|ABU94631.1|  putative aquaporin PIP2;3                             94.4    6e-21   Phaseolus vulgaris [French bean]
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g           94.4    6e-21   Phaseolus vulgaris [French bean]
emb|CDY56697.1|  BnaCnng31040D                                        94.4    7e-21   Brassica napus [oilseed rape]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                 94.4    7e-21   Phoenix dactylifera
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  94.0    7e-21   Nicotiana sylvestris
gb|KJB20285.1|  hypothetical protein B456_003G141600                  94.4    8e-21   Gossypium raimondii
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1       94.0    8e-21   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                 94.0    9e-21   Nelumbo nucifera [Indian lotus]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                        94.0    9e-21   Gossypium arboreum [tree cotton]
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg           93.6    1e-20   Capsella rubella
gb|AIA83104.1|  putative aquaporin PIP2                               93.6    1e-20   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                        93.6    1e-20   Gossypium arboreum [tree cotton]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg              93.2    2e-20   Erythranthe guttata [common monkey flower]
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2              93.2    2e-20   Populus trichocarpa x Populus deltoides
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                      92.8    2e-20   Brassica rapa
gb|AFH36337.1|  aquaporin PIP2;2                                      92.8    2e-20   Quercus petraea [durmast oak]
ref|XP_002322877.1|  major intrinsic protein 1                        92.8    2e-20   Populus trichocarpa [western balsam poplar]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                     92.8    2e-20   Raphanus sativus
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                      92.8    2e-20   Camelina sativa [gold-of-pleasure]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                       92.4    3e-20   Jatropha curcas
gb|ADJ67992.1|  aquaporin                                             92.4    3e-20   Fragaria x ananassa
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g           92.4    3e-20   Phaseolus vulgaris [French bean]
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7             92.4    3e-20   Phaseolus vulgaris [French bean]
gb|ABU94630.1|  putative aquaporin PIP2;2                             92.4    3e-20   Phaseolus vulgaris [French bean]
ref|NP_190910.1|  aquaporin PIP2-1                                    92.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                 92.4    3e-20   Populus euphratica
ref|NP_001234625.1|  aquaporin                                        92.4    3e-20   Solanum lycopersicum
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                 92.4    3e-20   Setaria italica
ref|NP_001105639.1|  aquaporin PIP2-7                                 92.0    4e-20   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                  92.0    4e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001240039.1|  uncharacterized protein LOC100782155             92.0    4e-20   Glycine max [soybeans]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                92.0    4e-20   Pyrus communis
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                      92.0    4e-20   
gb|ACX37450.1|  plasma membrane intrinsic protein                     92.0    4e-20   Hevea brasiliensis [jebe]
ref|NP_001237286.1|  PIP2,2                                           92.0    4e-20   
gb|KHN00691.1|  Aquaporin PIP2-2                                      92.0    4e-20   Glycine soja [wild soybean]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                 92.0    4e-20   Glycine max [soybeans]
gb|ACU19125.1|  unknown                                               92.0    4e-20   Glycine max [soybeans]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5             92.0    4e-20   Pyrus x bretschneideri [bai li]
ref|NP_001235204.1|  Pip1 protein                                     92.0    4e-20   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5             92.0    5e-20   
ref|NP_001047491.1|  Os02g0629200                                     92.0    5e-20   
gb|EAY86778.1|  hypothetical protein OsI_08158                        91.7    5e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g           91.7    6e-20   Phaseolus vulgaris [French bean]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2             91.7    6e-20   Elaeis guineensis
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3      91.7    6e-20   Cucumis melo [Oriental melon]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                 91.7    6e-20   Elaeis guineensis
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                 91.3    7e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13298.1|  BnaC06g14590D                                        91.3    7e-20   Brassica napus [oilseed rape]
ref|NP_181254.1|  aquaporin PIP2-2                                    91.3    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                 91.3    8e-20   Glycine max [soybeans]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                 91.3    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                 91.3    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g           91.3    9e-20   Phaseolus vulgaris [French bean]
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                 91.3    9e-20   Cicer arietinum [garbanzo]
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2           90.5    1e-19   Elaeis guineensis
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                 90.9    1e-19   Fragaria vesca subsp. vesca
gb|AHB33479.1|  plasma intrinsic protein 2-3                          90.5    1e-19   Cucumis sativus [cucumbers]
gb|AIG92831.1|  aquaporin PIP2                                        90.5    1e-19   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                 90.5    1e-19   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                 90.5    2e-19   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1           90.5    2e-19   Elaeis guineensis
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                   90.1    2e-19   Eucalyptus grandis [rose gum]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                 90.1    2e-19   Populus euphratica
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4             90.1    2e-19   Brassica rapa
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g           90.1    2e-19   Phaseolus vulgaris [French bean]
gb|AHA84284.1|  prolactin-inducible protein                           90.1    2e-19   Phaseolus vulgaris [French bean]
gb|ACU20229.1|  unknown                                               90.1    2e-19   Glycine max [soybeans]
gb|AAY22203.1|  putative aquaporin                                    90.1    2e-19   Phaseolus vulgaris [French bean]
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                 89.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2             89.7    3e-19   Eucalyptus grandis [rose gum]
gb|EAZ23886.1|  hypothetical protein OsJ_07605                        89.7    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like        89.7    3e-19   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg           89.7    3e-19   Capsella rubella
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4            89.7    3e-19   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4             89.7    3e-19   Camelina sativa [gold-of-pleasure]
emb|CAC82712.1|  major intrinsic protein 1                            89.7    3e-19   Populus tremula x Populus tremuloides
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                 89.7    3e-19   Nelumbo nucifera [Indian lotus]
ref|NP_181255.1|  aquaporin PIP2-3                                    89.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAH60724.1|  putative plasma membrane intrinsic protein           89.4    3e-19   Populus tremula x Populus tremuloides
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg              89.4    4e-19   Erythranthe guttata [common monkey flower]
gb|ACU21481.1|  unknown                                               89.4    4e-19   Glycine max [soybeans]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg           89.4    4e-19   Prunus persica
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5             89.4    4e-19   Prunus mume [ume]
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a      91.3    4e-19   Cloning vector pBullet-pm-n
gb|KHG08488.1|  putative aquaporin PIP2-2                             89.4    4e-19   Gossypium arboreum [tree cotton]
gb|AEY75242.1|  plasma membrane intrinsic protein                     89.4    4e-19   Malus hupehensis
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter      89.0    4e-19   Medicago truncatula
gb|EMS56715.1|  putative aquaporin PIP2-2                             89.4    4e-19   Triticum urartu
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                 89.0    5e-19   Populus euphratica
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                 89.0    5e-19   Phoenix dactylifera
gb|KJB21561.1|  hypothetical protein B456_004G001400                  89.0    5e-19   Gossypium raimondii
gb|AIK66515.1|  putative aquaporin                                    89.0    5e-19   Vitis vinifera
emb|CAN75442.1|  hypothetical protein VITISV_019657                   89.0    5e-19   Vitis vinifera
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2              89.0    5e-19   Theobroma cacao [chocolate]
emb|CDP06739.1|  unnamed protein product                              89.0    5e-19   Coffea canephora [robusta coffee]
ref|XP_003597235.1|  Aquaporin PIP2-7                                 89.0    5e-19   Medicago truncatula
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                   89.0    5e-19   Vitis cinerea var. helleri x Vitis rupestris
gb|ABH09326.1|  putative aquaporin                                    89.0    6e-19   Vitis vinifera
gb|KDP29110.1|  hypothetical protein JCGZ_16499                       89.0    6e-19   Jatropha curcas
gb|AAV69744.1|  aquaporin                                             89.0    6e-19   Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                   89.0    6e-19   Vitis vinifera
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg           89.0    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g           88.6    6e-19   Populus trichocarpa [western balsam poplar]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3              88.6    7e-19   Hevea brasiliensis [jebe]
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                 86.7    8e-19   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                 88.6    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                      88.6    8e-19   Camelina sativa [gold-of-pleasure]
gb|ACM50914.1|  aquaporin                                             88.2    1e-18   Medicago falcata [sickle alfalfa]
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707           88.2    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                 87.8    1e-18   Fragaria vesca subsp. vesca
emb|CAB46351.1|  major intrinsic protein 2                            87.8    1e-18   Solanum tuberosum [potatoes]
emb|CDX74983.1|  BnaA05g07290D                                        86.7    2e-18   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg           87.4    2e-18   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                 87.0    2e-18   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg           87.4    2e-18   Eutrema salsugineum [saltwater cress]
gb|AAL32127.1|  aquaporin                                             87.4    2e-18   Medicago truncatula
ref|XP_010100853.1|  Aquaporin PIP2-1                                 87.4    2e-18   Morus notabilis
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4             87.0    2e-18   Eucalyptus grandis [rose gum]
gb|ABC69040.1|  aquaporin PIP2-1                                      87.0    2e-18   Rhododendron catawbiense [Catawba rosebay]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g           87.0    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4             87.0    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4             87.0    3e-18   Brassica rapa
gb|AGD98707.1|  aquaporin protein 4                                   87.0    3e-18   Camellia sinensis [black tea]
gb|AGG39693.1|  aquaporin protein AQU15                               86.7    3e-18   Camellia sinensis [black tea]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                86.7    3e-18   Mimosa pudica [sensitive-plant]
gb|AGD98708.1|  aquaporin protein 5                                   86.7    3e-18   Camellia sinensis [black tea]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)      86.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg           86.7    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4             86.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840        86.7    4e-18   Sorghum bicolor [broomcorn]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5             86.3    4e-18   Pyrus x bretschneideri [bai li]
gb|AAD31846.1|AF133530_1  water channel protein MipH                  86.3    4e-18   Mesembryanthemum crystallinum
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5             86.3    5e-18   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5             86.3    5e-18   Malus domestica [apple tree]
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1              85.9    6e-18   Fragaria chiloensis
emb|CDX91341.1|  BnaC04g08090D                                        85.9    6e-18   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                      85.9    7e-18   Brassica rapa
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1              85.9    7e-18   Populus trichocarpa x Populus deltoides
ref|XP_010262516.1|  PREDICTED: aquaporin PIP2-7-like                 83.2    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2             85.9    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      85.5    8e-18   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                 85.5    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      85.5    8e-18   Cucumis melo [Oriental melon]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  85.5    8e-18   Brassica rapa
gb|ABN11917.1|  aquaporin                                             85.5    8e-18   Cucurbita ficifolia [chilacayote]
gb|ACU24483.1|  unknown                                               85.5    8e-18   Glycine max [soybeans]
ref|NP_001105616.1|  aquaporin PIP2-5                                 85.5    8e-18   Zea mays [maize]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                 85.5    8e-18   Glycine max [soybeans]
gb|AFH36338.1|  aquaporin PIP2;3                                      85.5    8e-18   Quercus petraea [durmast oak]
emb|CDX10333.1|  aquaporin                                            85.5    1e-17   Coffea arabica [arabica coffee]
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                      85.5    1e-17   Fragaria vesca subsp. vesca
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                  85.1    1e-17   Ziziphus jujuba [Chinese jujube]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                       85.1    1e-17   Helianthemum almeriense
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                      85.1    1e-17   Fragaria vesca subsp. vesca
gb|ACZ06859.1|  plasma membrane intrinsic protein                     85.1    1e-17   Glycine soja [wild soybean]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                 85.1    1e-17   Setaria italica
gb|ABB88840.1|  aquaporin                                             85.1    1e-17   Stevia rebaudiana
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                 85.1    1e-17   Brassica rapa
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                 84.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                 84.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                 84.7    2e-17   Nicotiana tomentosiformis
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                 84.3    2e-17   Nicotiana sylvestris
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                84.3    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5             84.3    2e-17   Populus euphratica
gb|ABI96813.1|  plasma membrane intrinsic protein                     84.3    2e-17   Triticum aestivum [Canadian hard winter wheat]
dbj|BAE06148.1|  PIP aquaporin isoform                                84.3    2e-17   Hordeum vulgare [barley]
emb|CAH60723.1|  putative plasma membrane intrinsic protein           84.3    3e-17   Populus tremula x Populus tremuloides
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                 84.0    3e-17   Nicotiana tomentosiformis
ref|XP_002316367.1|  putative aquaporin family protein                84.0    3e-17   Populus trichocarpa [western balsam poplar]
dbj|BAF33069.1|  aquaporin                                            84.0    3e-17   Hordeum vulgare [barley]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301           84.0    3e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                 84.0    3e-17   Cicer arietinum [garbanzo]
ref|NP_001274386.1|  aquaporin PIP2-1-like                            84.0    3e-17   Cucumis sativus [cucumbers]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2             84.0    3e-17   Pyrus x bretschneideri [bai li]
ref|NP_001268056.1|  aquaporin PIP2                                   84.0    3e-17   Vitis vinifera
ref|XP_010098191.1|  Aquaporin PIP2-7                                 84.0    4e-17   Morus notabilis
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                83.6    4e-17   Pyrus communis
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                 83.6    4e-17   
gb|AAV80229.1|  aquaporin 2                                           83.6    4e-17   Aegiceras corniculatum
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                83.6    4e-17   Nicotiana tabacum [American tobacco]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                 83.6    5e-17   Nicotiana sylvestris
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                 83.6    5e-17   Nicotiana tomentosiformis
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                         83.2    5e-17   Raphanus sativus
ref|NP_001268058.1|  aquaporin-like                                   83.2    5e-17   Vitis vinifera
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                 83.2    5e-17   Fragaria vesca subsp. vesca
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg           83.2    5e-17   Citrus clementina [clementine]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2             83.2    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                 83.2    5e-17   Brassica rapa
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1  83.2    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790        83.2    6e-17   Sorghum bicolor [broomcorn]
gb|AHG32323.1|  PIP2-2                                                83.2    6e-17   Pisum sativum [garden pea]
emb|CDX91340.1|  BnaC04g08100D                                        83.2    6e-17   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1            83.2    7e-17   Populus trichocarpa [western balsam poplar]
gb|ABO69705.2|  aquaporin PIP2                                        82.8    7e-17   Prunus humilis
ref|NP_001280185.1|  aquaporin PIP2-2                                 82.8    7e-17   Prunus mume [ume]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                         82.8    8e-17   Raphanus sativus
ref|XP_010263732.1|  PREDICTED: aquaporin PIP2-7-like                 81.6    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2  82.8    8e-17   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760        82.8    9e-17   Sorghum bicolor [broomcorn]
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5             82.4    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                       82.4    1e-16   Ricinus communis
gb|AEQ20672.1|  PIP2;1                                                82.4    1e-16   Karelinia caspia
ref|NP_001274397.1|  aquaporin PIP2-1-like                            82.4    1e-16   Cucumis sativus [cucumbers]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                 82.4    1e-16   
gb|AEY75244.1|  plasma membrane intrinsic protein                     82.4    1e-16   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830        82.4    1e-16   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                 82.0    1e-16   
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2             82.0    1e-16   
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5             82.0    2e-16   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                 81.6    2e-16   
gb|ABI96814.1|  plasma membrane intrinsic protein                     81.6    2e-16   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                   81.6    2e-16   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg              81.6    2e-16   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g           81.6    2e-16   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800        81.6    2e-16   
gb|EMT03221.1|  hypothetical protein F775_43871                       81.3    2e-16   
ref|NP_001105027.1|  aquaporin PIP2-6                                 81.3    3e-16   
gb|ABK93567.1|  unknown                                               81.3    3e-16   
ref|NP_200874.1|  putative aquaporin PIP2-4                           81.3    3e-16   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5             81.3    3e-16   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                81.3    3e-16   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg           81.3    3e-16   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4             80.9    4e-16   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg           80.5    4e-16   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1             80.9    4e-16   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                 80.9    4e-16   
emb|CDX74984.1|  BnaA05g07300D                                        80.9    4e-16   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                      80.5    5e-16   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...  80.5    5e-16   
emb|CDX67611.1|  BnaA07g16510D                                        80.5    5e-16   
ref|NP_001053335.1|  Os04g0521100                                     80.5    6e-16   
ref|NP_001059542.1|  Os07g0448100                                     80.5    6e-16   
gb|EAZ03711.1|  hypothetical protein OsI_25843                        80.5    6e-16   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5             80.5    6e-16   
ref|XP_003625627.1|  Aquaporin PIP2-1                                 80.5    6e-16   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                 80.5    6e-16   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      80.1    6e-16   
gb|AFK33316.1|  unknown                                               80.1    6e-16   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                  80.1    7e-16   
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2  80.1    7e-16   
gb|ACU87558.1|  PIP protein                                           80.1    7e-16   
gb|ACJ85211.1|  unknown                                               79.7    8e-16   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6             80.1    8e-16   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6             80.1    8e-16   
gb|EMS51072.1|  Aquaporin PIP2-5                                      79.7    9e-16   
gb|EMS60960.1|  Aquaporin PIP2-4                                      79.7    9e-16   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1      79.7    9e-16   
gb|KJB26182.1|  hypothetical protein B456_004G229000                  79.7    9e-16   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270        79.7    1e-15   
gb|ABX83874.1|  plasma membrane intrinsic protein                     79.3    1e-15   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                 79.0    1e-15   
emb|CDX73446.1|  BnaC08g25570D                                        79.3    1e-15   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5             79.3    1e-15   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1         79.3    1e-15   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg           79.3    1e-15   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                      79.3    1e-15   
gb|AEQ29857.1|  aquaporin PIP2                                        79.3    1e-15   
emb|CDY07519.1|  BnaC06g15450D                                        79.3    1e-15   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                      79.3    1e-15   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                79.0    1e-15   
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg           78.6    1e-15   
gb|ACR56613.1|  plasma intrinsic protein 2;3                          79.3    2e-15   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                 79.3    2e-15   
dbj|BAG06231.1|  plasma membrane intrinsic protein                    79.3    2e-15   
gb|ADG03686.1|  aquaporin                                             79.3    2e-15   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                      79.0    2e-15   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                79.0    2e-15   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                   79.3    2e-15   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5             79.0    2e-15   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                        79.3    2e-15   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg           78.6    2e-15   
ref|XP_008359252.1|  PREDICTED: aquaporin PIP2-2-like                 76.3    2e-15   
gb|KDO44718.1|  hypothetical protein CISIN_1g0196812mg                78.2    3e-15   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                      78.6    3e-15   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg           78.2    3e-15   
gb|AEC45512.1|  plasma membrane intrinsic protein                     78.2    3e-15   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5             78.2    3e-15   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg           78.2    4e-15   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                78.2    4e-15   
emb|CDY46759.1|  BnaA03g17030D                                        78.2    4e-15   
gb|AGD98705.1|  aquaporin                                             78.2    4e-15   
gb|AGD98712.1|  aquaporin protein 9                                   77.8    4e-15   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                78.6    4e-15   
gb|AAW80918.1|  putative plasma membrane intrinsic protein            77.8    4e-15   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                   79.0    5e-15   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                 77.8    5e-15   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780        77.4    7e-15   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5             77.4    7e-15   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg              77.0    9e-15   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                  77.0    9e-15   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                   77.4    9e-15   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                   77.8    9e-15   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                 77.0    1e-14   
gb|AFQ23181.1|  aquaporin PIP2;2                                      77.0    1e-14   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                      76.6    1e-14   
ref|NP_191042.1|  putative aquaporin PIP2-5                           76.6    1e-14   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like        76.6    1e-14   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                      76.3    2e-14   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8             76.3    2e-14   
ref|NP_001274308.1|  aquaporin PIP2-1-like                            75.9    2e-14   
gb|AAF65845.1|AF255795_1  aquaporin 1                                 76.3    2e-14   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                 75.9    2e-14   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5             76.3    2e-14   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5             75.9    2e-14   
gb|ABH09328.1|  putative aquaporin                                    75.9    2e-14   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g           75.9    2e-14   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg           75.5    3e-14   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5             75.5    3e-14   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5             75.5    3e-14   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5             75.5    3e-14   
gb|ACA35273.1|  aquaporin                                             73.6    4e-14   
gb|AFQ23567.1|  aquaporin PIP2;2                                      75.1    4e-14   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg           75.1    5e-14   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6             74.7    6e-14   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg           74.7    7e-14   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                 74.3    7e-14   
ref|XP_002876271.1|  PIP2_5/PIP2D                                     74.3    8e-14   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                      74.3    8e-14   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                 74.3    9e-14   
gb|EPS68613.1|  hypothetical protein M569_06155                       73.9    1e-13   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)      73.9    1e-13   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                 73.9    1e-13   
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like        73.2    1e-13   
gb|ACV70050.1|  aquaporin PIP2;1                                      73.2    2e-13   
gb|ACV70048.1|  aquaporin PIP2;1                                      72.8    2e-13   
gb|ACG32567.1|  aquaporin PIP2.1                                      73.2    2e-13   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2              72.8    2e-13   
gb|ABM54183.1|  aquaporin                                             73.2    2e-13   
gb|ACR38689.1|  unknown                                               72.8    2e-13   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                       72.8    2e-13   
ref|NP_001274381.1|  aquaporin PIP2-7-like                            72.8    3e-13   
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like        72.8    3e-13   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like        72.8    3e-13   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                        72.8    3e-13   
ref|NP_001059545.1|  Os07g0448800                                     72.8    4e-13   
gb|AAC16545.1|  aquaporin                                             72.8    4e-13   
ref|XP_004164389.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  72.4    4e-13   
ref|NP_001289823.1|  aquaporin PIP2-1-like                            72.4    4e-13   
gb|ACE60220.1|  plasma membrane aquaporin                             72.4    4e-13   
gb|ACB87734.1|  aquaporin                                             72.4    4e-13   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                 72.4    5e-13   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      72.0    5e-13   
gb|ACV70049.1|  aquaporin PIP2;1                                      71.6    5e-13   
ref|NP_001105024.1|  aquaporin PIP2-1                                 72.0    5e-13   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8             72.0    5e-13   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                72.0    6e-13   
gb|AAO86707.1|  aquaporin                                             72.0    6e-13   
ref|XP_008442677.1|  PREDICTED: probable aquaporin PIP2-4             72.0    6e-13   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2              71.6    6e-13   
ref|XP_002879778.1|  PIP2_6/PIP2E                                     72.0    7e-13   
gb|ACV70051.1|  aquaporin PIP2;1                                      71.2    8e-13   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                               71.2    9e-13   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  71.2    1e-12   
ref|NP_001105638.1|  aquaporin PIP2-2                                 71.2    1e-12   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                 71.2    1e-12   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      70.9    1e-12   
gb|ACF79873.1|  unknown                                               70.9    2e-12   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                 70.9    2e-12   
ref|XP_010107541.1|  Aquaporin PIP2-2                                 70.9    2e-12   
gb|ACV70053.1|  aquaporin PIP2;2                                      70.1    2e-12   
gb|ABH09327.1|  putative aquaporin                                    70.5    2e-12   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                   70.5    2e-12   
ref|NP_001267957.1|  aquaporin PIP2;2                                 70.5    2e-12   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                 70.5    2e-12   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2              70.9    2e-12   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                      70.1    3e-12   
gb|EAZ03714.1|  hypothetical protein OsI_25847                        70.1    3e-12   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700        70.1    3e-12   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6             69.7    3e-12   
gb|AAG44947.1|AF290620_1  putative PIP2                               69.7    3e-12   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6             69.7    4e-12   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6             69.7    4e-12   
gb|ACV70054.1|  aquaporin PIP2;3                                      68.9    4e-12   
gb|ACV70056.1|  aquaporin PIP2;3                                      68.9    4e-12   
gb|ACV70057.1|  aquaporin PIP2;3                                      68.9    4e-12   
gb|ACG39551.1|  aquaporin PIP2.1                                      69.7    5e-12   
gb|ACV70052.1|  aquaporin PIP2;1                                      68.9    5e-12   
gb|AFN53685.1|  putative aquaporin PIP2-8                             71.6    6e-12   
gb|AFN53630.1|  putative aquaporin PIP2-8                             71.6    6e-12   
gb|AFO63679.1|  plasma intrinsic protein 2                            68.9    7e-12   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8             68.9    8e-12   
dbj|BAG68661.1|  plasma membrane intrinsic protein                    68.9    9e-12   
gb|EMS55627.1|  Aquaporin PIP2-3                                      67.4    9e-12   
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      68.6    9e-12   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  68.6    1e-11   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                  68.6    1e-11   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                    67.8    2e-11   
ref|NP_001052292.1|  Os04g0233400                                     67.8    2e-11   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2             67.8    2e-11   
gb|EEC81958.1|  hypothetical protein OsI_25844                        67.8    2e-11   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8             67.8    2e-11   
gb|ACV66986.1|  plasma membrane aquaporin 2                           67.4    3e-11   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg           66.6    3e-11   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                 67.4    3e-11   
ref|NP_179277.1|  putative aquaporin PIP2-8                           67.0    3e-11   
gb|ABI96815.1|  plasma membrane intrinsic protein                     67.4    3e-11   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg           67.0    4e-11   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                 67.0    4e-11   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like        67.0    4e-11   
dbj|BAG06230.1|  plasma membrane intrinsic protein                    67.0    4e-11   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2      67.0    4e-11   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6             67.0    4e-11   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                 66.2    5e-11   
gb|ACB71281.1|  plasma membrane intrinsic protein                     66.6    6e-11   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg           66.6    6e-11   
dbj|BAG68662.1|  plasma membrane intrinsic protein                    66.2    7e-11   
gb|ACV70047.1|  aquaporin PIP2;1                                      65.5    7e-11   
gb|AFH36336.1|  aquaporin PIP2;1                                      66.2    7e-11   
gb|AEF32110.1|  aquaporin PIP2                                        66.2    8e-11   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6             66.2    8e-11   
gb|AAM00369.1|AF366565_1  aquaporin PIP2                              65.9    1e-10   
ref|XP_002879655.1|  aquaporin                                        65.5    1e-10   
gb|EMT26209.1|  Aquaporin PIP2-3                                      65.9    1e-10   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein   65.9    1e-10   
dbj|BAJ90410.1|  predicted protein                                    65.9    1e-10   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                 65.9    1e-10   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg           65.9    1e-10   
ref|NP_001288933.1|  probable aquaporin PIP2-6                        65.9    1e-10   
emb|CDY14415.1|  BnaC03g21800D                                        65.9    1e-10   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                   65.5    1e-10   
gb|KJB73581.1|  hypothetical protein B456_011G239500                  65.1    1e-10   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                      65.5    1e-10   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                   65.5    1e-10   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                65.5    1e-10   



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VEAV EQPAE+SAKDY DPPP+PLIDF+ LTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D K GG  CGGV
Sbjct  61   VIGYKHQSDTKDGGDICGGV  80



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ LTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D K GG  CGGV
Sbjct  61   VIGYKHQSDTKDGGDICGGV  80



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ LTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D K GG  CGGV
Sbjct  61   VIGYKHQSDTKDGGDICGGV  80



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VEAV EQ AE+SAKDY DPPP+PLIDF+ LTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ D  AGG  CGGV
Sbjct  61   VIGYKHQADVDAGGDVCGGV  80



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+VE V EQP E+SAKDYHDPPP+   D D LTKWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQP-EYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQTDP AGG DCGGV
Sbjct  60   VIGYKHQTDPDAGGADCGGV  79



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VEA  EQ  E+SAKDY DPPP+PLIDF+ LTKWS YRA IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIATLLFLYITILT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ D KAGG  CGGV
Sbjct  61   VIGYKHQADVKAGGDICGGV  80



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE   +Q  EFSAKDYHDPPP+PLIDF+ L KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  61   VIGYKSQTDPNTNADQCGGV  80



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE   ++  EFSAKDY DPPP+PLIDFD LTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGY HQ+DPKAGG DC GV
Sbjct  59   IIGYSHQSDPKAGGTDCDGV  78



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VE   EQP EFSAKDY DPPP+PL+DF+ LT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KA G  CGGV
Sbjct  61   VIGYKVQSDVKADGDICGGV  80



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE+  E   E+SAKDYHDPPP+PLIDFD L+ WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  GG DCGGV
Sbjct  61   VIGYKSQIDPAHGGDDCGGV  80



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VE   EQ AEFSAKDY DPPP+PL+DF+ LT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KA G  CGGV
Sbjct  61   VIGYKVQSDVKADGDICGGV  80



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VE+V E+  EFSAKDY DPPP+PL+DF+ LT+WSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVESVTER-GEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY+HQ D  AGG  CGGV
Sbjct  60   VIGYQHQADVDAGGDVCGGV  79



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDY DPPP+PLID + LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGY HQ+DPKAGG DC GV
Sbjct  59   IIGYSHQSDPKAGGTDCDGV  78



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +PAEF+AKDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP   G DC GV
Sbjct  59   VIGYKSQTDPALKGTDCDGV  78



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDY DPPP+PLID + LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGY HQ+DPKAGG DC GV
Sbjct  59   IIGYSHQSDPKAGGTDCDGV  78



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDY DPPP+PLID D LTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVE-VQEQ-GEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGY HQTD  AGG DC GV
Sbjct  59   IIGYSHQTDANAGGTDCDGV  78



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF AKDYHDPPP+PL+D   L KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP  GG+DCGGV
Sbjct  57   VIGYKTQTDPAKGGEDCGGV  76



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+ L KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  238  ltvIGYKHQTDPKAGGQDCGGV  303
            LTVIGYK QTDP      CGGV
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGV  82



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+ L KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  238  ltvIGYKHQTDPKAGGQDCGGV  303
            LTVIGYK QTDP      CGGV
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGV  82



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +PAEF+AKDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP   G DC GV
Sbjct  59   VIGYKSQTDPALKGTDCDGV  78



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKD+E   +   EFSAKDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQ--DCGGV  303
            VIGYK QTDP       DCGGV
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGV  82



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+ L KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  238  ltvIGYKHQTDPKAGGQDCGGV  303
            LTVIGYK QTDP      CGGV
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGV  82



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
 emb|CDX10334.1| aquaporin [Coffea arabica]
Length=288

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MTKDVEAV-PEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            M KDVE V   +  EFSAKDYHDPPP+   D D LTKWSF+RA+IAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLYVTVL  60

Query  241  tvIGYKHQTDPKAGGQDCGGV  303
            TVIGYKHQTD  AGG DC GV
Sbjct  61   TVIGYKHQTDATAGGDDCNGV  81



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V E   EF+AKDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  60   VIGYKVQSDTKAGGDDCGGV  79



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKD+E   ++  EFSAKDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQ--DCGGV  303
            VIGYK QTDP       DCGGV
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGV  82



>gb|AJF34896.1| plasma membrane intrinsic protein 2-2, partial [Stipa purpurea]
Length=104

 Score = 95.9 bits (237),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   + AEFSAKDY DPPP+P+IDF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGAEFSAKDYSDPPPAPIIDFEELTKWSLYRAVIAEFVATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  61   VIGYKHQSDPTVDAADAACSGV  82



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKD+E   +   EFSAKDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  244  vIGYKHQTDPKAGGQ--DCGGV  303
            VIGYK QTDP       DCGGV
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGV  82



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF AKDYHDPPP+PL+D   L KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP  GG+DCGGV
Sbjct  57   VIGYKTQTDPAKGGEDCGGV  76



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF AKDYHDPPP+PL+D   L KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP  GG+DCGGV
Sbjct  57   VIGYKTQTDPAKGGEDCGGV  76



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EFSAKDYHDPPP+PLID D L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  61   VIGYKSQTDPDKNADACGGV  80



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG DC GV
Sbjct  60   IIGYKRQTDTTVGGTDCDGV  79



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG DC GV
Sbjct  60   IIGYKRQTDTTVGGTDCDGV  79



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V E P EFSAKDYHDPPP+PLID + L KWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVE-VAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  60   VIGYKSQTDPLKNADVCGGV  79



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS+KDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D K GG DCGGV
Sbjct  59   VIGYKVQSDVKNGGDDCGGV  78



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG  CGGV
Sbjct  59   VIGYSIQTDVKAGGDACGGV  78



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 64/85 (75%), Gaps = 5/85 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPA-----EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllfly  228
            M KDVE   +Q       EFSAKDYHD PP+PLIDFD L KWSFYRAVIAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  229  vtvltvIGYKHQTDPKAGGQDCGGV  303
            VTVLTVIGYK QTDP      CGGV
Sbjct  61   VTVLTVIGYKSQTDPTLNTDQCGGV  85



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            MTKD+E   EQ   AEFSAKDYHDPPP+PLID + LTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  238  ltvIGYKHQTDPKAGGQ--DCGGV  303
            LTVIGYK QTDP       DCGGV
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGV  84



>gb|KJB16798.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=100

 Score = 93.6 bits (231),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+P +D   LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  GGQDC GV
Sbjct  57   VIGYKSQVDPDKGGQDCDGV  76



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+P++DF+ LTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  61   VIGYKHQTDVSASGPDAACGGV  82



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG +CGGV
Sbjct  59   VIGYSIQTDVKAGGDECGGV  78



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  60   IIGYKRQTDTTVGGTECDGV  79



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score = 94.7 bits (234),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+P +D   LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  GGQDC GV
Sbjct  57   VIGYKSQVDPDKGGQDCDGV  76



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA  +    FSAKDYHDPPP+PLID +  T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD   GG DCGGV
Sbjct  59   VIGYKSQTDKAKGGDDCGGV  78



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  60   IIGYKRQTDATLGGTECDGV  79



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  60   IIGYKRQTDATLGGTECDGV  79



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA  +    FSAKDYHDPPP+PLID +  T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD   GG DCGGV
Sbjct  59   VIGYKSQTDKAKGGDDCGGV  78



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score = 94.7 bits (234),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY HQTD K  G+ CGGV
Sbjct  59   VIGYNHQTDLKENGEICGGV  78



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  61   VIGYKHQTDASASGPDAACGGV  82



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V E   EFS KDYHDPPP+PLID D L +WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  60   VIGYKSQTDPNKNADACGGV  79



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PL+D + LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  G  +CGGV
Sbjct  57   VIGYKSQVDPDKGSDECGGV  76



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PL+D + LT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  61   VIGYKHQTDASASGPDAACGGV  82



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PL+D   LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  GGQDC GV
Sbjct  57   VIGYKSQVDPDKGGQDCDGV  76



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PL+D   LT+WSFYRA+IAEFIA LLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  GGQDC GV
Sbjct  57   VIGYKSQVDPDKGGQDCDGV  76



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  70   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvI  249
            +D+EA   +  EFSAKDY DPPP+PLID D LTKWS YRAVIAEFIATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  250  GYKHQTDPKAGGQD--CGGV  303
            GYKHQTD  A G D  CGGV
Sbjct  64   GYKHQTDAAASGPDAACGGV  83



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID   LT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  61   VIGYKHQTDATASGPDAACGGV  82



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  61   VIGYKHQTDAAASGPDAACGGV  82



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DY DPPP+PL D + LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  59   VIGYKIQSDTTAGGVDCGGV  78



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG  CGGV
Sbjct  59   VIGYSIQTDVKAGGDACGGV  78



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG  CGGV
Sbjct  59   VIGYSIQTDVKAGGDACGGV  78



>ref|XP_002877918.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54177.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DYHDPPP+P ID   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYHDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  59   VIGYKIQSDTTAGGVDCGGV  78



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+VE       EFSAKDYHDPPP+PL+D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  61   VIGYKSQTDPIKNADQCGGV  80



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 65/84 (77%), Gaps = 4/84 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            MTKD+E   EQ   AEFSAKDY DPPP+PLID + LTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  238  ltvIGYKHQTDPKAGGQ--DCGGV  303
            LTVIGYK QTDP       DCGGV
Sbjct  61   LTVIGYKVQTDPVKNTVDPDCGGV  84



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            MTKDVEAV EQ   EFS KDYHDPPP+PLID + L KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  241  tvIGYKHQTDPKAGGQDCGGV  303
            TVIG+    D + GG++C GV
Sbjct  61   TVIGHFRSADLENGGENCTGV  81



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            MTKDVEAV EQ   EFS KDYHDPPP+PLID + L KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  241  tvIGYKHQTDPKAGGQDCGGV  303
            TVIG+    D + GG++C GV
Sbjct  61   TVIGHFRSADLENGGENCTGV  81



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   +SAKDYHDPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG  CGGV
Sbjct  59   VIGYKSQSDTKAGGDVCGGV  78



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PL+D + LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  G  +CGGV
Sbjct  57   VIGYKSQVDPDKGSDECGGV  76



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V     EF AKDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  60   VIGYKSQTDPAKNADACGGV  79



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS KDY DPPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>ref|XP_003591905.1| Aquaporin PIP [Medicago truncatula]
Length=283

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG  CGGV
Sbjct  59   VIGYSIQTDVKAGGDACGGV  78



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS KDY DPPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA      EFSAKDY DPPP+PLIDF+ L +WSFYRA IAEFIATLLFLYVTVLT
Sbjct  1    MGKDVEA----ATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D  A G  CGGV
Sbjct  57   VIGYKHQSDVDANGDVCGGV  76



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS KDY DPPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA  E   EF+AKDY DPPP+PLID + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+D   GG D  C GV
Sbjct  60   VIGYKHQSDANVGGADAACSGV  81



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D K  G  CGGV
Sbjct  59   VIGYKHQSDLKDHGDACGGV  78



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D K  G  CGGV
Sbjct  59   VIGYKHQSDLKDHGDACGGV  78



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAV  +   F  +DY DPPP+PL D + LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKIQTDSTAGGVDCGGV  78



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA  E   EF+AKDY DPPP+PLID + LT WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP   G D  C GV
Sbjct  60   VIGYKHQSDPNVNGTDAACSGV  81



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA      EFSAKDY DPPP+PLIDF+ L +WSFYRA IAEFIATLLFLYVTV T
Sbjct  1    MGKDVEA----ATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ+D  A G  CGGV
Sbjct  57   VIGYKHQSDVDANGDVCGGV  76



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 65/84 (77%), Gaps = 4/84 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtv  237
            MTKD+E   EQ   AEFSAKDY DPPP+PLID + LTKWS YRA IAEFIATLLFLYVTV
Sbjct  30   MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  89

Query  238  ltvIGYKHQTDPKAGGQ--DCGGV  303
            LTVIGYK QTDP       DCGGV
Sbjct  90   LTVIGYKVQTDPVKNTVDPDCGGV  113



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY HQTD K  G+ CGGV
Sbjct  59   VIGYNHQTDLKENGEICGGV  78



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE+   + ++FSAKDYHDPPP+ LID D L+KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVES--SEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G DCGGV
Sbjct  59   VIGYKRQTDSSHNGTDCGGV  78



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   EQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  270
            E   EF AKDYHDPPP+PL+D   L KWSFYRAVIAEFIATL FLY+TVLTVIGYK QTD
Sbjct  6    EVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGYKTQTD  65

Query  271  PKAGGQDCGGV  303
               GG+DCGGV
Sbjct  66   LAKGGEDCGGV  76



>ref|XP_006291609.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
 gb|EOA24507.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
Length=287

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE VP +   F  +DY DPPP+P  D   LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  59   VIGYKLQSDLKAGGDDCGGV  78



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAE---FSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvt  234
            M KDVE   +Q      FSAKDYHDPPP+PLIDF+ L KWSFYRAVIAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  235  vltvIGYKHQTDPKAGGQDCGGV  303
            VLT IGYK QTDP      CGGV
Sbjct  61   VLTAIGYKSQTDPTLNTDQCGGV  83



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PL+D   LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP  G QDC GV
Sbjct  57   VIGYKSQVDPDKGSQDCDGV  76



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE   + PA FSAKDYHDPPP+PL D   LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEC-ADPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D   GG  CGGV
Sbjct  60   VIGYKVQSDAVHGGDQCGGV  79



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EFSAKDYHDPPP+PLID + +T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G +CGGV
Sbjct  57   VIGYKSQTDVNKNGDECGGV  76



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAV  +   F  +DY DPPP+PL D   LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKIQTDSTAGGVDCGGV  78



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +  E+SAKDYHDPPP+PLID + LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  59   VIGYKSQTDPLKNADQCGGV  78



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EFSAKDYHDPPP+PLID + +T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G +CGGV
Sbjct  57   VIGYKSQTDVNKNGDECGGV  76



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAV  +   F  +DY DPPP+PL D + LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK +TD  AGG DCGGV
Sbjct  59   VIGYKIETDSTAGGVDCGGV  78



>ref|XP_010426989.1| PREDICTED: aquaporin PIP2-1 [Camelina sativa]
Length=287

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DY DPPP+P  D   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  59   VIGYKIQSDVKAGGVDCGGV  78



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDV     +   FSAKDYHDPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVA----EQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  57   VIGYKSQTDPAKNADSCGGV  76



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D   GG  CGGV
Sbjct  59   VIGYKSQIDADLGGDACGGV  78



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQP E+SAKDYHDPPP+PL D D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK QTD    G  +C GV
Sbjct  60   IIGYKRQTDTSIPGNTECDGV  80



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQP E+SAKDYHDPPP+PL D D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK QTD    G  +C GV
Sbjct  60   IIGYKRQTDTSIPGNTECDGV  80



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQP E+SAKDYHDPPP+PL D D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK QTD    G  +C GV
Sbjct  60   IIGYKRQTDTSIPGNTECDGV  80



>ref|NP_190910.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 ref|NP_001030851.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 sp|P43286.1|PIP21_ARATH RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; Short=AtPIP2;1; AltName: Full=Plasma 
membrane intrinsic protein 2a; Short=PIP2a; Contains: RecName: 
Full=Aquaporin PIP2-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16195.1|AF428426_1 AT3g53420/F4P12_120 [Arabidopsis thaliana]
 emb|CAA53477.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 emb|CAB67649.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAK62634.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAK73268.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAL06973.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAL62366.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAM65406.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AEE79083.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 gb|AEE79084.1| aquaporin PIP2-1 [Arabidopsis thaliana]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DY DPPP+P ID   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  59   VIGYKIQSDTDAGGVDCGGV  78



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EFSAKDYHDPPP+PLID + +T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKSQTDVNKNGDQCGGV  76



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 7/80 (9%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+V        +FSAKDY DPPP+PL+DF+ L +WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MTKEVT-------DFSAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLYVTILT  53

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQ D  AGG  CGGV
Sbjct  54   VIGYKHQADVDAGGDVCGGV  73



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = +1

Query  64   MTKDVEAVPE-QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            M KD+EA    +  E++AKDY DPPP+PLID + LTKWS YRAVIAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA  60

Query  241  tvIGYKHQTDPKAGGQD--CGGV  303
            TVIGYKHQTD  A G D  CGGV
Sbjct  61   TVIGYKHQTDAAASGPDAACGGV  83



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PLID D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK Q+D K  G  +C GV
Sbjct  60   IIGYKRQSDTKIPGNTECDGV  80



>gb|AEH76326.1| plasma membrane intrinsic protein 2A [Camelina sativa]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DY DPPP+P  D   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  59   VIGYKIQSDVKAGGFDCGGV  78



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID + LT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PLID   LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  59   VIGYKSQTDPAVNADACGGV  78



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PLID D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK Q+D K  G  +C GV
Sbjct  60   IIGYKRQSDTKIPGNTECDGV  80



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V  Q  EF AKDY+DPPP+PLID +  T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  60   VIGYKSQTDPAKNADPCGGV  79



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PLID D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK Q+D K  G  +C GV
Sbjct  60   IIGYKRQSDTKIPGNTECDGV  80



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID + LT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID + LT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PLID D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK Q+D K  G  +C GV
Sbjct  60   IIGYKRQSDTKIPGNTECDGV  80



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PLID   LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  59   VIGYKSQTDPAVNADACGGV  78



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID + LT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PLID   LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  59   VIGYKSQTDPATNADACGGV  78



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+D      D  C GV
Sbjct  61   VIGYKHQSDATVNTTDAACSGV  82



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+D      D  C GV
Sbjct  61   VIGYKHQSDATVNTTDAACSGV  82



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID   LT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDA  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDLCGGV  76



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA  E   EF+AKDY DPPP+ LID + + KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEG-GEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP  GG D  C GV
Sbjct  60   VIGYKHQSDPNVGGADAACSGV  81



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+KD+EA       F+ KDY DPPP+PLID + LT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D K+GGQ CGGV
Sbjct  56   VIGYSSQSDTKSGGQICGGV  75



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 63/82 (77%), Gaps = 8/82 (10%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEA      EF+AKDY DPPP+PLID + L KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEA------EFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVAT  54

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP  GG D  C GV
Sbjct  55   VIGYKHQSDPNVGGADAACSGV  76



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F  +DY DPPP+P  D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  57   VIGYKIQSDTKAGGVDCGGV  76



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAV  +   F ++DY DPPP+PL D + LTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVAGE--GFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VI YK QTD  AGG DCGGV
Sbjct  59   VICYKIQTDSTAGGVDCGGV  78



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F  +DY DPPP+P  D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  57   VIGYKIQSDTKAGGVDCGGV  76



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   F+AKDYHDPPP+PLID + LT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>ref|XP_010504105.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
 ref|XP_010515832.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
Length=287

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE VP +   F  +DY DPPP+P  D   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  59   VIGYKIQSDVKAGGVDCGGV  78



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F A+DY DPPP+ L+D + LT+WSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGGVAGEG-FPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD KAGG DCGGV
Sbjct  60   VIGYKSQTDTKAGGDDCGGV  79



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID   LT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDLCGGV  76



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+VE    +   FS KDYHDPPP+P ID   LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKNVEV--AERGSFSNKDYHDPPPAPFIDAAELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  QTD KAGG  CGGV
Sbjct  59   VIGYSIQTDIKAGGDVCGGV  78



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 64/82 (78%), Gaps = 6/82 (7%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA     AEF+AKDY DPPP+PL+D + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP   G D  C GV
Sbjct  57   VIGYKHQSDPNVSGPDAACNGV  78



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E  P+    FSAKDY+DPPP+PLID +   KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEVGPQ--GGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D   GG  CGGV
Sbjct  59   VIGYKSQSDTLKGGDQCGGV  78



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+KD+EA       F+ KDY DPPP+PLID + LT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D K GGQ CGGV
Sbjct  56   VIGYSSQSDTKNGGQICGGV  75



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDV   PEQ   FSAKDYHDPPP+PLID   L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDV---PEQ-GSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK  TDP      CGGV
Sbjct  57   VIGYKSTTDPALNADQCGGV  76



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+KD+EA       F+ KDY DPPP+PLID + LT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D K GGQ CGGV
Sbjct  56   VIGYSSQSDTKNGGQICGGV  75



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+KD+EA       F+ KDY DPPP+PLID + LT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D K GGQ CGGV
Sbjct  56   VIGYSSQSDTKNGGQICGGV  75



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 64/82 (78%), Gaps = 6/82 (7%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA     AEF+AKDY DPPP+PL+D + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP   G D  C GV
Sbjct  57   VIGYKHQSDPNVSGPDAACNGV  78



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD E V +Q  EF  KDY DPPP+PL+D + L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D   GG  C GV
Sbjct  61   VIGYSRQSDTTHGGDQCDGV  80



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EFSAKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D    G  CGGV
Sbjct  57   VIGYKSQIDTTKNGDQCGGV  76



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E   ++    +A+DY DPPP+PL D + L KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKAQTDANAGGVDCGGV  78



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E++AKDY DPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  59   IIGYKRQTDANVGGTECDGV  78



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E++AKDY DPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  59   IIGYKRQTDANVGGTECDGV  78



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   QPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  273
            +   FSAKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  274  KAGGQDCGGV  303
            KAGG  CGGV
Sbjct  67   KAGGDVCGGV  76



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E++AKDY DPPP+PL D + LT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            +IGYK QTD   GG +C GV
Sbjct  59   IIGYKRQTDANVGGTECDGV  78



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MTKDVEAVP-EQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            MTKDVEAV  +Q  EF   DYHDPPP+PLID + L KW FYRA+IAEF+ATLLFLYVT+L
Sbjct  1    MTKDVEAVSVQQQPEFLDIDYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLYVTIL  60

Query  241  tvIGYKHQTDPKAGGQDCGGV  303
            TVIG+   +D  AGG+ CGGV
Sbjct  61   TVIGHSRNSDLGAGGKSCGGV  81



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD E V +Q  EF  KDY DPPP+PL+D + L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D   GG  C GV
Sbjct  61   VIGYSRQSDTTHGGDQCDGV  80



>gb|EAZ23886.1| hypothetical protein OsJ_07605 [Oryza sativa Japonica Group]
Length=280

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQD--CGG  300
            VIGYKHQ+D      D  C G
Sbjct  61   VIGYKHQSDATVNTTDAACSG  81



>ref|XP_006648854.1| PREDICTED: probable aquaporin PIP2-2-like [Oryza brachyantha]
Length=262

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA   +  EFSAKDY DPPP+PLID + LTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  244  vIGYKHQTDPKAGGQDC  294
            VIGYKHQ+D      D 
Sbjct  61   VIGYKHQSDATVNTTDA  77



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F  +DY DPPP+P  D D LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+VE   +   EFSAKDYHDPPP+PLID + L KWSFYRA+IAEFIATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  244  vIGYKHQTDPKAGG--QDCGGV  303
            VIGYK QTD        DCGGV
Sbjct  61   VIGYKVQTDTLKNTVDADCGGV  82



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD++ V E  A  +A+DY DPPP+PL+D + L KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  60   VIGYKAQTDANAGGVDCGGV  79



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD E       E SAKDYHDPPP+PLID + +T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDFEG----GGELSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK+QTD    G +CGGV
Sbjct  57   VIGYKNQTDVHKNGHECGGV  76



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FSAKDYHDPPP+PLID   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY+ QTD    G DC GV
Sbjct  59   VIGYRSQTDQAHNGGDCEGV  78



>ref|NP_181255.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 sp|P30302.1|PIP23_ARATH RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; Short=AtPIP2;3; AltName: Full=Plasma 
membrane intrinsic protein 2c; Short=PIP2c; AltName: Full=RD28-PIP; 
AltName: Full=TMP2C; AltName: Full=Water stress-induced 
tonoplast intrinsic protein; Short=WSI-TIP; Contains: RecName: 
Full=Aquaporin PIP2-3, N-terminally processed [Arabidopsis 
thaliana]
 dbj|BAA02520.1| transmembrane channel protein [Arabidopsis thaliana]
 gb|AAD18141.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
 gb|AAL36385.1| putative aquaporin, plasma membrane intrinsic protein 2C [Arabidopsis 
thaliana]
 gb|AAM20335.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|AEC09363.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 prf||1905411A transmembrane channel
Length=285

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F  +DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  57   VIGYKIQSDTKAGGVDCGGV  76



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF AKDYHDPPP+PLID + LT+WS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKSQTDTAKNGDVCGGV  76



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+VE   E  AEF+AKDYHDPPP+PLID+D LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEC-AEPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q++       CGGV
Sbjct  60   VIGYKSQSEY----DQCGGV  75



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDYHDPPP+PLI  D LTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGYK Q+D K  G  +C GV
Sbjct  60   IIGYKRQSDTKIPGNTECDGV  80



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD       CGGV
Sbjct  59   VIGYKSQTDTTVNADACGGV  78



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD       CGGV
Sbjct  59   VIGYKSQTDTAVNADACGGV  78



>gb|AHW81492.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-n]
 gb|AHW81510.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-c]
Length=531

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVEAVP +   F  +DY DPPP+P ID   L KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGEG--FQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  59   VIGYKIQSDTDAGGVDCGGV  78



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 64/82 (78%), Gaps = 5/82 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E+  EQ    S KDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQ---VSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  244  vIGYKHQTDPKAGGQ--DCGGV  303
            VIGYK QTDP       DCGGV
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGV  79



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDY DPPP+PLID   LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--GERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  59   VIGYKSQTDPATNADACGGV  78



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  EFSAKDY DPPP+PL D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGY  Q+D    G  +C GV
Sbjct  60   IIGYSRQSDTTIKGNTECDGV  80



>gb|EMS56715.1| putative aquaporin PIP2-2 [Triticum urartu]
Length=341

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P Q  EFS K Y  PPP+P++DF+ LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKSYAAPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  60   VIGYKHQSDPTVNTTDAACSGV  81



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF+AKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D    G  CGGV
Sbjct  57   VIGYKSQIDTTKNGDQCGGV  76



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA     A F+AKDY DPPP+PLID + LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MGKDMEA---GAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVAT  57

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP   G D  C GV
Sbjct  58   VIGYKHQSDPNVNGTDAACSGV  79



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 64/82 (78%), Gaps = 5/82 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E+  EQ    S KDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQG---SGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  244  vIGYKHQTDPKAGGQ--DCGGV  303
            VIGYK QTDP       DCGGV
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGV  79



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       +F AKDYHDPPP+PL+D + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D   GG +CGGV
Sbjct  57   VIGYKSQIDK--GGDECGGV  74



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E        + AKDY DPPP+PL+D + LT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KA G  CGGV
Sbjct  61   VIGYKSQSDTKANGDICGGV  80



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  EFSAKDY DPPP+PL D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGY  Q+D    G  +C GV
Sbjct  60   IIGYSRQSDTTIKGNTECDGV  80



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       +F AKDYHDPPP+PLID +  T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEG-----GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  56   VIGYKSQTDPSKNSDACGGV  75



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT   AGG  CGGV
Sbjct  59   VIGYKSQT---AGGDPCGGV  75



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E   ++    +A+DY DPPP+PL+D + L KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKAQTDASAGGVDCGGV  78



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EFSAKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD       CGGV
Sbjct  57   VIGYKSQTDTTKNSDACGGV  76



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDV    EQ   F AKDYHDPPP+PLID   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVT---EQ-GSFPAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP      CGGV
Sbjct  57   VIGYKSQTDPAKNADSCGGV  76



>ref|XP_008345040.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=166

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E     PA    KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVGSGNPA----KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKQQTDTTLNGNQCGGV  76



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F ++DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F ++DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ AEF+AKDY DPPP+PL D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGAEFTAKDYQDPPPAPLFDTDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGY  Q+D    G  +C GV
Sbjct  60   IIGYSRQSDTSIEGNTECDGV  80



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     P  F  +DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDKTAGGVDCGGV  76



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E        F+AKDYHDPPP+PLID +   KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV-----GGFAAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D   GG  CGGV
Sbjct  56   VIGYKSQSDTLKGGDQCGGV  75



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTK+VEAV EQ AE+S KDY DPPP+PLIDF+ LTKWS YRAVIA+FIATLLFLY+TVL 
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIATLLFLYITVLI  60

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  +   K     CGGV
Sbjct  61   VIGYNIKPMLKP-ASVCGGV  79



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F+A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK  +D KAGG +CGGV
Sbjct  57   VIGYKISSDTKAGGDECGGV  76



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  61   AMTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvl  240
            AM KD++   ++    +A+DY DPPP+PL+D + L KWS YRAVIAEF+ATLLFLYV+VL
Sbjct  12   AMAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVL  69

Query  241  tvIGYKHQTDPKAGGQDCGGV  303
            TVIGYK QTD  AGG DCGGV
Sbjct  70   TVIGYKAQTDATAGGVDCGGV  90



>ref|XP_008345410.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=227

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E     PA    KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVGSGNPA----KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKQQTDTTLNGNQCGGV  76



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F+A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG-----EGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  56   VIGYKIQSDTAAGGVDCGGV  75



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE   EQ  EFSAKDY DPPP+PL D D LTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEG-QEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  244  vIGYKHQTDPKA-GGQDCGGV  303
            +IGY  Q+D    G  +C GV
Sbjct  60   IIGYSRQSDTTIKGNTECDGV  80



>ref|XP_010100853.1| Aquaporin PIP2-1 [Morus notabilis]
 gb|EXB85110.1| Aquaporin PIP2-1 [Morus notabilis]
Length=287

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKD+E    +   F+AKDYHDPPP+PL+D   L KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDLEV--TERGSFTAKDYHDPPPAPLLDSAELGKWSFYRALIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D    G  CGGV
Sbjct  59   VIGYKSQSDVNHNGDVCGGV  78



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    QP   +A+DY DPPP+PL+D + L KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDLEG--AQP-PLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP   G DCGGV
Sbjct  58   VIGYKSQTDPTMNGSDCGGV  77



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 66/82 (80%), Gaps = 10/82 (12%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M+KDVE V EQPA +SAKDYHDPPP+ LID + L KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MSKDVE-VAEQPA-YSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQ--TDPKAGGQDCGGV  303
            VIGYK Q  TDP      CGGV
Sbjct  59   VIGYKSQTTTDP------CGGV  74



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE       EF AKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV----RGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD       CGGV
Sbjct  57   VIGYKSQTDTTKNSDACGGV  76



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD++ V E  A   ++DY DPPP+PL+D + L KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  60   VIGYKAQTDANAGGVDCGGV  79



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E V E  A   A+DY DPPP+PL D + L KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLE-VQEGRA---ARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  57   VIGYKAQTDASAGGADCGGV  76



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+  V EQ   +SAKDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP      CGGV
Sbjct  59   VIGYKSQVDPVKNADQCGGV  78



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+  V EQ   +SAKDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP      CGGV
Sbjct  59   VIGYKSQVDPVKNADQCGGV  78



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   +SAKDYHDPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPK-AGGQDCGGV  303
            VIGYK QTD   A G  CGGV
Sbjct  59   VIGYKSQTDTTVATGDVCGGV  79



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+  V EQ   +SAKDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP      CGGV
Sbjct  59   VIGYKSQVDPVKNADQCGGV  78



>gb|AAM61438.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
Length=285

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F  +DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----SDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D KAGG DCGGV
Sbjct  57   VIGYKIQSDTKAGGVDCGGV  76



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE     PA    +DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEGFPA----RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD++   ++    +A+DY DPPP+PL+D + L KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKAQTDANAGGVDCGGV  78



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 5/85 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPA---EFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvt  234
            M KD+EA         E++AKDY DPPP+PL+D + LTKWS YRAVIAEF+ATLLFLY+T
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYIT  60

Query  235  vltvIGYKHQTDPKAGGQD--CGGV  303
            V TVIGYKHQTD  + G D  CGGV
Sbjct  61   VATVIGYKHQTDASSSGPDAACGGV  85



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E        +SAKDY DPPP PLID + L KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKSQTDAALNGDQCGGV  76



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD E    +  +  AKDY DPPPSPL D + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDFETGGGEVRDV-AKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP   G D  CGGV
Sbjct  60   VIGYKHQSDPLVSGADAGCGGV  81



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E        +SAKDY DPPP PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKSQTDTALNGDQCGGV  76



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E        +SAKDY DPPP PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD    G  CGGV
Sbjct  57   VIGYKSQTDTALNGDQCGGV  76



>gb|ADJ57599.1| plasma membrane intrinsic protein PIP2;1 [Fragaria chiloensis]
Length=284

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = +1

Query  70   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvI  249
            KDVE    +   FSAKDYHDPPP+PL D   LTKWSFYRAVIAEFIATLLFLY++VLTVI
Sbjct  2    KDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYISVLTVI  59

Query  250  GYKHQTDPKAGGQDCGGV  303
            GYK Q D   GG  CG V
Sbjct  60   GYKSQIDAHLGGDACGEV  77



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F+A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK  +D KAGG +CGGV
Sbjct  57   VIGYKISSDTKAGGDECGGV  76



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        F+A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK  +D KAGG +CGGV
Sbjct  57   VIGYKISSDTKAGGDECGGV  76



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       EF AKDYHDPPP+PLID + LT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD       CGGV
Sbjct  57   VIGYKSQTDTTKNSDACGGV  76



>ref|XP_010262516.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=125

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDYH+PPP PLID   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AKNGHFSTKDYHNPPPVPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QT     G DC GV
Sbjct  59   VIGYKSQTVQAHNGGDCDGV  78



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E V EQ  E++AKDY DPPP+PL+D + LTKWS YRA IAEFIAT+LFLYVTVLT
Sbjct  1    MAKDIE-VAEQ-GEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQ+DP     D  C GV
Sbjct  59   VIGYKHQSDPNVNPTDAACSGV  80



>ref|XP_008449251.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Cucumis melo]
Length=287

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA       FS KDY DPPP+PLID     KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEA--GGHGGFSGKDYEDPPPAPLIDAHEFAKWSFYRAIIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D K GG+ CGGV
Sbjct  59   VIGYKVQSDVKNGGEICGGV  78



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE        + A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----YQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_008449252.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Cucumis melo]
Length=284

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA       FS KDY DPPP+PLID     KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEA--GGHGGFSGKDYEDPPPAPLIDAHEFAKWSFYRAIIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D K GG+ CGGV
Sbjct  59   VIGYKVQSDVKNGGEICGGV  78



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E   ++    +A+DY DPPP+PL+D +   KWS YRAVIAEF+ TLLFLYV+VLT
Sbjct  1    MAKDLEV--QEGGATAARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTD  AGG DCGGV
Sbjct  59   VIGYKAQTDANAGGVDCGGV  78



>gb|ABN11917.1| aquaporin [Cucurbita ficifolia]
Length=284

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD EA       F+AKDYHDPPP+PLID +  T+WSFYRA+IAEFI TLLFLYVTVLT
Sbjct  1    MAKDSEA-----GGFAAKDYHDPPPAPLIDVEEFTQWSFYRAIIAEFITTLLFLYVTVLT  55

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGY  Q+D   GG  CGGV
Sbjct  56   VIGYSSQSDVDNGGHICGGV  75



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQTD       CGGV
Sbjct  59   VIGYKHQTDHA---DACGGV  75



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA     A    KDY DPPP+PL+D + LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEA----AAAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVAT  56

Query  244  vIGYKHQTDPKAGGQD--CGGV  303
            VIGYKHQTD  A G D  CGGV
Sbjct  57   VIGYKHQTDAAASGPDAACGGV  78



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FS KDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQTD       CGGV
Sbjct  59   VIGYKHQTDHA---DACGGV  75



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            MTKDV     +   F AKDYHDPPP+PL D   LTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVA----EHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP   G  CGGV
Sbjct  57   VIGYKSQIDPALKGDACGGV  76



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+  V E    F+ KDYHDPPP+PLID + LTKWSF+RA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDM-GVAEH-GSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D    G  CGGV
Sbjct  59   VIGYKSQIDVAHQGDQCGGV  78



>ref|XP_004307390.1| PREDICTED: aquaporin PIP2-1 [Fragaria vesca subsp. vesca]
Length=285

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +   FSAKDY DPPP+PL D   LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYQDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D   GG  CGGV
Sbjct  59   VIGYKSQID--LGGDACGGV  76



>dbj|BAK20223.1| plasma membrane intrinsic protein 2 [Ziziphus jujuba]
Length=281

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   EQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  270
            + P  F  KDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLYVT+ TVIGYK Q+D
Sbjct  3    KDPEAFPGKDYHDPPPAPLFDTVELTKWSFYRALIAEFIATLLFLYVTIATVIGYKIQSD  62

Query  271  PKAGGQDCGGV  303
             K  G+ CGGV
Sbjct  63   TKMNGEVCGGV  73



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 7/80 (9%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K+ EA      EF AKDYHDPPP+PL D + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEAEA----AGEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D   GG +CGGV
Sbjct  57   VIGYKSQID---GGDECGGV  73



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +  EF+AKDYHDPPP+PL D D LTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+        CGGV
Sbjct  59   VIGYKSQSAT----DQCGGV  74



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FS KDY DPPP+PLID + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYKHQTD       CGGV
Sbjct  59   VIGYKHQTDHA---DACGGV  75



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  73   DVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIG  252
            DV        EF+AKDY DPPP+PLID   L  WS YRAVIAEFIATLLFLY+TVLTVIG
Sbjct  5    DVIESGAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIG  64

Query  253  YKHQTDPKAGGQD-CGGV  303
            YKHQTDP   G D CGGV
Sbjct  65   YKHQTDPNVAGTDACGGV  82



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  109  SAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQ  288
              KDYHDPPP+PLID + LTKWSFYRAVIAEFIATLLFLYVTVLTVIGYK QTDP     
Sbjct  10   GGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLNTD  69

Query  289  DCGGV  303
             CGGV
Sbjct  70   QCGGV  74



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE         +A+DY DPPP+P  D + LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEGV----TARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK  +D KAGG DCGGV
Sbjct  57   VIGYKISSDTKAGGDDCGGV  76



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K VE        + A+DY DPPP+P  D D LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M K VE        + A+DY DPPP+P  D D LTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D  AGG DCGGV
Sbjct  57   VIGYKIQSDTTAGGVDCGGV  76



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD E       E++ KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  9    MAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  64

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK QTDP   G+ CGGV
Sbjct  65   VIGYKSQTDPDHKGEQCGGV  84



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       E++ KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP   G+ CGGV
Sbjct  57   VIGYKSQIDPDHNGEQCGGV  76



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E       E++ KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q DP   G+ CGGV
Sbjct  57   VIGYKSQIDPDHNGEQCGGV  76



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D  A    CGGV
Sbjct  59   VIGYKSQIDGNA--DSCGGV  76



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P    E++AKDY DPPP+PL D + LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTD---PKAGGQDCGGV  303
            VIGYKHQ D   P A    C GV
Sbjct  60   VIGYKHQADPAGPNAADAACSGV  82



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P    E++AKDY DPPP+PL D + LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTD---PKAGGQDCGGV  303
            VIGYKHQ D   P A    C GV
Sbjct  60   VIGYKHQADPAGPNAADAACSGV  82



>emb|CAH60723.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D  A    CGGV
Sbjct  59   VIGYKSQIDGSA--DSCGGV  76



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E   +Q A    KDY DPPP+PLID + L KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D K  G +CGGV
Sbjct  59   VIGYKSQSDTKHNGDECGGV  78



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+E    +   FSAKDYHDPPP+PL D   LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q D  A    CGGV
Sbjct  59   VIGYKSQIDGSA--DSCGGV  76



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA P    E+ AKDY DPPP+PL D + LTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  244  vIGYKHQTD---PKAGGQDCGGV  303
            VIGYKHQ D   P A    C GV
Sbjct  60   VIGYKHQADPAGPNAADAACSGV  82



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  109  SAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQ  288
            +A+DY DPPP+PL+D + + KWS YRAVIAEF+ATLLFLYV+VLTVIGYK QTD  AGG 
Sbjct  14   AARDYRDPPPAPLLDMEEIRKWSLYRAVIAEFVATLLFLYVSVLTVIGYKAQTDATAGGV  73

Query  289  DCGGV  303
            DCGGV
Sbjct  74   DCGGV  78



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE V EQ  E+SAKDY DPPP+PL D   LTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEYSAKDYQDPPPAPLFDPAELTKWSLYRAVIAEFIATLLFLYITVLT  59

Query  244  vIGYKHQTDPK-AGGQDCGGV  303
            +IGY  QTD    G  +C GV
Sbjct  60   IIGYSRQTDTTITGNTECDGV  80



>ref|NP_001274386.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33477.1| plasma intrinsic protein 2-1 [Cucumis sativus]
 gb|KGN48148.1| hypothetical protein Csa_6G445130 [Cucumis sativus]
Length=284

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KD+EA       FS KDY DPPP+PLID     +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEA--GAHGGFSGKDYEDPPPAPLIDPHEFAQWSFYRAIIAEFVATLLFLYVTVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q+D K GG+ CGGV
Sbjct  59   VIGYKVQSDVKNGGETCGGV  78



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFD*LTKWSFYRAVIAEFIAtllflyvtvlt  243
            M KDVE    +  EF+AKDYHDPPP+PL D + LTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  244  vIGYKHQTDPKAGGQDCGGV  303
            VIGYK Q++       CGGV
Sbjct  59   VIGYKSQSEA----DQCGGV  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090