BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF003A04

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764361.1|  PREDICTED: uncharacterized protein LOC104216095  73.2    1e-13   Nicotiana sylvestris
ref|XP_004239713.1|  PREDICTED: uncharacterized protein LOC101266725  65.5    7e-11   
ref|XP_009607482.1|  PREDICTED: uncharacterized protein LOC104101695  65.1    1e-10   Nicotiana tomentosiformis
ref|XP_006345847.1|  PREDICTED: uncharacterized protein LOC102602810  63.9    3e-10   Solanum tuberosum [potatoes]
ref|XP_011031599.1|  PREDICTED: uncharacterized protein LOC105130...  57.0    7e-08   Populus euphratica
ref|XP_006379512.1|  hypothetical protein POPTR_0008s03030g           57.0    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011031598.1|  PREDICTED: uncharacterized protein LOC105130...  56.6    2e-07   Populus euphratica
ref|XP_011015662.1|  PREDICTED: uncharacterized protein LOC105119235  55.1    2e-07   Populus euphratica
emb|CDO99821.1|  unnamed protein product                              55.8    3e-07   Coffea canephora [robusta coffee]
ref|XP_011024313.1|  PREDICTED: uncharacterized protein LOC105125526  55.5    3e-07   Populus euphratica
ref|XP_011101526.1|  PREDICTED: uncharacterized protein LOC105179587  54.7    9e-07   Sesamum indicum [beniseed]
emb|CAN67223.1|  hypothetical protein VITISV_029052                   53.1    1e-06   Vitis vinifera
ref|XP_002270872.1|  PREDICTED: uncharacterized protein LOC100249596  52.8    3e-06   Vitis vinifera
ref|XP_006575157.1|  PREDICTED: uncharacterized protein LOC100789...  51.6    5e-06   Glycine max [soybeans]
gb|EYU32449.1|  hypothetical protein MIMGU_mgv1a012632mg              52.4    6e-06   Erythranthe guttata [common monkey flower]
ref|XP_002315341.2|  hypothetical protein POPTR_0010s23740g           52.8    8e-06   
ref|XP_008232054.1|  PREDICTED: uncharacterized protein LOC103331...  51.6    1e-05   Prunus mume [ume]
ref|XP_003518995.1|  PREDICTED: uncharacterized protein LOC100789...  51.2    1e-05   Glycine max [soybeans]
gb|EPS69171.1|  hypothetical protein M569_05597                       50.8    2e-05   Genlisea aurea
ref|XP_006288505.1|  hypothetical protein CARUB_v10001769mg           51.2    2e-05   Capsella rubella
ref|XP_010552941.1|  PREDICTED: uncharacterized protein LOC104823196  50.8    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_004138686.1|  PREDICTED: uncharacterized protein SYNPCC700...  50.4    3e-05   Cucumis sativus [cucumbers]
ref|XP_010694519.1|  PREDICTED: uncharacterized protein LOC104907303  50.4    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004159242.1|  PREDICTED: uncharacterized protein SYNPCC700...  50.4    3e-05   
gb|KGN63024.1|  hypothetical protein Csa_2G384440                     50.4    3e-05   Cucumis sativus [cucumbers]
ref|XP_006398904.1|  hypothetical protein EUTSA_v10014494mg           49.7    5e-05   Eutrema salsugineum [saltwater cress]
ref|XP_007218206.1|  hypothetical protein PRUPE_ppa010633mg           49.3    6e-05   Prunus persica
ref|XP_008456550.1|  PREDICTED: uncharacterized protein LOC103496...  48.9    1e-04   Cucumis melo [Oriental melon]
ref|XP_009361429.1|  PREDICTED: uncharacterized protein LOC103951...  48.5    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_006588992.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    2e-04   
ref|XP_002532619.1|  conserved hypothetical protein                   48.1    2e-04   
gb|KDP45068.1|  hypothetical protein JCGZ_01568                       48.1    2e-04   Jatropha curcas
ref|XP_006588991.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    2e-04   
ref|XP_006588987.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    2e-04   
ref|XP_006588988.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    2e-04   
ref|XP_006588989.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    2e-04   
ref|XP_006588985.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    3e-04   Glycine max [soybeans]
ref|XP_006588986.1|  PREDICTED: uncharacterized protein LOC100797...  47.8    3e-04   
ref|XP_009122596.1|  PREDICTED: uncharacterized protein LOC103847290  47.8    3e-04   Brassica rapa
emb|CDX70224.1|  BnaA10g25730D                                        47.8    3e-04   
gb|KHN02048.1|  hypothetical protein glysoja_046281                   47.4    3e-04   Glycine soja [wild soybean]
ref|XP_002871094.1|  hypothetical protein ARALYDRAFT_487226           47.4    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_007145503.1|  hypothetical protein PHAVU_007G244000g           47.4    3e-04   Phaseolus vulgaris [French bean]
ref|NP_196064.2|  uncharacterized protein                             47.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAB85550.1|  putative protein                                     47.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58441.1|  BnaC03g71250D                                        46.6    5e-04   Brassica napus [oilseed rape]
ref|XP_010423577.1|  PREDICTED: uncharacterized protein LOC104708675  47.0    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010452341.1|  PREDICTED: uncharacterized protein LOC104734455  47.0    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010067191.1|  PREDICTED: uncharacterized protein LOC104454136  47.0    5e-04   Eucalyptus grandis [rose gum]
ref|XP_010490956.1|  PREDICTED: uncharacterized protein LOC104768633  46.6    6e-04   Camelina sativa [gold-of-pleasure]
emb|CDY44856.1|  BnaC09g50560D                                        46.2    9e-04   Brassica napus [oilseed rape]



>ref|XP_009764361.1| PREDICTED: uncharacterized protein LOC104216095 [Nicotiana sylvestris]
Length=247

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 4/66 (6%)
 Frame = +1

Query  109  YVSFRFKNPK---VCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQ  279
            Y+ F++KNP+      P ALL+LTS  S D  + SLRI+AD+APK RFIARRKES+SV+Q
Sbjct  15   YIPFQYKNPRFPTTSVPYALLNLTSS-SDDYSKRSLRITADSAPKARFIARRKESLSVKQ  73

Query  280  LQRPLM  297
            LQRPLM
Sbjct  74   LQRPLM  79



>ref|XP_004239713.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
 ref|XP_010321338.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
 ref|XP_010321339.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
Length=238

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 9/64 (14%)
 Frame = +1

Query  109  YVSFRFKNPKVCPPVALLSLTSPPSYDSPR-GSLRISADAAPKVRFIARRKESVSVRQLQ  285
            Y+SF++KNP+          T+  S DS +  +LRI+AD+APK RFI RRKES+SV+QLQ
Sbjct  15   YISFQYKNPRFS--------TTLSSVDSSKCTTLRITADSAPKARFIGRRKESLSVKQLQ  66

Query  286  RPLM  297
            RPLM
Sbjct  67   RPLM  70



>ref|XP_009607482.1| PREDICTED: uncharacterized protein LOC104101695 [Nicotiana tomentosiformis]
Length=247

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = +1

Query  109  YVSFRFKNPK---VCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQ  279
            Y+ F +KNP+      P ALL+LTS  +  S + SLRI+AD+APK RFIARRKES+SV+Q
Sbjct  15   YIPFHYKNPRFPTTSVPYALLNLTSSSND-SSKRSLRITADSAPKARFIARRKESLSVKQ  73

Query  280  LQRPLM  297
            LQRPLM
Sbjct  74   LQRPLM  79



>ref|XP_006345847.1| PREDICTED: uncharacterized protein LOC102602810 [Solanum tuberosum]
Length=238

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 9/64 (14%)
 Frame = +1

Query  109  YVSFRFKNPKVCPPVALLSLTSPPSYDSPR-GSLRISADAAPKVRFIARRKESVSVRQLQ  285
            Y+SF++K PK          T+  S DS +  +LRI+AD+APK RFI RRKES+SV+QLQ
Sbjct  15   YISFQYKTPKFS--------TTFSSVDSSKCTTLRITADSAPKARFIGRRKESLSVKQLQ  66

Query  286  RPLM  297
            RPLM
Sbjct  67   RPLM  70



>ref|XP_011031599.1| PREDICTED: uncharacterized protein LOC105130684 isoform X2 [Populus 
euphratica]
Length=204

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 9/65 (14%)
 Frame = +1

Query  112  VSFRFKNPK---VCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQL  282
            +S+R KNP+    C  +  L+ +SP +      SLR SAD+ PK +F+ARRKESVSVRQL
Sbjct  17   ISYRSKNPRNSLSCKHL-FLNFSSPVT-----ESLRASADSTPKAKFVARRKESVSVRQL  70

Query  283  QRPLM  297
             RPLM
Sbjct  71   GRPLM  75



>ref|XP_006379512.1| hypothetical protein POPTR_0008s03030g [Populus trichocarpa]
 gb|ERP57309.1| hypothetical protein POPTR_0008s03030g [Populus trichocarpa]
Length=243

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 9/65 (14%)
 Frame = +1

Query  112  VSFRFKNPK---VCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQL  282
            +SFR K P+    C  +  L+ +SP +      SLR+SAD+ PK +F+ARRKESVSVRQL
Sbjct  17   ISFRSKYPRNSLTCKHL-FLNFSSPVT-----ESLRVSADSTPKAKFVARRKESVSVRQL  70

Query  283  QRPLM  297
             RPLM
Sbjct  71   GRPLM  75



>ref|XP_011031598.1| PREDICTED: uncharacterized protein LOC105130684 isoform X1 [Populus 
euphratica]
Length=243

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 9/65 (14%)
 Frame = +1

Query  112  VSFRFKNPK---VCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQL  282
            +S+R KNP+    C  +  L+ +SP +      SLR SAD+ PK +F+ARRKESVSVRQL
Sbjct  17   ISYRSKNPRNSLSCKHL-FLNFSSPVT-----ESLRASADSTPKAKFVARRKESVSVRQL  70

Query  283  QRPLM  297
             RPLM
Sbjct  71   GRPLM  75



>ref|XP_011015662.1| PREDICTED: uncharacterized protein LOC105119235, partial [Populus 
euphratica]
Length=125

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +1

Query  112  VSFRFKNPKVCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRP  291
            +SFR +NP+   P+    L  P  Y  P+ +LR SAD+APK +FIARR+ESVSVRQL RP
Sbjct  9    ISFRSRNPR--NPLTSKQLF-PTEY--PKCTLRASADSAPKAKFIARRRESVSVRQLGRP  63

Query  292  LM  297
            L+
Sbjct  64   LV  65



>emb|CDO99821.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +1

Query  121  RFKNPKVCPPVALLSLTSPPSYDSPRGSLRISAD-AAPKVRFIARRKESVSVRQLQRPL  294
            RF+ P++   V L SLT     DS + S+RISAD AAPK RF+ARR ESVSVRQL+RPL
Sbjct  16   RFRYPRLSARV-LSSLTD----DSSKSSVRISADSAAPKARFVARRTESVSVRQLKRPL  69



>ref|XP_011024313.1| PREDICTED: uncharacterized protein LOC105125526 [Populus euphratica]
Length=233

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +1

Query  112  VSFRFKNPKVCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRP  291
            +SFR +NP+   P+    L  P  Y  P+ +LR SAD+APK +FIARR+ESVSVRQL RP
Sbjct  9    ISFRSRNPR--NPLTSKQLF-PTEY--PKCTLRASADSAPKAKFIARRRESVSVRQLGRP  63

Query  292  LM  297
            L+
Sbjct  64   LV  65



>ref|XP_011101526.1| PREDICTED: uncharacterized protein LOC105179587 [Sesamum indicum]
Length=244

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  202  SLRISADAAPKVRFIARRKESVSVRQLQRPL  294
            +LRISAD+APK RF+ARR ESVSVRQLQRPL
Sbjct  45   TLRISADSAPKARFVARRTESVSVRQLQRPL  75



>emb|CAN67223.1| hypothetical protein VITISV_029052 [Vitis vinifera]
Length=178

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  187  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +S + S RISAD APK RF+ARR+ESVSV+QL+RPL+
Sbjct  35   ESSKPSFRISADLAPKARFVARRRESVSVKQLERPLV  71



>ref|XP_002270872.1| PREDICTED: uncharacterized protein LOC100249596 [Vitis vinifera]
 emb|CBI31380.3| unnamed protein product [Vitis vinifera]
Length=239

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  187  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +S + S RISAD APK RF+ARR+ESVSV+QL+RPL+
Sbjct  35   ESSKPSFRISADLAPKARFVARRRESVSVKQLERPLV  71



>ref|XP_006575157.1| PREDICTED: uncharacterized protein LOC100789119 isoform X2 [Glycine 
max]
Length=189

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            SPR SLR SA  + K RF+ARRKESVSVRQLQRPL+
Sbjct  25   SPRLSLRASATPSQKARFVARRKESVSVRQLQRPLI  60



>gb|EYU32449.1| hypothetical protein MIMGU_mgv1a012632mg [Erythranthe guttata]
Length=245

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  124  FKNPKVCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            F+N +  P + +LS  +  S DS +   RISAD++PK RF+ARR ESVSVRQLQRPL+
Sbjct  20   FRNSRRSPYIFVLSNLASSSDDSAKSPRRISADSSPKARFVARRTESVSVRQLQRPLI  77



>ref|XP_002315341.2| hypothetical protein POPTR_0010s23740g [Populus trichocarpa]
 gb|EEF01512.2| hypothetical protein POPTR_0010s23740g [Populus trichocarpa]
Length=356

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  175  PPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            P  Y  P+ +LR SAD+APK +FIARR+ESVSVRQL RPL+
Sbjct  150  PTEY--PKCTLRASADSAPKAKFIARRRESVSVRQLGRPLV  188



>ref|XP_008232054.1| PREDICTED: uncharacterized protein LOC103331217 isoform X1 [Prunus 
mume]
Length=242

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  181  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPL  294
            ++ SP+ SL ISAD  PK RF+ARR ESVSV QLQRPL
Sbjct  36   AFASPKPSLHISADLTPKARFVARRTESVSVPQLQRPL  73



>ref|XP_003518995.1| PREDICTED: uncharacterized protein LOC100789119 isoform X1 [Glycine 
max]
 gb|KHN28481.1| Hypothetical protein glysoja_048359 [Glycine soja]
Length=228

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            SPR SLR SA  + K RF+ARRKESVSVRQLQRPL+
Sbjct  25   SPRLSLRASATPSQKARFVARRKESVSVRQLQRPLI  60



>gb|EPS69171.1| hypothetical protein M569_05597, partial [Genlisea aurea]
Length=237

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  211  ISADAAPKVRFIARRKESVSVRQLQRPL  294
            ISAD+APK RF+ARR ESVSVRQLQRPL
Sbjct  39   ISADSAPKARFVARRTESVSVRQLQRPL  66



>ref|XP_006288505.1| hypothetical protein CARUB_v10001769mg [Capsella rubella]
 gb|EOA21403.1| hypothetical protein CARUB_v10001769mg [Capsella rubella]
Length=257

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 14/76 (18%)
 Frame = +1

Query  112  VSFRFKNPKVCP--PVALLSLTSPPSYDSP------------RGSLRISADAAPKVRFIA  249
            +SF  K P   P  P    ++TS  SYD P               +R+S+ + PK RFIA
Sbjct  14   MSFSAKKPNPNPRNPSLSFTITSSSSYDEPPKPTSLTSSSSSTPPVRVSSSSTPKARFIA  73

Query  250  RRKESVSVRQLQRPLM  297
            R+K+S+SVRQLQRPL+
Sbjct  74   RQKQSISVRQLQRPLI  89



>ref|XP_010552941.1| PREDICTED: uncharacterized protein LOC104823196 [Tarenaya hassleriana]
Length=258

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            LR+S+ +APK RFIARRKE+VSVRQLQRPL+
Sbjct  60   LRVSSRSAPKARFIARRKEAVSVRQLQRPLI  90



>ref|XP_004138686.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590-like [Cucumis 
sativus]
Length=242

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = +1

Query  118  FRFKNPKVCPPVALLS----LTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQ  285
              +KNPK   P +L      + +  + DS R SL IS ++ PK RFIARR ESV+VRQL 
Sbjct  13   LHYKNPKT--PFSLTHKPFLILASSANDSTRPSLPISTNSNPKARFIARRSESVTVRQLA  70

Query  286  RPL  294
            RPL
Sbjct  71   RPL  73



>ref|XP_010694519.1| PREDICTED: uncharacterized protein LOC104907303 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  169  TSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +SP    + +   RIS+D APK RF+ARRKE++SV+QLQRPL+
Sbjct  38   SSPIKLHNNKIPFRISSDLAPKARFVARRKETLSVQQLQRPLL  80



>ref|XP_004159242.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590-like [Cucumis 
sativus]
Length=242

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = +1

Query  118  FRFKNPKVCPPVALLS----LTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQ  285
              +KNPK   P +L      + +  + DS R SL IS ++ PK RFIARR ESV+VRQL 
Sbjct  13   LHYKNPKT--PFSLTHKPFLILASSANDSTRPSLPISTNSNPKARFIARRSESVTVRQLA  70

Query  286  RPL  294
            RPL
Sbjct  71   RPL  73



>gb|KGN63024.1| hypothetical protein Csa_2G384440 [Cucumis sativus]
Length=247

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = +1

Query  118  FRFKNPKVCPPVALLS----LTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQ  285
              +KNPK   P +L      + +  + DS R SL IS ++ PK RFIARR ESV+VRQL 
Sbjct  13   LHYKNPKT--PFSLTHKPFLILASSANDSTRPSLPISTNSNPKARFIARRSESVTVRQLA  70

Query  286  RPL  294
            RPL
Sbjct  71   RPL  73



>ref|XP_006398904.1| hypothetical protein EUTSA_v10014494mg [Eutrema salsugineum]
 gb|ESQ40357.1| hypothetical protein EUTSA_v10014494mg [Eutrema salsugineum]
Length=250

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 9/72 (13%)
 Frame = +1

Query  109  YVSFRFK--NPKVCPPVALLSLTSPPSYDSPRGS-------LRISADAAPKVRFIARRKE  261
            ++SF  K  N  +  P    ++T   S+D P          +R+S+ AAPK RF+AR+K+
Sbjct  11   FLSFSAKKTNRNIRNPSLSFAITCSSSFDEPSKPSSSSTPPIRVSSSAAPKARFVARQKQ  70

Query  262  SVSVRQLQRPLM  297
            SVSVRQLQRPL+
Sbjct  71   SVSVRQLQRPLI  82



>ref|XP_007218206.1| hypothetical protein PRUPE_ppa010633mg [Prunus persica]
 gb|EMJ19405.1| hypothetical protein PRUPE_ppa010633mg [Prunus persica]
Length=242

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 8/59 (14%)
 Frame = +1

Query  142  CPPVALLSLTSPP--------SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPL  294
            CP   L + TSP         ++  P+ SL ISAD  PK RF+ARR ESVSV QLQRPL
Sbjct  15   CPYENLRNGTSPRLKLKHVLFAFAPPKPSLHISADLTPKARFVARRTESVSVPQLQRPL  73



>ref|XP_008456550.1| PREDICTED: uncharacterized protein LOC103496471 isoform X1 [Cucumis 
melo]
Length=242

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  187  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPL  294
            DS R SL IS ++ PK RF+ARR ESV+VRQL+RPL
Sbjct  38   DSTRPSLPISTNSNPKARFVARRSESVTVRQLERPL  73



>ref|XP_009361429.1| PREDICTED: uncharacterized protein LOC103951706 isoform X1 [Pyrus 
x bretschneideri]
Length=235

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  202  SLRISADAAPKVRFIARRKESVSVRQLQRPL  294
            S+R+SAD++PK RF+ARR ESVSV QLQRPL
Sbjct  36   SVRVSADSSPKARFVARRTESVSVPQLQRPL  66



>ref|XP_006588992.1| PREDICTED: uncharacterized protein LOC100797206 isoform X9 [Glycine 
max]
Length=209

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_002532619.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29750.1| conserved hypothetical protein [Ricinus communis]
Length=245

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +1

Query  145  PPVALLSLTSPPSYDSPRG-SLRI-SADAAPKVRFIARRKESVSVRQLQRPLM  297
            P +  L+  S  +  SPR   LRI SA+A PK RFIARRKESV VRQL RPL+
Sbjct  25   PRIFSLNFNSSQNGSSPRKPFLRIVSANATPKARFIARRKESVWVRQLGRPLI  77



>gb|KDP45068.1| hypothetical protein JCGZ_01568 [Jatropha curcas]
Length=241

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +1

Query  109  YVSFRFKNPKVCPPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQR  288
            +V F+ K P+V  P+   S     S +SP+ S RIS  +  K RFIARRKESVS++QL R
Sbjct  18   FVPFKSKTPRV--PLYFSS-----SNESPKPSRRISVSSMQKARFIARRKESVSIQQLGR  70

Query  289  PLM  297
            PL+
Sbjct  71   PLI  73



>ref|XP_006588991.1| PREDICTED: uncharacterized protein LOC100797206 isoform X8 [Glycine 
max]
Length=222

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_006588987.1| PREDICTED: uncharacterized protein LOC100797206 isoform X4 [Glycine 
max]
Length=235

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_006588988.1| PREDICTED: uncharacterized protein LOC100797206 isoform X5 [Glycine 
max]
Length=234

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_006588989.1| PREDICTED: uncharacterized protein LOC100797206 isoform X6 [Glycine 
max]
 ref|XP_006588990.1| PREDICTED: uncharacterized protein LOC100797206 isoform X7 [Glycine 
max]
Length=232

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_006588985.1| PREDICTED: uncharacterized protein LOC100797206 isoform X2 [Glycine 
max]
Length=266

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_006588986.1| PREDICTED: uncharacterized protein LOC100797206 isoform X3 [Glycine 
max]
 ref|XP_003535909.2| PREDICTED: uncharacterized protein LOC100797206 isoform X1 [Glycine 
max]
Length=253

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_009122596.1| PREDICTED: uncharacterized protein LOC103847290 [Brassica rapa]
Length=253

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  208  RISADAAPKVRFIARRKESVSVRQLQRPLM  297
            R+S+ +APK RF+AR+K+SVSVRQLQRPL+
Sbjct  56   RVSSSSAPKARFVARQKQSVSVRQLQRPLI  85



>emb|CDX70224.1| BnaA10g25730D [Brassica napus]
Length=253

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  208  RISADAAPKVRFIARRKESVSVRQLQRPLM  297
            R+S+ +APK RF+AR+K+SVSVRQLQRPL+
Sbjct  56   RVSSSSAPKARFVARQKQSVSVRQLQRPLI  85



>gb|KHN02048.1| hypothetical protein glysoja_046281 [Glycine soja]
Length=238

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  190  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            S R SLR SA  + K RF+ARRKES+SVRQLQRPL+
Sbjct  28   SQRLSLRASATPSQKARFVARRKESLSVRQLQRPLI  63



>ref|XP_002871094.1| hypothetical protein ARALYDRAFT_487226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47353.1| hypothetical protein ARALYDRAFT_487226 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 8/51 (16%)
 Frame = +1

Query  145  PPVALLSLTSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            PP   L+ ++PP        +R+S+ + PK RFIAR+K+S+SVRQLQRPL+
Sbjct  42   PPKPSLASSTPP--------IRVSSSSTPKARFIARQKQSISVRQLQRPLI  84



>ref|XP_007145503.1| hypothetical protein PHAVU_007G244000g [Phaseolus vulgaris]
 gb|ESW17497.1| hypothetical protein PHAVU_007G244000g [Phaseolus vulgaris]
Length=229

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  169  TSPPSYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            T   +  S R SLR SA    K RF+ RRKESVSVRQLQRPL+
Sbjct  19   TKQWNLKSSRPSLRASATPTQKARFVGRRKESVSVRQLQRPLI  61



>ref|NP_196064.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY34156.1| At5g04440 [Arabidopsis thaliana]
 gb|ABD19663.1| At5g04440 [Arabidopsis thaliana]
 gb|AED90745.1| uncharacterized protein AT5G04440 [Arabidopsis thaliana]
Length=255

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +R+S+ + PK RFIAR+K+SVSVRQLQRPL+
Sbjct  57   IRVSSSSTPKARFIARQKQSVSVRQLQRPLI  87



>emb|CAB85550.1| putative protein [Arabidopsis thaliana]
Length=285

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +R+S+ + PK RFIAR+K+SVSVRQLQRPL+
Sbjct  57   IRVSSSSTPKARFIARQKQSVSVRQLQRPLI  87



>emb|CDY58441.1| BnaC03g71250D [Brassica napus]
Length=206

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +1

Query  160  LSLTSPPSYDSPRGS-LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            L++T   S D P    +R+ + + PK RFI+R+K+SVSVRQLQRPL+
Sbjct  25   LTITCSSSLDEPSSPPIRVPSSSTPKARFISRQKQSVSVRQLQRPLI  71



>ref|XP_010423577.1| PREDICTED: uncharacterized protein LOC104708675 [Camelina sativa]
Length=253

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+
Sbjct  55   IRVSSSSVPKARFIARQKQSISVRQLQRPLI  85



>ref|XP_010452341.1| PREDICTED: uncharacterized protein LOC104734455 [Camelina sativa]
Length=253

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+
Sbjct  55   IRVSSSSVPKARFIARQKQSISVRQLQRPLI  85



>ref|XP_010067191.1| PREDICTED: uncharacterized protein LOC104454136 [Eucalyptus grandis]
Length=271

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPL  294
            LRI+A + PK RF+ARRKESVSVRQL RPL
Sbjct  73   LRIAAASNPKARFVARRKESVSVRQLDRPL  102



>ref|XP_010490956.1| PREDICTED: uncharacterized protein LOC104768633 [Camelina sativa]
Length=255

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  205  LRISADAAPKVRFIARRKESVSVRQLQRPLM  297
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+
Sbjct  57   IRVSSSSVPKARFIARQKQSISVRQLQRPLI  87



>emb|CDY44856.1| BnaC09g50560D [Brassica napus]
Length=249

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 8/54 (15%)
 Frame = +1

Query  160  LSLTSPPSYDSP-RGSL-------RISADAAPKVRFIARRKESVSVRQLQRPLM  297
             ++T   S+D P + SL       R+S+ + PK RF+AR+K+SVSVRQLQRPL+
Sbjct  28   FTITCSSSFDEPPKPSLTSSSTPNRVSSSSDPKARFVARQKQSVSVRQLQRPLI  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566700398000