BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF003A13

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA11310.1|  chlorophyl a/b binding protein                       72.0    2e-14   Ipomoea nil [qian niu]
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...  66.2    3e-11   Nicotiana sylvestris
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...  66.2    3e-11   Nicotiana tomentosiformis
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...  65.9    4e-11   Nicotiana sylvestris
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...  65.5    7e-11   Sesamum indicum [beniseed]
gb|AAA34156.1|  chlorophyll a/b-binding protein Cab-3B                62.4    7e-11   Solanum lycopersicum
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I         65.1    8e-11   Solanum tuberosum [potatoes]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...  64.3    2e-10   Solanum tuberosum [potatoes]
gb|AAA34154.1|  chlorophyll a/b-binding protein Cab-3A                60.8    3e-10   Solanum lycopersicum
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.5    3e-10   Nicotiana tomentosiformis
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.5    3e-10   Nicotiana sylvestris
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.5    3e-10   Nicotiana tomentosiformis
pir||F24039  chlorophyll a/b-binding protein 3B precursor - tomat...  62.0    5e-10
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...  62.4    8e-10   Cucumis sativus [cucumbers]
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...  62.4    9e-10   Nicotiana sylvestris
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...  62.4    1e-09   Solanum tuberosum [potatoes]
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...  62.0    1e-09   Petunia sp.
sp|P14277.1|CB2F_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  62.0    1e-09   Solanum lycopersicum
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...  62.0    1e-09   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...  61.6    2e-09   Nicotiana tomentosiformis
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...  61.6    2e-09   Nicotiana tomentosiformis
pir||E24039  chlorophyll a/b-binding protein 3A precursor - tomat...  60.5    2e-09
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...  61.6    2e-09   Nicotiana sylvestris
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...  61.6    2e-09   Nicotiana sylvestris
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...  61.6    2e-09   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009794580.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.5    2e-09   Nicotiana sylvestris
ref|XP_009609679.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.1    2e-09   Nicotiana tomentosiformis
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...  61.2    2e-09   Solanum tuberosum [potatoes]
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...  60.8    2e-09   Nicotiana tomentosiformis
sp|P14276.1|CB2E_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  60.5    4e-09   Solanum lycopersicum
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...  60.5    4e-09   Nicotiana sylvestris
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...  60.5    4e-09   Nicotiana tomentosiformis
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...  60.5    5e-09   Nicotiana tabacum [American tobacco]
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729  62.0    5e-09   
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...  60.5    5e-09   Nicotiana tabacum [American tobacco]
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.5    5e-09   Nicotiana sylvestris
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...  60.1    5e-09   Solanum tuberosum [potatoes]
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...  60.1    5e-09   Nicotiana sylvestris
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...  60.1    6e-09   Cucumis melo [Oriental melon]
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...  60.1    6e-09   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...  60.1    6e-09   Nicotiana sylvestris
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...  60.1    6e-09   Nicotiana sylvestris
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein           59.3    7e-09   Hyacinthus orientalis [common hyacinth]
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...  59.7    8e-09   Nicotiana tabacum [American tobacco]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...  59.7    8e-09   Nicotiana sylvestris
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...  59.7    8e-09   Petunia sp.
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...  59.7    9e-09   Elaeis guineensis
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...  59.3    1e-08   Solanum tuberosum [potatoes]
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...  59.3    1e-08   Nicotiana tomentosiformis
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...  59.3    1e-08   Nicotiana tomentosiformis
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  59.3    1e-08   Solanum lycopersicum
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                59.3    1e-08   Solanum lycopersicum
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein  58.9    1e-08   Carya cathayensis
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...  58.9    1e-08   Solanum lycopersicum
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...  58.9    2e-08   Solanum tuberosum [potatoes]
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...  58.5    2e-08   Sesamum indicum [beniseed]
ref|XP_004170963.1|  PREDICTED: chlorophyll a-b binding protein o...  57.0    2e-08   
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...  58.5    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...  58.5    2e-08   
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg              58.5    2e-08   Erythranthe guttata [common monkey flower]
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor    58.2    3e-08   Lemna gibba
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...  58.2    4e-08   Nicotiana sylvestris
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2        57.8    4e-08   Spinacia oleracea
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...  57.8    4e-08   Nicotiana sylvestris
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...  57.8    5e-08   Nicotiana tomentosiformis
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...  57.8    5e-08   Nicotiana tomentosiformis
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...  57.4    5e-08   Eucalyptus grandis [rose gum]
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...  57.4    5e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                   57.4    6e-08   Eucalyptus grandis [rose gum]
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...  57.4    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein           57.4    6e-08   Pachysandra terminalis
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...  57.4    6e-08   Sesamum indicum [beniseed]
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...  57.4    7e-08   Phoenix dactylifera
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...  57.0    8e-08   
gb|ABV26426.1|  light-harvesting chlorophyll a/b-binding protein      55.8    8e-08   Camellia sinensis [black tea]
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...  57.0    8e-08   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...  57.0    8e-08   
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg              56.6    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...  56.6    1e-07   Phoenix dactylifera
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1        56.6    1e-07   Spinacia oleracea
gb|AAA80593.1|  chlorophyll a/b binding protein                       56.6    1e-07   Solanum tuberosum [potatoes]
gb|AAA34151.1|  chlorophyll a/b-binding protein Cab-1C                53.9    1e-07   Solanum lycopersicum
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...  56.6    1e-07   
gb|AAA80595.1|  chlorophyll a/b binding protein                       54.7    2e-07   Solanum tuberosum [potatoes]
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672  57.4    2e-07   
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...  56.2    2e-07   Nicotiana sylvestris
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...  55.8    2e-07   Nicotiana tomentosiformis
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg              56.6    2e-07   Erythranthe guttata [common monkey flower]
emb|CDP06159.1|  unnamed protein product                              54.3    2e-07   Coffea canephora [robusta coffee]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...  55.8    2e-07   Nelumbo nucifera [Indian lotus]
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...  55.8    2e-07   Spinacia oleracea
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                55.8    2e-07   Populus trichocarpa [western balsam poplar]
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...  55.8    3e-07   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein           55.1    4e-07   Hevea brasiliensis [jebe]
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...  55.1    4e-07   Spinacia oleracea
gb|KJB66916.1|  hypothetical protein B456_010G165100                  55.1    4e-07   Gossypium raimondii
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative        55.1    5e-07   Ricinus communis
gb|AGJ50622.1|  chlorophyll a/b binding protein                       55.1    5e-07   Salicornia brachiata
prf||1204205C  protein 1C,chlorophyll binding                         53.5    5e-07
gb|AAA80592.1|  chlorophyll a/b binding protein                       54.7    5e-07   Solanum tuberosum [potatoes]
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative        54.7    5e-07   Ricinus communis
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.7    5e-07   
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.7    5e-07   Solanum tuberosum [potatoes]
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...  54.7    5e-07   Solanum tuberosum [potatoes]
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...  54.7    6e-07   Nicotiana sylvestris
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...  54.7    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...  54.7    6e-07   Nicotiana tomentosiformis
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...  54.7    6e-07   Vitis vinifera
gb|AAB61238.1|  chlorophyll a/b-binding protein                       54.7    6e-07   Mesembryanthemum crystallinum
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...  54.7    6e-07   Nicotiana sylvestris
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein     54.7    6e-07   Nicotiana sylvestris
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...  54.7    7e-07   Petunia sp.
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic   54.3    8e-07   
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...  54.3    8e-07   Cucumis melo [Oriental melon]
gb|KJB57287.1|  hypothetical protein B456_009G156900                  53.9    1e-06   Gossypium raimondii
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...  53.9    1e-06   Phoenix dactylifera
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...  53.9    1e-06   Eucalyptus grandis [rose gum]
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like               53.5    1e-06   Solanum tuberosum [potatoes]
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...  53.1    2e-06   Vitis hybrid cultivar
gb|AAA80594.1|  chlorophyll a/b binding protein                       53.5    2e-06   Solanum tuberosum [potatoes]
prf||1204205B  protein 1B,chlorophyll binding                         53.5    2e-06
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...  53.5    2e-06   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...  53.5    2e-06   Solanum tuberosum [potatoes]
gb|AAA80591.1|  chlorophyll a/b binding protein                       53.5    2e-06   Solanum tuberosum [potatoes]
ref|XP_004164941.1|  PREDICTED: chlorophyll a-b binding protein 4...  52.0    2e-06   
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...  53.1    2e-06   Populus euphratica
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein           53.5    2e-06   Solanum tuberosum [potatoes]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein           53.1    2e-06   Canarium album [Chinese white-olive]
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...  53.1    2e-06   Solanum tuberosum [potatoes]
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                   53.1    3e-06   Eucalyptus grandis [rose gum]
gb|AAA34149.1|  chlorophyll a/b-binding protein Cab-1A                50.1    3e-06   Solanum lycopersicum
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                   53.5    3e-06   Eucalyptus grandis [rose gum]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...  52.8    3e-06   
gb|AAA18529.1|  chlorophyll A/B binding protein                       52.8    3e-06   Gossypium hirsutum [American cotton]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein           52.8    3e-06   Gossypium hirsutum [American cotton]
gb|ACN41907.1|  chlorophyll A/B binding protein                       52.4    3e-06   Gardenia jasminoides
gb|AAB61237.1|  chlorophyll a/b-binding protein                       52.4    4e-06   Mesembryanthemum crystallinum
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...  52.4    4e-06   Cucumis sativus [cucumbers]
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg              52.4    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...  53.1    4e-06   
gb|KJB69716.1|  hypothetical protein B456_011G041600                  52.4    4e-06   Gossypium raimondii
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...  52.4    5e-06   Fragaria vesca subsp. vesca
gb|AFO67219.1|  putative chlorophyll a/b binding protein              50.8    5e-06   Aralia elata
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...  52.0    5e-06   Cucumis sativus [cucumbers]
gb|KDP37945.1|  hypothetical protein JCGZ_04588                       52.0    5e-06   Jatropha curcas
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...  52.0    5e-06   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY66768.1|  BnaAnng22920D                                        52.0    6e-06   Brassica napus [oilseed rape]
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...  52.0    6e-06   
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic   52.0    6e-06   Theobroma cacao [chocolate]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...  52.0    6e-06   Nicotiana tomentosiformis
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg              51.6    7e-06   Erythranthe guttata [common monkey flower]
gb|AGU28449.1|  chlorophyll A/B binding protein 1                     50.4    8e-06   Sinapis alba [bai jie]
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...  51.6    8e-06   Brassica rapa
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                  51.6    8e-06   Arabis alpina [alpine rockcress]
pir||A24039  chlorophyll a/b-binding protein 1A precursor - tomat...  50.1    8e-06
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg           51.6    9e-06   Capsella rubella
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg              51.2    9e-06   Erythranthe guttata [common monkey flower]
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg              51.2    9e-06   Erythranthe guttata [common monkey flower]
gb|ACF23033.1|  ST140                                                 49.7    1e-05   Eutrema halophilum
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...  51.2    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...  51.2    1e-05   Elaeis guineensis
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...  51.2    1e-05   Prunus mume [ume]
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...  51.2    1e-05   Sedum alfredii
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...  51.2    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...  51.2    1e-05   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                   51.2    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KDP37944.1|  hypothetical protein JCGZ_04587                       51.2    1e-05   Jatropha curcas
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...  51.2    1e-05   Camelina sativa [gold-of-pleasure]
emb|CDX99866.1|  BnaC05g22880D                                        51.2    1e-05   
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...  50.8    1e-05   Elaeis guineensis
emb|CDY35271.1|  BnaC03g59520D                                        51.2    1e-05   Brassica napus [oilseed rape]
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein           51.2    1e-05   Brassica napus [oilseed rape]
emb|CDY26306.1|  BnaA09g26570D                                        50.8    1e-05   Brassica napus [oilseed rape]
gb|AAP44089.1|  chlorophyll a/b binding protein                       50.8    1e-05   Brassica oleracea
sp|P14275.1|CB2C_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  50.8    2e-05   Solanum lycopersicum
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204           50.4    2e-05   
ref|XP_010247431.1|  PREDICTED: chlorophyll a-b binding protein 1...  50.1    2e-05   Nelumbo nucifera [Indian lotus]
gb|AFO67221.1|  putative chlorophyll a/b binding protein              48.9    2e-05   Aralia elata
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...  50.4    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...  50.8    2e-05   
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...  50.1    3e-05   Cucumis melo [Oriental melon]
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg           50.1    3e-05   Eutrema salsugineum [saltwater cress]
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic     50.1    3e-05   Genlisea aurea
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...  50.1    3e-05   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg           50.1    3e-05   Eutrema salsugineum [saltwater cress]
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                   49.7    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...  50.1    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...  50.1    3e-05   Eucalyptus grandis [rose gum]
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg           49.7    3e-05   Capsella rubella
gb|AAB61236.1|  chlorophyll a/b-binding protein                       49.7    4e-05   Mesembryanthemum crystallinum
emb|CDP06330.1|  unnamed protein product                              49.7    4e-05   Coffea canephora [robusta coffee]
gb|AAL38341.1|  chlorophyll a/b-binding protein                       49.7    4e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06329.1|  unnamed protein product                              49.7    4e-05   Coffea canephora [robusta coffee]
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...  49.7    4e-05   Camelina sativa [gold-of-pleasure]
ref|NP_564339.1|  chlorophyll A/B binding protein 3                   49.7    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg              49.7    4e-05   Erythranthe guttata [common monkey flower]
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203           49.3    4e-05   
emb|CDP06328.1|  unnamed protein product                              49.3    4e-05   Coffea canephora [robusta coffee]
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...  49.3    5e-05   Pyrus x bretschneideri [bai li]
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...  49.3    5e-05   Petunia sp.
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...  49.3    5e-05   Fragaria vesca subsp. vesca
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...  49.3    6e-05   Petunia sp.
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                48.9    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...  48.1    7e-05   Prunus mume [ume]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                48.9    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...  48.9    8e-05   Solanum tuberosum [potatoes]
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...  48.5    8e-05   Solanum tuberosum [potatoes]
ref|XP_007151994.1|  hypothetical protein PHAVU_004G0929001g          45.8    9e-05   Phaseolus vulgaris [French bean]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg           48.5    9e-05   Prunus persica
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein           48.5    1e-04   Mangifera indica
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg              48.5    1e-04   Erythranthe guttata [common monkey flower]
gb|ACA52201.1|  chloroplast chlorophyll A/B-binding protein           46.6    1e-04   Oenothera elata subsp. hookeri [Hooker's evening primrose]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...  48.1    1e-04   Prunus mume [ume]
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...  48.1    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...  48.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...  48.1    1e-04   Brassica rapa
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...  48.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHM26643.1|  a-b binding protein                                   47.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...  47.8    2e-04   
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...  47.8    2e-04   
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...  47.8    2e-04   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...  47.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...  47.4    2e-04   Malus domestica [apple tree]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg           47.4    2e-04   Prunus persica
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg             47.4    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...  47.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...  47.4    3e-04   
sp|P14274.1|CB2A_SOLLC  RecName: Full=Chlorophyll a-b binding pro...  47.4    3e-04   Solanum lycopersicum
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...  47.0    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative       47.0    4e-04   Musa balbisiana [starchy banana]
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...  46.6    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...  46.6    4e-04   Fragaria vesca subsp. vesca
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...  46.6    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg           46.2    5e-04   Eutrema salsugineum [saltwater cress]
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...  46.2    6e-04   
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g          45.8    6e-04   Phaseolus vulgaris [French bean]
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg              46.2    7e-04   Erythranthe guttata [common monkey flower]
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1  46.2    7e-04   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...  45.8    9e-04   Brachypodium distachyon [annual false brome]
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg           45.8    0.001   Prunus persica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg           45.8    0.001   Prunus persica
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...  45.8    0.001   



>dbj|BAA11310.1| chlorophyl a/b binding protein [Ipomoea nil]
Length=68

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVK+SPSTPEITGN  FTMRKTAGKPKPVSSG
Sbjct  8    LSSSSFAGKAVKVSPSTPEITGNVNFTMRKTAGKPKPVSSG  48



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  48



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  48



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSPSFAGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSG  48



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSPS PEITGN + +MRKT  KPKP SSG
Sbjct  27   LSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSG  67



>gb|AAA34156.1| chlorophyll a/b-binding protein Cab-3B, partial [Solanum lycopersicum]
Length=51

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EI+GN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSG  48



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EITGN +FTMRKTA K KPVSSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEITGNGRFTMRKTAAKAKPVSSG  48



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EITGN +FTMRKTA K KPVSSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEITGNGRFTMRKTATKAKPVSSG  48



>gb|AAA34154.1| chlorophyll a/b-binding protein Cab-3A, partial [Solanum lycopersicum]
Length=51

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKL+PS+ EITGN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKTVKLAPSSSEITGNGRITMRKTAAKPKPASSG  48



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  48



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  48



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EITGN K TMRKTA K K VSSG
Sbjct  8    LSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSG  48



>pir||F24039 chlorophyll a/b-binding protein 3B precursor - tomato  (fragments)
 prf||1204205F protein 3B,chlorophyll binding
Length=167

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EI+GN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSG  48



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSP+  ++ G  + TMRKTAGKPKPVSSG
Sbjct  8    LSSPSFAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSG  48



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EI GN K TMRKT  K KPVSSG
Sbjct  8    LSSPSFAGKAVKLSPSSYEIIGNGKVTMRKTVIKAKPVSSG  48



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS+ EITGN K  MRKT  K KP+SSG
Sbjct  8    LSSPSFAGKAVKLSPSSSEITGNGKVMMRKTVTKAKPISSG  48



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVK SPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSG  48



>sp|P14277.1|CB2F_SOLLC RecName: Full=Chlorophyll a-b binding protein 3B, chloroplastic; 
AltName: Full=LHCII type I CAB-3B; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
Length=267

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EI+GN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSG  48



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SF GKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSSSFVGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  48



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSG  48



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSG  48



>pir||E24039 chlorophyll a/b-binding protein 3A precursor - tomato  (fragments)
 prf||1204205E protein 3A,chlorophyll binding
Length=167

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKL+PS+ EITGN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKTVKLAPSSSEITGNGRITMRKTAAKPKPASSG  48



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSG  48



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SF GKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSSSFVGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSG  48



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSS SFAGKAVKLSPS+ EITGN K TMRKTA K KPVSS
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSS  47



>ref|XP_009794580.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=159

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>ref|XP_009609679.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=139

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGRVTMRKTAAKAKPASSG  48



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SF GKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  3    LSSSSFVGKAVKLSPSSSEITGNGKATMRKTASKAKPVSSG  43



>sp|P14276.1|CB2E_SOLLC RecName: Full=Chlorophyll a-b binding protein 3A, chloroplastic; 
AltName: Full=LHCII type I CAB-3A; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
Length=267

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKL+PS+ EITGN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKTVKLAPSSSEITGNGRITMRKTAAKPKPASSG  48



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  121  SPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            S SFAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  9    SSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  47



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP FAGKAVKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSP-FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSG  47



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN K TMRKT  K KP+SSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSG  48



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EI+GN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSG  48


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  295  LSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSG  335



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSG  48



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSP+  ++ G  + TMRKTAGKPKPVSSG
Sbjct  8    LSSPSLAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSG  48



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP FAGKAVKLSPS+ E+TGN K TMRKTA K KPVSSG
Sbjct  8    LSSP-FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSG  47



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SF GKAVKLSPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSG  48



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SF GKAVKLSPS+ EITGN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSG  48



>gb|AAT08651.1| chloroplast chlorophyll A-B binding protein [Hyacinthus orientalis]
Length=239

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG AVKL+PS+  ++G+ +FTMRKTAGKPK VSSG
Sbjct  19   LSSPSLAGTAVKLTPSSSVVSGDGRFTMRKTAGKPKTVSSG  59



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP FAGKAVKLSPS+ E+TGN K TMRKTA K KPVSSG
Sbjct  8    LSSP-FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSG  47



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAVKLSPS+ EI GN K TMRKT  K KPVSSG
Sbjct  8    LSSSSFAGKAVKLSPSSSEIIGNGKVTMRKTVTKAKPVSSG  48



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKLSPS+ EITGN K TMRKTA K KPVSSG
Sbjct  8    LSSSTFAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSG  48



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS  EI G  + TMRKT  KPKPV++G
Sbjct  7    LSSPSFAGKAVKLSPSASEINGEGRITMRKTVPKPKPVAAG  47



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGK VKLSPS+ EITGN + TMRKT  K KP SSG
Sbjct  8    LSSPSFAGKTVKLSPSSYEITGNGRVTMRKTTTKAKPASSG  48



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS  E TGN K TMRKTA K KPVSSG
Sbjct  8    LSSPSFAGKAVKLSPS--ETTGNGKVTMRKTASKAKPVSSG  46



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  121  SPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            S SFAGKAVKLSPS+ EITGN K TMRKTA K KP+SSG
Sbjct  9    SSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPLSSG  47



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSG  48



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSG  48



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+A+KL+PS+ ++ G  + TMRKTAG+PKPVSSG
Sbjct  8    LSSPSLAGQAIKLAPSSSDLLGEGRVTMRKTAGRPKPVSSG  48



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKL+PS+ EI+GN + TMRKTA KPKP SSG
Sbjct  8    LSSSTFAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSG  48



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +F GKAVKLSPS+ EITGN + TMRKTA K KP SSG
Sbjct  8    LSSSTFVGKAVKLSPSSSEITGNGRITMRKTAAKAKPASSG  48



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSPS PEITGN + +MRKT    KPVSSG
Sbjct  8    LSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVA--KPVSSG  46



>ref|XP_004170963.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like, 
partial [Cucumis sativus]
Length=117

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+ AG+AVKLSP+ PEI GNAKFTMRKTA   K VSSG
Sbjct  8    LSSPTLAGQAVKLSPNAPEIQGNAKFTMRKTAS--KSVSSG  46



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS  E+ G  + TMRKT  KPKPVSSG
Sbjct  8    LSSPSLAGKAVKLAPSASELLGEGRITMRKTVAKPKPVSSG  48



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ E+TGN + TMRKTA K KP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEVTGNGRVTMRKTATKAKPASSG  48



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVK   STPEITGN + +MRKTA KPKP SSG
Sbjct  8    LSSPSFAGQAVK---STPEITGNGRISMRKTAAKPKPASSG  45



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS  GKAVKL+P+  E+ G  + +MRKTAGKPKPVSSG
Sbjct  7    LSSPSLVGKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSG  47



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG AVKLSPS+ EITGN K  MRKT  K KPVSSG
Sbjct  8    LSSPSLAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSG  48



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKA+KL P+  EI G  + TMRKTAGKPK VSSG
Sbjct  8    LSSPSLAGKAIKLGPTASEILGEGRVTMRKTAGKPKNVSSG  48



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS PEITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSS  47



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS PEITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSS  47



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS PEITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSS  47



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSPSTPE+ GN + +MRKT G  KPVSSG
Sbjct  8    LSSPSLAGQAVKLSPSTPELLGNGRVSMRKTVG--KPVSSG  46



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGK +KL P+  EI G  + TMRKTAGKPKP+SSG
Sbjct  8    LSSPSLAGKPIKLGPTPSEILGEGRITMRKTAGKPKPISSG  48



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSPSTPE+ GN + +MRKT G  KPVSSG
Sbjct  8    LSSPSLAGQAVKLSPSTPELLGNGRVSMRKTVG--KPVSSG  46



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKL+PS  ++ G  + TMRKT  KPKPV+SG
Sbjct  7    LSSPSFAGQAVKLAPSASDVLGGGRVTMRKTGAKPKPVASG  47



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS  E+ G  + +MRKT G+PKPVSSG
Sbjct  8    LSSPSLAGKAVKLAPSASELLGVGRVSMRKTGGRPKPVSSG  48



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSPST EITGN + +MRKT    KPVSSG
Sbjct  8    LSSPSFAGQAVKLSPSTSEITGNGRVSMRKTVA--KPVSSG  46



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS  +I G  + TMRK+ G+PKP++SG
Sbjct  7    LSSPSLAGKAVKLAPSASDIIGEGRITMRKSVGRPKPIASG  47



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+ AG+AVKLSP+ PEI GNAKFTMRKTA   K VSSG
Sbjct  8    LSSPTLAGQAVKLSPTAPEIQGNAKFTMRKTAS--KSVSSG  46



>gb|ABV26426.1| light-harvesting chlorophyll a/b-binding protein [Camellia sinensis]
Length=153

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKA+KLSPSTP++ G  + +MRKT GKP
Sbjct  5    LSSPSFAGKAIKLSPSTPDLVGRGRISMRKTGGKP  39



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+ AG+AVKLSP+ PEI GNAKFTMRKTA   K VSSG
Sbjct  8    LSSPTLAGQAVKLSPNAPEIQGNAKFTMRKTAS--KSVSSG  46



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+ AG+AVKLSP+ PEI GNAKFTMRKTA   K VSSG
Sbjct  8    LSSPTLAGQAVKLSPNAPEIQGNAKFTMRKTAS--KSVSSG  46



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVK   STPE TGN + +MRKTA KPKP SSG
Sbjct  8    LSSPSFAGQAVK---STPEFTGNGRISMRKTAAKPKPASSG  45



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS  EI G  + TMRKT  +PKPV+SG
Sbjct  7    LSSPSLAGKAVKLAPSASEILGEGRITMRKTFSRPKPVASG  47



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+F GKAVKL+PST ++ G  + +MRK+AGKPK VSSG
Sbjct  8    LSSPAFGGKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSG  48



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPST EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSTSEITGNGRITMRKAVAKSAPSSS  47



>gb|AAA34151.1| chlorophyll a/b-binding protein Cab-1C, partial [Solanum lycopersicum]
Length=49

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVKLSPS+ E+TGN + TMRK+  K KP SSG
Sbjct  8    LSSSTFAGKAVKLSPSSSEVTGNGRVTMRKSVAKAKPASSG  48



>gb|AAA80595.1| chlorophyll a/b binding protein, partial [Solanum tuberosum]
Length=135

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMRKAVAKSAPSSS  47



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAV L P+  EI G  + TMRKTAGKPK VSSG
Sbjct  365  LSSPSLAGKAVNLGPNASEILGEGRITMRKTAGKPKQVSSG  405


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL P+  EI G  + TMRKT GK KP +S
Sbjct  8    LSSPSLAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAAS  47



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + +MRKTA KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRVSMRKTAAKPVSSSS  47



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  121  SPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            S SFAGKAV+LSPS+ EI GN K TMRKT  K KPVSSG
Sbjct  9    SSSFAGKAVRLSPSSSEIIGNGKVTMRKTVTKAKPVSSG  47



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVK   STPE TGN + +MRKTA KPKP SSG
Sbjct  70   LSSPSFAGQAVK---STPEFTGNGRVSMRKTAAKPKPASSG  107



>emb|CDP06159.1| unnamed protein product [Coffea canephora]
Length=151

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVK++PST E  G  + TMRKT  KPKP S G
Sbjct  8    LSSPSFAGKAVKIAPSTSERLGEGRVTMRKTVAKPKPSSGG  48



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPE-ITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKL+PS  E + G  + TMRKT  KPKPVSSG
Sbjct  8    LSSPSFAGKAVKLAPSASEKLLGEGRVTMRKTVAKPKPVSSG  49



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL P+  EI G  + TMRKTAGKPK V S
Sbjct  8    LSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQS  47



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAVKLSPS+PE+ GN + +MRKT    KPVSSG
Sbjct  8    LSSPAFAGKAVKLSPSSPELMGNGRVSMRKTT---KPVSSG  45



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+A+KL+PS  +I G  + +MRKT  KPKPVSSG
Sbjct  8    LSSPSLAGQAIKLAPSASDILGEGRISMRKTGAKPKPVSSG  48



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKL+PS P + GNA+ +MRK+ G  KPVSSG
Sbjct  8    LSSPSFAGKAVKLTPSAPGLMGNARVSMRKSVG--KPVSSG  46



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKA+KL P+  EI    + TMRKTAGKPK VSSG
Sbjct  8    LSSPSLAGKAIKLGPTASEILSEGRVTMRKTAGKPKNVSSG  48



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKAVK SPSTP+I GN + +MRKTA KP
Sbjct  8    LSSPSFAGKAVKFSPSTPKIQGNGRVSMRKTATKP  42



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS PE+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPSFAGKAVKLSPSAPELMGNGRVSMRKTAA--KSVSSG  46



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGK +KL P+  EI G  + TMRKTAGKPK V+SG
Sbjct  8    LSSPSLAGKPIKLGPNAAEILGEGRVTMRKTAGKPKQVASG  48



>prf||1204205C protein 1C,chlorophyll binding
Length=165

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMRKAVAKSAPSSS  47



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSPS PE+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPSFAGKAVKLSPSAPELMGNGRVSMRKTAA--KNVSSG  46



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMRKAVAKSAPSSS  47



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMRKAVAKSAPSSS  47



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGK VKLSPS+ EITGN + TMRK+A K KP S G
Sbjct  8    LSSSTFAGKTVKLSPSSSEITGNGRVTMRKSAAKAKPASFG  48



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSS  47



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS  +I G  + TMRK+A + KPVSSG
Sbjct  7    LSSPSLAGKAVKLAPSASDILGEGRITMRKSAARSKPVSSG  47



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSS  47



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKA+KL+PS  ++ G  + TMRKT G+ KPVSSG
Sbjct  8    LSSPSLAGKALKLAPSASDLLGEGRVTMRKTGGRAKPVSSG  48



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL+P+T +I G  + TMRKTAGK K VSS
Sbjct  8    LSSPSLAGKAVKLNPTTSQILGEGRITMRKTAGKTKNVSS  47



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSS  47



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITGN + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSS  47



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSS SFAGKAVKLS S+ EITGN K TMRKT  K KP SS
Sbjct  8    LSSSSFAGKAVKLSSSSSEITGNGKVTMRKTVTKAKPASS  47



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKAVKLSP TPEI GN + +MRKT  +P
Sbjct  8    LSSPSFAGKAVKLSPLTPEIQGNGRVSMRKTGTRP  42



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKLSP+ PEI G  + TMRKTA   KPVSSG
Sbjct  8    LSSPSLAGKAVKLSPNAPEIQGTGRITMRKTA--TKPVSSG  46



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKLSPS P+I GN + +MRKTA K  P  S
Sbjct  8    LSSPSFAGKAVKLSPSAPKIQGNGRVSMRKTATKAAPSGS  47



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKL+PST  I G  + TMRKT GKP P  S
Sbjct  7    LSSPSFAGKAVKLAPSTSTILGEGRVTMRKTIGKPVPSGS  46



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSP+TP++ GN + TMRK     KP SSG
Sbjct  8    LSSPSFAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSG  45



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  127  SFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            +FAGKAVKLSPS+ EITGN + TMRK+  K KP SSG
Sbjct  12   TFAGKAVKLSPSSSEITGNGRITMRKSVAKAKPASSG  48



>dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding protein [Vitis hybrid 
cultivar]
Length=234

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKA +L+PS  ++ G  + TMRKT G+ KPVSSG
Sbjct  6    LSSPSLAGKAFQLAPSASDLLGEGRVTMRKTGGRAKPVSSG  46



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>ref|XP_004164941.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, 
partial [Cucumis sativus]
Length=149

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGK VKL+PS+PE+ GN++ TMRK+A   K VSSG
Sbjct  8    LSSPSFAGKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSG  46



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS+PE+ GN + +MRKT    KPVSSG
Sbjct  8    LSSPSLAGKAVKLTPSSPELMGNGRVSMRKTT---KPVSSG  45



>gb|AFW90594.1| chloroplast chlorophyll a/b binding protein [Solanum tuberosum]
Length=276

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSP+FAGKAVKLSPS PE+ GN +  MRKT  KP
Sbjct  8    LSSPAFAGKAVKLSPSAPELMGNGRVNMRKTFNKP  42



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVSKSAPSSS  47



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSPSTPE+ GN + +MRK     KPVSSG
Sbjct  43   LSSPSLAGQAVKLSPSTPELLGNGRISMRKAV--RKPVSSG  81



>gb|AAA34149.1| chlorophyll a/b-binding protein Cab-1A, partial [Solanum lycopersicum]
Length=49

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  E +GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASENSGNGRITMRKAVAKSAPSSS  47



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKLSP+TP++ GN + TMRK     KP SSG
Sbjct  102  LSSPSFAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSG  139



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKL PS  EITGN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLLPSASEITGNGRITMRKAVAKSAPSSS  47



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVK SPSTPEI G  + +MRKT    KPV SG
Sbjct  8    LSSPSFAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSG  45



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVK SPSTPEI G  + +MRKT    KPV SG
Sbjct  8    LSSPSFAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSG  45



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSPS PE+ GN + +M++T    +PVSSG
Sbjct  8    LSSPSFAGQAVKLSPSAPELMGNGRISMKRTT---RPVSSG  45



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGK VKL+P+  EI G  + TMRKTAGK K VSS
Sbjct  8    LSSPSLAGKMVKLAPTASEILGEGRITMRKTAGKTKSVSS  47



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +1

Query  124  PSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            P+ AG+AVKLSP+ PEI GNAKFTMRKTA   K VSSG
Sbjct  1    PTLAGQAVKLSPNAPEIQGNAKFTMRKTAS--KSVSSG  36



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAG+AVK   STPE T   +F+MRKTA KPKP SSG
Sbjct  8    LSSPTFAGQAVK---STPEFTTTGRFSMRKTAAKPKPASSG  45



>ref|XP_010052094.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=400

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSPSTPE+ GN + +MRK     KPVSSG
Sbjct  8    LSSPSLAGQAVKLSPSTPELLGNGRISMRKAV--RKPVSSG  46



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVK SPSTPEI G  + +MRKT    KPV SG
Sbjct  8    LSSPSFAGKAVKFSPSTPEIRGTGRVSMRKTT---KPVPSG  45



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKLSPST  + G  + TMRKTA K K VSSG
Sbjct  8    LSSPSLAGQAVKLSPSTSTLFGEGRVTMRKTAAKSKNVSSG  48



>gb|AFO67219.1| putative chlorophyll a/b binding protein, partial [Aralia elata]
Length=155

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVK++PS+ E+ GN + +MRKTA   KPVSSG
Sbjct  8    LSSPSLAGKAVKVAPSSSELFGNGRISMRKTA---KPVSSG  45



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGK VKL+PS+PE+ GN++ TMRK+A   K VSSG
Sbjct  8    LSSPSFAGKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSG  46



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL PS PE+ GN + TMRKTA   K VSSG
Sbjct  8    LSSPSLAGKAVKLGPSAPELMGNGRVTMRKTA--SKNVSSG  46



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL P+  EI G  + TMRKT GK KP +S
Sbjct  8    LSSPSLAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAAS  47



>emb|CDY66768.1| BnaAnng22920D [Brassica napus]
 emb|CDY43676.1| BnaA04g20150D [Brassica napus]
Length=267

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSPS  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPSASEVLGSGRVTMRKTVAKPK  43



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSF G+AVKLSPS  EI+GN + TMRK   K  P SS
Sbjct  8    LSSPSFVGQAVKLSPSASEISGNGRITMRKAVAKSAPSSS  47



>ref|XP_007025148.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27770.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKA+K SPSTPEI G+ + +MRKT  KP
Sbjct  8    LSSPSFAGKALKFSPSTPEIQGSGRVSMRKTGTKP  42



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  EITG  + +MRKT  KP   SS
Sbjct  8    LSSPSFAGQAVKLSPSASEITGYGRVSMRKTVAKPVASSS  47



>gb|EYU28189.1| hypothetical protein MIMGU_mgv1a020664mg [Erythranthe guttata]
Length=254

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 3/40 (8%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AV+LSP   EIT   +F+MRKTA KPKP +S
Sbjct  8    LSSPSFAGQAVRLSP---EITTTGRFSMRKTAAKPKPAAS  44



>gb|AGU28449.1| chlorophyll A/B binding protein 1, partial [Sinapis alba]
Length=193

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVK+SP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKISPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_009141380.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Brassica rapa]
Length=267

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSPS  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPSASEVLGSGRVTMRKTHAKPK  43



>gb|KFK44818.1| hypothetical protein AALP_AA1G306800 [Arabis alpina]
Length=267

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP++ E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPASSEVLGSGRVTMRKTVAKPK  43



>pir||A24039 chlorophyll a/b-binding protein 1A precursor - tomato  (fragments)
 prf||1204205A protein 1A,chlorophyll binding
Length=165

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  E +GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASENSGNGRITMRKAVAKSAPSSS  47



>ref|XP_006304391.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
 gb|EOA37289.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
Length=267

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP++ E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPASSEVLGSGRVTMRKTVAKPK  43



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAG+AVK   STPE T   +F+MRKTA KPKP +SG
Sbjct  8    LSSPTFAGQAVK---STPEFTTTGRFSMRKTAAKPKPAASG  45



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 4/42 (10%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGN-AKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLS   PEIT N ++ +MRKTA KPKP SSG
Sbjct  3    LSSPSFAGQAVKLS---PEITANYSRVSMRKTAAKPKPASSG  41



>gb|ACF23033.1| ST140, partial [Eutrema halophilum]
Length=141

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVK+SP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKISPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_010499509.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Camelina 
sativa]
 ref|XP_010499510.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Camelina 
sativa]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL+PS  +I G  + TMRK+ G+ +PV S
Sbjct  7    LSSPSLAGKAVKLAPSASDIIGEGRITMRKSVGRSRPVVS  46



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKL  S   I G  + TMRKTA KPK VSSG
Sbjct  8    LSSPSLAGQAVKLGSSVSNIVGEGRVTMRKTASKPKNVSSG  48



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AG+AVKL+P+  ++ GN+K TMRKTA K KP  S
Sbjct  8    LSSPSLAGQAVKLTPTVSDLYGNSKVTMRKTAAKSKPTVS  47



>ref|XP_010478366.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_010460769.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|NP_174286.1| chlorophyll A/B binding protein 1 [Arabidopsis thaliana]
 sp|P04778.1|CB1C_ARATH RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=Chlorophyll a-b protein 140; Short=CAB-140; 
AltName: Full=LHCII type I CAB-1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG10603.1|AC008030_3 Putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAL16289.1|AF428359_1 At1g29930/F1N18_23 [Arabidopsis thaliana]
 emb|CAA27543.1| chlorophyll a/b binding protein (LHCP AB 140) [Arabidopsis thaliana]
 gb|AAK74031.1| At1g29930/F1N18_23 [Arabidopsis thaliana]
 gb|AAK93612.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 gb|AAL25594.1| At1g29930/F1N18_23 [Arabidopsis thaliana]
 gb|AAM14108.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AEE31151.1| chlorophyll a-b binding protein 1 [Arabidopsis thaliana]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL PS PE+ GN + TMRKTA   K VSSG
Sbjct  3    LSSPSLAGKAVKLGPSPPELMGNGRVTMRKTA--SKNVSSG  41



>ref|XP_010460768.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Camelina sativa]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP+  E+ G+ + TMRKTA KPK
Sbjct  8    LSSPAFAGKAVNLSPAASEVLGSGRVTMRKTAAKPK  43



>emb|CDX99866.1| BnaC05g22880D [Brassica napus]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PST  I G  + TMRKT G  KPVSSG
Sbjct  7    LSSPSLAGKAVKLAPSTSPILGEGRVTMRKTVG--KPVSSG  45



>emb|CDY35271.1| BnaC03g59520D [Brassica napus]
 emb|CDX90218.1| BnaA08g17660D [Brassica napus]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>gb|ABG29728.1| chloroplast chlorophyll a/b binding protein [Brassica napus]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>emb|CDY26306.1| BnaA09g26570D [Brassica napus]
Length=267

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>gb|AAP44089.1| chlorophyll a/b binding protein [Brassica oleracea]
Length=273

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>sp|P14275.1|CB2C_SOLLC RecName: Full=Chlorophyll a-b binding protein 1C, chloroplastic; 
AltName: Full=LHCII type I CAB-1C; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
Length=265

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGK  216
            LSSPSFAG+AVKLSPS  EI+GN + TMRK   K
Sbjct  8    LSSPSFAGQAVKLSPSASEISGNGRITMRKAVAK  41



>ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67097.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  3    LSSPAFAGKAVKLSPAASEVLGSGRVTMRKTTAKPK  38



>ref|XP_010247431.1| PREDICTED: chlorophyll a-b binding protein 1D-like [Nelumbo nucifera]
Length=222

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPE-ITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAGKAVKL+ S  E + G  + TMRKT  KPK VSSG
Sbjct  8    LSSPSFAGKAVKLAQSASEQLLGEGRVTMRKTVAKPKTVSSG  49



>gb|AFO67221.1| putative chlorophyll a/b binding protein, partial [Aralia elata]
Length=152

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKAVK++PS+ E+ GN + +MRKT  KP
Sbjct  8    LSSPSFAGKAVKVAPSSSELFGNGRISMRKTGKKP  42



>ref|XP_010538237.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=267

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKAVKLSP+  EI G A+ TMRK+  KP
Sbjct  8    LSSPSFAGKAVKLSPTASEILGTARVTMRKSTAKP  42



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKLSP+ PEI G  + TMRKTA   K VSSG
Sbjct  81   LSSPSLAGKAVKLSPNAPEIQGTGRITMRKTA--TKSVSSG  119



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS+PE+ GN++  MRK+A   K VSSG
Sbjct  8    LSSPSLAGKAVKLTPSSPELFGNSRVNMRKSAA--KSVSSG  46



>ref|XP_006415537.1| hypothetical protein EUTSA_v10008476mg [Eutrema salsugineum]
 gb|ESQ33890.1| hypothetical protein EUTSA_v10008476mg [Eutrema salsugineum]
Length=267

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVK+SP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKISPAASEVLGSGRVTMRKTVAKPK  43



>gb|EPS64140.1| chlorophyll a-b binding protein 21, chloroplastic [Genlisea aurea]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGK  216
            LSSPSFAG+AVKLSPSTPE++G  + +MR+T  K
Sbjct  8    LSSPSFAGQAVKLSPSTPELSGKGRISMRRTVTK  41



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVKLSPS  E +GN + TMRK   K  P SS
Sbjct  8    LSSPSFAGQAVKLSPSASENSGNGRITMRKAVAKSAPSSS  47



>ref|XP_006415534.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 ref|XP_006415536.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
 gb|ESQ33887.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 gb|ESQ33889.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
Length=267

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAVK+SP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVKISPAASEVLGSGRVTMRKTVAKPK  43



>gb|KCW73782.1| hypothetical protein EUGRSUZ_E02381 [Eucalyptus grandis]
Length=252

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAV+LSPSTPE+ G  + TMRKT    K VSSG
Sbjct  8    LSSPSLAGKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSG  46



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPE--ITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS     + G  + TMRKT  KPKPVSSG
Sbjct  8    LSSPSLAGKAVKLAPSAASELLLGQGRVTMRKTVVKPKPVSSG  50



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAV+LSPSTPE+ G  + TMRKT    K VSSG
Sbjct  8    LSSPSLAGKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSG  46



>ref|XP_006305533.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 ref|XP_006305913.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
 gb|EOA38431.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 gb|EOA38811.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
Length=267

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP++ E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVNLSPASSEVLGSGRVTMRKTVAKPK  43



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSPSFAGKAVKLSP+  E  G  + TMRK AGK K
Sbjct  8    LSSPSFAGKAVKLSPTASETLGEGRITMRKAAGKSK  43



>emb|CDP06330.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKL+PS PE+ GN + +M++T+ +P P  S
Sbjct  8    LSSPSFAGKAVKLNPSAPELMGNGRISMKRTS-RPAPSGS  46



>gb|AAL38341.1| chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAM47913.1| chlorophyll a/b-binding protein [Arabidopsis thaliana]
Length=267

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPK  43



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKL+PS PE+ GN + +M++T+ +P P  S
Sbjct  8    LSSPSFAGKAVKLNPSAPELMGNGRISMKRTS-RPSPSGS  46



>ref|XP_010499505.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic [Camelina 
sativa]
 ref|XP_010460766.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic [Camelina 
sativa]
 ref|XP_010460767.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic [Camelina 
sativa]
 ref|XP_010478364.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010478365.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic isoform 
X2 [Camelina sativa]
Length=267

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|NP_564339.1| chlorophyll A/B binding protein 3 [Arabidopsis thaliana]
 ref|NP_564340.1| chlorophyll A/B-binding protein 2 [Arabidopsis thaliana]
 sp|P0CJ48.1|CB1A_ARATH RecName: Full=Chlorophyll a-b binding protein 2, chloroplastic; 
AltName: Full=Chlorophyll a-b protein 165; Short=CAB-165; 
AltName: Full=LHCII type I CAB-2; Flags: Precursor [Arabidopsis 
thaliana]
 sp|Q8VZ87.2|CB1B_ARATH RecName: Full=Chlorophyll a-b binding protein 3, chloroplastic; 
AltName: Full=Chlorophyll a-b protein 180; Short=CAB-180; 
AltName: Full=LHCII type I CAB-3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG10604.1|AC008030_4 chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAG10605.1|AC008030_5 chlorophyll a/b-binding protein [Arabidopsis thaliana]
 emb|CAA27540.1| chlorophyll a/b binding protein (LHCP AB 65) [Arabidopsis thaliana]
 emb|CAA27541.1| chlorophyll a/b binding protein (LHCP AB 180) [Arabidopsis thaliana]
 gb|AAK97707.1| At1g29920/F1N18_80 [Arabidopsis thaliana]
 gb|AAL06859.1| At1g29920/F1N18_80 [Arabidopsis thaliana]
 gb|AAL31113.1| At1g29920/F1N18_80 [Arabidopsis thaliana]
 gb|AAL32892.1| chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAM10134.1| chlorophyll a/b-binding protein [Arabidopsis thaliana]
 gb|AAM63949.1| photosystem II type I chlorophyll a /b binding protein, putative 
[Arabidopsis thaliana]
 gb|AAM91548.1| photosystem II type I chlorophyll a/b binding protein, putative 
[Arabidopsis thaliana]
 gb|AAN31868.1| putative photosystem II type I chlorophyll a /b binding protein 
[Arabidopsis thaliana]
 gb|AEE31149.1| chlorophyll A/B binding protein 3 [Arabidopsis thaliana]
 gb|AEE31150.1| chlorophyll A/B-binding protein 2 [Arabidopsis thaliana]
Length=267

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPK  43



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPSFAG+AVKLSP     TG  + +MRKT+ KPKP SSG
Sbjct  8    LSSPSFAGQAVKLSPEVTG-TGTGRISMRKTSAKPKPASSG  47



>ref|XP_002893588.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69847.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSSP+FAGKAV LSP+  E+ G+ + TMRKT  KPK
Sbjct  3    LSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPK  38



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKL+PS PE+ GN + +M++T+ +P P  S
Sbjct  8    LSSPSFAGKAVKLNPSAPELMGNGRISMKRTS-RPAPSGS  46



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS +G+AVKL+PS+  + G  + TMRKTA K K VSSG
Sbjct  8    LSSPSLSGQAVKLNPSSSNLLGEGRVTMRKTAAKSKKVSSG  48



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            +SS SFAGKAV + PS+ +ITGN K TMRKT  K KPVSSG
Sbjct  8    ISSSSFAGKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSG  47



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AV+LSP+   I G  + TMRKT  K K VSSG
Sbjct  8    LSSPSLAGQAVQLSPAASNIFGEGRITMRKTGAKSKAVSSG  48



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS SFAGKAV + PS+ EIT N K TMRKT  K KPVSSG
Sbjct  8    LSSSSFAGKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSG  47



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS+ EI GN + +MRKT    KPV SG
Sbjct  8    LSSPSLAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSG  45



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKL  S   I G  + TMRKTA K K VSSG
Sbjct  8    LSSPSLAGQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSG  48



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVKL+PS+ EI GN + +MRKT    KPV SG
Sbjct  8    LSSPSLAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSG  45



>ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMR  201
            LSSPSFAG+AVKLSPS  EITGN + TMR
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMR  36



>ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMR  201
            LSSPSFAG+AVKLSPS  EITGN + TMR
Sbjct  8    LSSPSFAGQAVKLSPSASEITGNGRITMR  36



>ref|XP_007151994.1| hypothetical protein PHAVU_004G0929001g, partial [Phaseolus vulgaris]
 gb|ESW23988.1| hypothetical protein PHAVU_004G0929001g, partial [Phaseolus vulgaris]
Length=41

 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGK  216
            LSSPS AG+A+KLSP+TP+I+G  + +MRKTA K
Sbjct  8    LSSPSLAGQAIKLSPATPDISGG-RISMRKTASK  40



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKL  S   I G  + TMRKTA K K VSSG
Sbjct  8    LSSPSLAGQAVKLGSSVSNIVGEGRITMRKTASKSKNVSSG  48



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAGKAVKLSP+  E+ GN + +MR+TA KP P  S
Sbjct  8    LSSPSFAGKAVKLSPAPRELMGNGRVSMRRTA-KPTPSGS  46



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVK   STPE T + + +MRKTA KPKP +S
Sbjct  8    LSSPSFAGQAVK---STPEFTSSGRISMRKTAAKPKPAAS  44



>gb|ACA52201.1| chloroplast chlorophyll A/B-binding protein, partial [Oenothera 
elata subsp. hookeri]
Length=119

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKP-VSSG  237
            LSSP+FAGKAVKLS   PE+      TMRKTAGK KP VSSG
Sbjct  10   LSSPAFAGKAVKLS---PEVLTTGGITMRKTAGKAKPAVSSG  48



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKL  S   I G  + TMRKTA K K VSSG
Sbjct  8    LSSPSLAGQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSG  48



>ref|XP_010549470.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549471.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=268

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTA  210
            LSSPSFAGKAVKLSP+  EI G A+ TMRK A
Sbjct  10   LSSPSFAGKAVKLSPAASEILGTARVTMRKAA  41



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AGKAVK  PS  ++ G  + TMRKT  KPK   SG
Sbjct  7    LSSPSLAGKAVKFGPSVADVLGGGRVTMRKTGAKPKSAPSG  47



>ref|XP_009102798.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic [Brassica 
rapa]
 emb|CDY43198.1| BnaA07g07560D [Brassica napus]
Length=267

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPK  222
            LSS +FAGKAVKLSP+  E+ G+ + TMRKT  KPK
Sbjct  8    LSSSAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPK  43



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKP  219
            LSSPSFAGKAVKL+PS   + G  + TMRK  GKP
Sbjct  7    LSSPSFAGKAVKLAPSASGVLGQGRVTMRKAGGKP  41



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  7    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  45



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  46



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  46



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  7    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKKVSSG  45



>ref|XP_009360962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=283

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  46



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  8    LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKKVSSG  46



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+AVKL  S   I G  + TMRKTA + K VSSG
Sbjct  8    LSSPSLAGQAVKLGSSVSNIVGEGRVTMRKTASRSKNVSSG  48



>gb|EYU43289.1| hypothetical protein MIMGU_mgv11b019945mg [Erythranthe guttata]
Length=265

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPS-TPEITGNAKFTMRKTAGKPKP  225
            LSSPSFAG+A+K+SP  T   +G+ + +MRKTAGKPKP
Sbjct  3    LSSPSFAGQAIKISPEITANSSGSGRVSMRKTAGKPKP  40



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            L+SPS AG+AVKLS ST  + G  + TMRKTA K K VS G
Sbjct  8    LTSPSLAGQAVKLSKSTSTLRGEGRITMRKTAAKSKNVSCG  48



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  34   LSSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  72



>sp|P14274.1|CB2A_SOLLC RecName: Full=Chlorophyll a-b binding protein 1A, chloroplastic; 
AltName: Full=LHCII type I CAB-1A; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
Length=265

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGK  216
            LSSPSFAG+AVKLSPS  E +GN + TMRK   K
Sbjct  8    LSSPSFAGQAVKLSPSASENSGNGRITMRKAVAK  41



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL+PS  ++ G  + TMRK+  K KP ++
Sbjct  7    LSSPSLAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAA  46



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AGKAVKL+PS  ++ G  + TMRK+  K KP ++
Sbjct  7    LSSPSLAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAA  46



>ref|XP_009377327.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            L+SPS AG+AVKLS ST  + G  + TM KTA K K VS+G
Sbjct  8    LTSPSLAGQAVKLSQSTSTLLGEGRITMHKTAAKSKNVSAG  48



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSS  234
            LSSPS AG+AVKL  ST  + G  + TMRKTA K K VSS
Sbjct  8    LSSPSLAGQAVKLGSSTSNLLGEGRVTMRKTAAKSKNVSS  47



>ref|XP_010237260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=266

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAVK  PS+  + G A+ TMRKTA K KPV SG
Sbjct  8    LSSPAFAGKAVKNLPSS-ALFGEARVTMRKTAAKAKPVPSG  47



>ref|XP_006410587.1| hypothetical protein EUTSA_v10017088mg [Eutrema salsugineum]
 gb|ESQ52040.1| hypothetical protein EUTSA_v10017088mg [Eutrema salsugineum]
Length=266

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTA  210
            LSSP+FAGKAVKLSP+  E+ G  + TMRKTA
Sbjct  8    LSSPAFAGKAVKLSPAASEVFGTGRVTMRKTA  39



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            L SP+FAGKAV+LSP   E+ GN + +MRKTA   K VSSG
Sbjct  8    LXSPTFAGKAVQLSPGATELFGNGRVSMRKTA--TKQVSSG  46



>ref|XP_007151992.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
 gb|ESW23986.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
Length=206

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSPS AG+A+KLSP+TP+I+G  + +MRKTA   K VSSG
Sbjct  8    LSSPSLAGQAIKLSPATPDISGG-RISMRKTA--SKSVSSG  45



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 5/42 (12%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNA--KFTMRKTAGKPKPVSS  234
            LSSPSFAG+AVK++   PEIT N+  + +MRKTA KPK VSS
Sbjct  9    LSSPSFAGQAVKIA---PEITANSVGRVSMRKTAAKPKQVSS  47



>gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein 1-1 [Dendrocalamus 
latiflorus]
Length=265

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVS  231
            LSSP+FAGKAVK  PS+  I G A+ TMRKT  KPKP S
Sbjct  8    LSSPAFAGKAVKNVPSS-AIFGEARVTMRKTGAKPKPAS  45



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSS +FAGKAVK  PS+  + G A+ TMRKTA K KPVSSG
Sbjct  8    LSSSAFAGKAVKNLPSSA-LFGEARVTMRKTAAKAKPVSSG  47



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+L+P   E+ GN + +MRKT    K VSSG
Sbjct  8    LSSPTFAGKAVQLAPGATELFGNGRVSMRKTGA--KQVSSG  46



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+L+P   E+ GN + +MRKT    K VSSG
Sbjct  7    LSSPTFAGKAVQLAPGATELFGNGRVSMRKTGA--KQVSSG  45



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +1

Query  115  LSSPSFAGKAVKLSPSTPEITGNAKFTMRKTAGKPKPVSSG  237
            LSSP+FAGKAV+LSP   E+ GN + +MRK A   K VSSG
Sbjct  8    LSSPTFAGKAVQLSPGATELFGNGRVSMRKXA--TKKVSSG  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563183668210