BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002P10

Length=270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    110   1e-26   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    106   3e-25   Nicotiana tomentosiformis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    106   5e-25   
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    105   1e-24   Nicotiana tomentosiformis
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    104   2e-24   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    104   3e-24   Nicotiana sylvestris
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               103   8e-24   Solanum tuberosum [potatoes]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    103   8e-24   Solanum tuberosum [potatoes]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    102   8e-24   Solanum lycopersicum
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg              96.3    2e-22   Erythranthe guttata [common monkey flower]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B            98.6    4e-22   Scoparia dulcis [escobilla]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    7e-22   Sesamum indicum [beniseed]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.4    1e-21   Prunus mume [ume]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg           97.1    1e-21   Prunus persica
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    3e-21   Fragaria vesca subsp. vesca
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B       95.9    2e-20   
emb|CAN69459.1|  hypothetical protein VITISV_021576                   91.3    2e-19   Vitis vinifera
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-19   Malus domestica [apple tree]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B            91.3    2e-19   Pyrus x bretschneideri [bai li]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...  91.3    2e-19   Pyrus x bretschneideri [bai li]
gb|KJB14201.1|  hypothetical protein B456_002G114000                  89.4    9e-19   Gossypium raimondii
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.0    1e-18   Vitis vinifera
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  88.6    2e-18   Pisum sativum [garden pea]
emb|CAA33262.1|  unnamed protein product                              88.6    2e-18   Pisum sativum [garden pea]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  88.6    2e-18   Glycine soja [wild soybean]
gb|ACU20783.1|  unknown                                               88.6    2e-18   Glycine max [soybeans]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  88.2    2e-18   Gossypium arboreum [tree cotton]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  87.8    3e-18   Gossypium arboreum [tree cotton]
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase         85.9    4e-18   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.2    4e-18   Cicer arietinum [garbanzo]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.0    6e-18   
gb|KJB57937.1|  hypothetical protein B456_009G186400                  85.5    6e-18   Gossypium raimondii
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.0    6e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.0    7e-18   Nelumbo nucifera [Indian lotus]
gb|KJB57939.1|  hypothetical protein B456_009G186400                  85.5    8e-18   Gossypium raimondii
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  86.7    1e-17   
ref|NP_001240080.1|  uncharacterized protein LOC100806482             86.7    1e-17   Glycine max [soybeans]
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B            85.9    1e-17   Medicago truncatula
gb|ACJ85309.1|  unknown                                               83.6    2e-17   Medicago truncatula
gb|ACJ84309.1|  unknown                                               85.5    2e-17   Medicago truncatula
gb|KJB57938.1|  hypothetical protein B456_009G186400                  85.1    2e-17   Gossypium raimondii
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase         85.5    2e-17   Medicago truncatula
gb|KJB57936.1|  hypothetical protein B456_009G186400                  85.5    2e-17   Gossypium raimondii
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase     81.6    3e-17   Tragopogon pratensis [Jack-go-to-bed-at-noon]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    3e-17   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase         85.5    3e-17   
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...  85.1    3e-17   Glycine max [soybeans]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    4e-17   Pyrus x bretschneideri [bai li]
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase     81.3    4e-17   Tragopogon dubius [yellow salsify]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    4e-17   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.3    5e-17   Elaeis guineensis
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  84.0    8e-17   Nicotiana tabacum [American tobacco]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g           84.0    8e-17   Phaseolus vulgaris [French bean]
emb|CDP07271.1|  unnamed protein product                              83.6    1e-16   Coffea canephora [robusta coffee]
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  83.6    1e-16   Spinacia oleracea
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...  82.4    3e-16   
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  82.0    4e-16   Phoenix dactylifera
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  81.6    5e-16   Cucumis melo [Oriental melon]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  81.6    6e-16   Ricinus communis
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  81.6    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  81.3    7e-16   Populus euphratica
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  81.3    7e-16   Populus euphratica
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    2e-15   Cucumis sativus [cucumbers]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                       78.6    8e-15   Jatropha curcas
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  77.8    1e-14   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g           77.8    2e-14   
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g           76.3    2e-14   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  77.0    3e-14   Populus euphratica
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  77.0    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  76.6    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  76.3    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...  76.3    6e-14   Populus trichocarpa [western balsam poplar]
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                 73.6    9e-14   Citrus sinensis [apfelsine]
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                 73.6    1e-13   Citrus sinensis [apfelsine]
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                 73.2    1e-13   Citrus sinensis [apfelsine]
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                 73.6    1e-13   Citrus sinensis [apfelsine]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  74.3    2e-13   Eucalyptus grandis [rose gum]
gb|AAB23533.1|  glyceraldehyde-3-phosphate-dehydrogenase subunit ...  69.3    4e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                 72.0    4e-13   Citrus sinensis [apfelsine]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                 73.2    5e-13   Citrus sinensis [apfelsine]
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                 72.4    5e-13   Citrus sinensis [apfelsine]
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg           72.0    6e-13   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    6e-13   Citrus sinensis [apfelsine]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg           73.2    6e-13   Citrus clementina [clementine]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg           72.0    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.6    2e-12   Brassica rapa
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase              70.5    5e-12   Vicia sativa [spring vetch]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B          69.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg           67.0    9e-11   Capsella rubella
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  65.9    2e-10   
gb|EPS70760.1|  hypothetical protein M569_03997                       63.5    1e-09   Genlisea aurea
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                  63.5    2e-09   Arabis alpina [alpine rockcress]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g           60.8    1e-08   
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  56.6    9e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.2    5e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001048847.1|  Os03g0129300                                     56.2    5e-07   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  55.8    7e-07   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  55.8    7e-07   Triticum urartu
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.8    8e-07   Setaria italica
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.1    1e-06   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  54.7    2e-06   
dbj|BAJ86633.1|  predicted protein                                    53.9    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                    53.9    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  47.8    3e-04   



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 4/75 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLP+K S     QCFSK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLPAKNSHSFPTQCFSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKL  269
             TG APVKG TVAKL
Sbjct  70   TTGSAPVKGETVAKL  84



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLPSK S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPSKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKL  269
             TG APVKG TVAKL
Sbjct  70   TTGLAPVKGETVAKL  84



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 62/76 (82%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  225  KATG-APVKGVTVAKL  269
            K TG APVKG TVAKL
Sbjct  70   KTTGSAPVKGETVAKL  85



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLPSK S     QCFSK+ EVAEFSGLRSSG VTFSNRE+S  DVV+AQLTPK
Sbjct  10   SRIPTSTRLPSKNSQSFPTQCFSKKFEVAEFSGLRSSGYVTFSNRESSLFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKL  269
             TG APVKG TVAKL
Sbjct  70   TTGSAPVKGETVAKL  84



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 61/76 (80%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  225  KATG-APVKGVTVAKL  269
            K TG AP KG TVAKL
Sbjct  70   KTTGSAPAKGETVAKL  85



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLP+K S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPTKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  228  ATGA-PVKGVTVAKL  269
             TG+ PVKG TVAKL
Sbjct  70   TTGSTPVKGETVAKL  84



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 61/76 (80%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKL  269
             TG+  PVKG TVAKL
Sbjct  70   TTGSAGPVKGETVAKL  85



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 61/76 (80%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKL  269
             TG+  PVKG TVAKL
Sbjct  70   TTGSAGPVKGETVAKL  85



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 61/76 (80%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKL  269
             TG+  PVKG TVAKL
Sbjct  70   TTGSAGPVKGETVAKL  85



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            SRIPT TRLPSKT+   + QCFSK++EVAEFSGL+S+GCV F  ++REAS  DVVAAQLT
Sbjct  10   SRIPTSTRLPSKTTHSFSAQCFSKKVEVAEFSGLKSNGCVAFTKNSREASLFDVVAAQLT  69

Query  222  PKATG--APVKGVTVAKL  269
             K +G  APVKG TVAKL
Sbjct  70   TKTSGESAPVKGETVAKL  87



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFS-NREASFSDVVAAQLT  221
            SRIPT TRLPSKTS      QCFSK+LEVAEFSGLRSSGCVTF+ N+EASF D VAAQLT
Sbjct  10   SRIPTSTRLPSKTSHSFPAAQCFSKKLEVAEFSGLRSSGCVTFAKNKEASFFDAVAAQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
             K  G+  VKG TVAKL
Sbjct  70   LKTAGSTTVKGETVAKL  86



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            SR+PT TRLPSK S     QCFSK+LEVAEFSGLR  G VTF  + REASF DVVAAQLT
Sbjct  10   SRVPTSTRLPSKASNAFPAQCFSKKLEVAEFSGLRVGGSVTFAKNGREASFFDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
            PKA G+ PVKG TVAKL
Sbjct  70   PKAAGSTPVKGETVAKL  86



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 60/77 (78%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            PK TG APVKG TVAKL
Sbjct  70   PKTTGPAPVKGETVAKL  86



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 60/77 (78%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            PK TG APVKG TVAKL
Sbjct  70   PKTTGPAPVKGETVAKL  86



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSKTS     QCFSKRLEVAEFSGLRSS C+T+++  REAS  D VAAQLT
Sbjct  10   TRIPANTRLPSKTSHSYPTQCFSKRLEVAEFSGLRSSSCLTYASNGREASLFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            P+ +G APVKG TVAKL
Sbjct  70   PQTSGSAPVKGETVAKL  86



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 8/78 (10%)
 Frame = +3

Query  60   RIPTRTRLPSKT----STP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            RIPT TRLPS +    S P QCFSK+LEVAEFSGLRSS CVT++   REASF DVVAAQL
Sbjct  12   RIPTNTRLPSNSKPSHSFPTQCFSKKLEVAEFSGLRSSSCVTYAKNAREASFFDVVAAQL  71

Query  219  TPKATG-APVKGVTVAKL  269
            TP+  G APVKG TVAKL
Sbjct  72   TPRTAGSAPVKGETVAKL  89



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIPT  TRLPSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRLPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  219  TPKATG-APVKGVTVAKL  269
            TPKA G APV+G TVAKL
Sbjct  70   TPKAGGPAPVRGETVAKL  87



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            PK  G  PV+G TVAKL
Sbjct  70   PKTAGPTPVRGETVAKL  86



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            PK  G  PV+G TVAKL
Sbjct  70   PKTAGPTPVRGETVAKL  86



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKL  269
            PK  G  PV+G TVAKL
Sbjct  70   PKTAGPTPVRGETVAKL  86



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ASF DV+AAQL+
Sbjct  10   SRIPANTRLPSKTTHSFPTQCPSKRLEVTEFSGLRSSSCVTFAKNVRDASFFDVLAAQLS  69

Query  222  PKATGAP---VKGVTVAKL  269
            PK  G P   V+G TVAKL
Sbjct  70   PKGVGVPSTSVRGETVAKL  88



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIPT  TR PSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRHPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  219  TPKATG-APVKGVTVAKL  269
            TPKA G APV+G TVAKL
Sbjct  70   TPKAGGPAPVRGETVAKL  87



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  10   TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  VKGVTVAKL
Sbjct  70   SKANGSTAVKGVTVAKL  86



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  6    TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  65

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  VKGVTVAKL
Sbjct  66   SKANGSTAVKGVTVAKL  82



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKL  269
            PK  G+  PV+G TVAKL
Sbjct  70   PKTNGSSTPVRGETVAKL  87



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKL  269
            PK  G+  PV+G TVAKL
Sbjct  70   PKTNGSSTPVRGETVAKL  87



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            S+IP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ SF DV+AAQLT
Sbjct  10   SKIPANTRLPSKTTHSFPTQCSSKRLEVTEFSGLRSSSCVTFAKNVRDTSFFDVLAAQLT  69

Query  222  PKATGAP---VKGVTVAKL  269
            PK+ G P   V+G TVAKL
Sbjct  70   PKSEGVPSASVRGETVAKL  88



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRIP  TRLPSK      S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIPATTRLPSKATHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFYDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKL  269
            LTPK  G   PV+G TVAKL
Sbjct  70   LTPKTAGGATPVRGETVAKL  89



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEF GL+S+ C+T++N  R++SFSDVVAAQLT
Sbjct  83   TRIPTNTRFPSKASHNFPTQCASKRLEVAEFCGLKSTSCITYANNARDSSFSDVVAAQLT  142

Query  222  PKAT--GAPVKGVTVAKL  269
             KA     PV+G TVAKL
Sbjct  143  SKAAVGSIPVRGETVAKL  160



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA---PVKGVTVAKL  269
            PK T     PV+G TVAKL
Sbjct  70   PKQTNGSSTPVRGETVAKL  88



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKL  269
            LTPK  G   PV+G TVAKL
Sbjct  70   LTPKTAGGATPVRGETVAKL  89



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 58/77 (75%), Gaps = 7/77 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  221
            +RIP  TRLP+K +       QC  K+L+VA+FSGLRSS CVTF+ REASF DV+AAQLT
Sbjct  10   TRIPASTRLPTKAAQQHSFPTQCSFKKLDVADFSGLRSSNCVTFT-REASFHDVIAAQLT  68

Query  222  PKATG-APVKGVTVAKL  269
             K TG APV+G TVAKL
Sbjct  69   TKTTGAAPVRGETVAKL  85



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TRLPS++S     QCFSKRLEVA+FSGLRSS  VTF    RE+SF DVVA+QL 
Sbjct  10   SRIPANTRLPSRSSHSHATQCFSKRLEVADFSGLRSSTSVTFGKNARESSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+G TVAKL
Sbjct  70   PKVAASTPVRGETVAKL  86



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKL  269
            LTPK  G   PV+G TVAKL
Sbjct  70   LTPKTAGGATPVRGETVAKL  89



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
            PK  G+ PV+G TVAKL
Sbjct  70   PKTNGSTPVRGETVAKL  86



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
            PK  G+ PV+G TVAKL
Sbjct  70   PKTNGSTPVRGETVAKL  86



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC S+RLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASRRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKL  269
            LTPK  G   PV+G TVAKL
Sbjct  70   LTPKTAGGATPVRGETVAKL  89



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKL  269
            LTPK  G   PV+G TVAKL
Sbjct  70   LTPKTAGGATPVRGETVAKL  89



>gb|ABC68431.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
pratensis]
Length=143

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 8/79 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKLSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  216  LTPKATGAPVKGV-TVAKL  269
             TPKA G+ V  V TVAKL
Sbjct  70   FTPKAAGSTVAKVETVAKL  88



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKL  269
            K  G APVKG TVAKL
Sbjct  71   KTAGPAPVKGETVAKL  86



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             KA G+  V+G TVAKL
Sbjct  70   TKAIGSTAVRGETVAKL  86



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKL  269
            PK T    PV+G TVAKL
Sbjct  70   PKQTNGSTPVRGETVAKL  87



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKL  269
            K  G APVKG TVAKL
Sbjct  71   KTAGPAPVKGETVAKL  86



>gb|ABC68432.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=143

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 8/79 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKPSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  216  LTPKATGAPVKGV-TVAKL  269
             TPKA G+ V  V TVAKL
Sbjct  70   FTPKAAGSTVAKVETVAKL  88



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKL  269
            K  G APVKG TVAKL
Sbjct  71   KTAGPAPVKGETVAKL  86



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQ---CFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLT  221
            SRIP+ TR  SK +       F+KRLEVAEFSGLRSS CVTF+   REASFSDV+AAQL 
Sbjct  10   SRIPSNTRFHSKATHSHPTPSFTKRLEVAEFSGLRSSTCVTFATQGREASFSDVLAAQLA  69

Query  222  PKATGA-PVKGVTVAKL  269
             K  GA PV+G TVAKL
Sbjct  70   SKTVGASPVRGETVAKL  86



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +3

Query  108  CFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKAT-GAPVKGVTVAKL  269
            C SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK T   PVKG TVAKL
Sbjct  1    CLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPKTTRSTPVKGETVAKL  55



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T  PSK S     QC SKRLEV +FSGLRS+ CVT+++  RE+SF D VAAQLT
Sbjct  10   TRIPTNTSFPSKASHSFPTQCTSKRLEVNDFSGLRSTSCVTYASNARESSFFDTVAAQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
            PK  G+ PV+G TVAKL
Sbjct  70   PKTNGSTPVRGETVAKL  86



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 55/82 (67%), Gaps = 11/82 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS------TPQCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAA  212
            SRIP  TRL SKTS      T   FSKRLEV E+SGLRSSGCVTF  ++RE SF D  A 
Sbjct  11   SRIPANTRLVSKTSHYNSFPTQYSFSKRLEVDEYSGLRSSGCVTFATNSRETSFFDAAAV  70

Query  213  QLTPKATGA---PVKGVTVAKL  269
            QLTPK   A   PVKG TVAKL
Sbjct  71   QLTPKRQNAGSTPVKGETVAKL  92



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  221
            SRIP  TRL SK S       QC  KRL+VA+FSGLRSS  VTF+ REASF DV+AAQLT
Sbjct  10   SRIPASTRLASKASQQYSFLTQCSFKRLDVADFSGLRSSNSVTFT-REASFHDVIAAQLT  68

Query  222  PKATG-APVKGVTVAKL  269
             K TG APV+G TVAKL
Sbjct  69   TKPTGAAPVRGETVAKL  85



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  T LPSK++     QC +KRLEVAEFSGLRSS  VTF+    EASF DVVAAQLT
Sbjct  10   SRIPASTTLPSKSTHSFPTQCSTKRLEVAEFSGLRSSSRVTFARNVGEASFFDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKL  269
            PK  G+ PV+G TVAKL
Sbjct  70   PKTGGSTPVRGETVAKL  86



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 57/78 (73%), Gaps = 8/78 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQL  218
            SRIP+ TR  SK +    TP  F+KRLEVAEF GLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHVPPTPS-FTKRLEVAEFLGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  219  TPKATGA-PVKGVTVAKL  269
              K  GA PV+G TVAKL
Sbjct  69   ASKTVGASPVRGETVAKL  86



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 7/77 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSA-SLSFPNNGREGSFFDVVAAQLT  68

Query  222  PKATGA-PVKGVTVAKL  269
            PK  G+ PV+G TVAKL
Sbjct  69   PKVVGSTPVRGETVAKL  85



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK++     QC SKRLEVAEFSGLR+S C+T++    EASF D+VAAQ+ 
Sbjct  10   SRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASFFDLVAAQMA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK AT  P +  TVAKL
Sbjct  70   PKVATSTPTRAETVAKL  86



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQ---CFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQL-  218
            SRIP+ T   SK +      CFSKRLEVAEFSGLRSS CVTF  + R+ASFSDV+AAQL 
Sbjct  10   SRIPSNTWFHSKAAHSHPTSCFSKRLEVAEFSGLRSSACVTFATNGRDASFSDVLAAQLS  69

Query  219  TPKATGAPVKGVTVAKL  269
            T  A    VKG TVAKL
Sbjct  70   TETARAVLVKGETVAKL  86



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+  TV+KL
Sbjct  70   PKVAVSTPVRAETVSKL  86



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+  TV+KL
Sbjct  70   PKVAVSTPVRAETVSKL  86



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN-REASFSDVVAAQLTP  224
            +RIPT TRLPSKTS     +C SKRL VAEF+GLRS+   + +N RE SF D VAAQLTP
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSSKRLNVAEFNGLRSASLSSSNNGREGSFFDAVAAQLTP  69

Query  225  KATGA-PVKGVTVAKL  269
            KA  + PV+G TVAKL
Sbjct  70   KAVASTPVRGETVAKL  85



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR++  V+++    E SF DVVAAQ+T
Sbjct  10   SRIPASTRLPSKTTYSFPSQCSSKRLEVAEFSGLRATSHVSYAKNATEGSFFDVVAAQMT  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   P++  TVAKL
Sbjct  70   PKVAASTPIRAETVAKL  86



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 8/78 (10%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSA-SLSFPNNGREGSFFDVVAAQLT  68

Query  222  PKAT--GAPVKGVTVAKL  269
            PK      PV+G TVAKL
Sbjct  69   PKQVVGSTPVRGETVAKL  86



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 6/75 (8%)
 Frame = +3

Query  63   IPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK  227
            IP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL PK
Sbjct  34   IPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDMVASQLAPK  93

Query  228  -ATGAPVKGVTVAKL  269
             A   PV+  TV+KL
Sbjct  94   VAVSTPVRAETVSKL  108



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+  TVAKL
Sbjct  70   PKVAVSTPVRAETVAKL  86



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK +     Q  SKRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPATTRLPSKINRSFPTQSSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+  TVAKL
Sbjct  70   PKAAVSTPVRAETVAKL  86



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 5/74 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLTPK-  227
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKT  67

Query  228  ATGAPVKGVTVAKL  269
            A   PV+G TVAKL
Sbjct  68   ARAVPVRGETVAKL  81



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQL  218
            SRIP   R  SK++      QC SKR+E AEF+GLRSSGC+ +S    ++SF D VA+QL
Sbjct  10   SRIPVNPRFHSKSNVNSFHAQCSSKRVEFAEFAGLRSSGCMVYSKNGGDSSFFDAVASQL  69

Query  219  TPKAT-GAPVKGVTVAKL  269
            TPKA   APV+G TVAKL
Sbjct  70   TPKAVAAAPVRGETVAKL  87



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLTPK-  227
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKL  67

Query  228  --ATGAPVKGVTVAKL  269
              A   PV+G TVAKL
Sbjct  68   QTARAVPVRGETVAKL  83



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKL  269
            PK A   PV+  TVAKL
Sbjct  70   PKVAVSTPVRAETVAKL  86



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPKATG-APVKGVTVAKL  269
            QCFSKRLEVAEFSGLR+  CVT++    E SF D VAAQLTPK +  AP KG TVAKL
Sbjct  30   QCFSKRLEVAEFSGLRAGSCVTYAKNAGEGSFFDAVAAQLTPKTSAPAPAKGETVAKL  87



>gb|AAB23533.1| glyceraldehyde-3-phosphate-dehydrogenase subunit GapB, partial 
(chloroplast) [Arabidopsis thaliana]
Length=88

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 49/77 (64%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  PV+G TVAKL
Sbjct  66   KAVTTSTPVRGETVAKL  82



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKL  269
            PK  A   PVK  TVAKL
Sbjct  70   PKVAAGSVPVKKETVAKL  87



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 52/77 (68%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVNPRLQSKSAIHSFPAQCSSKRLEVAEFSGLR----VSNNGGEASFFDAIAAQITP  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  PV+G TVAKL
Sbjct  66   KAVTTSTPVRGETVAKL  82



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP + RL SK++      QC SKRLEVA FSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVKPRLQSKSAIHSFPAQCSSKRLEVAAFSGLR----VSSNGGEASFFDAIAAQITP  65

Query  225  KATG--APVKGVTVAKL  269
            KA G  +PV+G TVAKL
Sbjct  66   KAVGTSSPVRGETVAKL  82



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 3/58 (5%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKATGA-PVKGVTVAKL  269
            QC SKRLEV EFSGL+S+ CVT+  + RE+SF DVVAAQL+ K TG+ PV+G TVAKL
Sbjct  7    QCGSKRLEVPEFSGLKSTSCVTYAINARESSFYDVVAAQLSTKRTGSTPVRGETVAKL  64



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 49/77 (64%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  PV+G TVAKL
Sbjct  66   KAVTTSTPVRGETVAKL  82



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 50/77 (65%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     +  EASF D VAAQ+T 
Sbjct  10   SRIPVAQRLQSKSAVHSFPAQCSSKRLEVAEFSGLRMSS----NGGEASFFDAVAAQITA  65

Query  225  KATGA--PVKGVTVAKL  269
            KA  A  PV+G TVAKL
Sbjct  66   KAVTASTPVRGETVAKL  82



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     ++ EASF D VA+Q+T 
Sbjct  10   SRIPVAQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS----NSGEASFFDAVASQITT  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  P++G TVAKL
Sbjct  66   KAVTTSTPIRGETVAKL  82



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 48/77 (62%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      Q  SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQWSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  PV+G TVAKL
Sbjct  66   KAVTTSTPVRGETVAKL  82



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   TRLPSKTS-TPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG  251
            +R+P+  + T QCFSKR+EV +FSGL+SS  ++F+ +E SF D VA +L   ++  PVKG
Sbjct  9    SRIPATPAFTSQCFSKRVEVGDFSGLKSSRGLSFAAKEVSFFDAVAPKLAGPSSSPPVKG  68

Query  252  VTVAKL  269
             TVAKL
Sbjct  69   ETVAKL  74



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 10/77 (13%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRL+VAEFSGLR+S     ++ +ASF D + AQ+  
Sbjct  10   SRIPANPRLQSKSAIHSFPAQCSSKRLQVAEFSGLRASN----NSGDASFFDAIVAQIAS  65

Query  225  KA--TGAPVKGVTVAKL  269
            KA  T  PV+G TVAKL
Sbjct  66   KAVTTSTPVRGETVAKL  82



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = +3

Query  117  KRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK-ATGAPVKGVTVAKL  269
            +RLEVAEFSGLR+S CVT++    E SF DVVA+QL PK A   PV+  TVAKL
Sbjct  2    QRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLAPKVAVSTPVRAETVAKL  55



>gb|ABF93790.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=207

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 5/61 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  234  G  236
            G
Sbjct  66   G  66



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSK--RLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA  230
            SRIP   R+ SK++     ++  RLEVA+FSGLR S     +  EASF D VAAQ+T KA
Sbjct  10   SRIPVTQRVQSKSAIHSFPAQXPRLEVADFSGLRMSS----NGGEASFFDAVAAQITAKA  65

Query  231  TGA--PVKGVTVAKL  269
              A  PV+G TVAKL
Sbjct  66   VTASTPVRGETVAKL  80



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 5/61 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  234  G  236
            G
Sbjct  66   G  66



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  G  236
            G
Sbjct  66   G  66



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKL  269
            G   V+    AKL
Sbjct  66   GENAVRAPAEAKL  78



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIPT  RL S+ ++ Q    R++ A+FSGLR   C V+ + REASF DV+ AQL  KAT
Sbjct  10   SRIPTSARLNSRAASRQ----RVDFADFSGLRPGSCSVSTAAREASFYDVLGAQLVAKAT  65

Query  234  GA-PVKGVTVAKL  269
            G   V+    AKL
Sbjct  66   GENAVRAPAEAKL  78



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-STPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKA  230
            SRIP   RL S+  ++ +   +RL+ A+FSGLR   C V+ + REASFSDV+ AQL  KA
Sbjct  10   SRIPAGARLHSRAPASSRHGVQRLDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVAKA  69

Query  231  TG  236
            TG
Sbjct  70   TG  71



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL S+ ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSRAASKQ----RVDFADFSGLRPGSCSVSHAAREASFSDVLGSQLVARAT  65

Query  234  GA-PVKGVTVAKL  269
            G   V+    AKL
Sbjct  66   GENAVRAPAEAKL  78



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 5/61 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  G  236
            G
Sbjct  66   G  66



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKL  269
            G   V+    AKL
Sbjct  66   GENAVRAPAEAKL  78



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 5/74 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVT--FSNREASFSDVVAAQLTPKA  230
            SRIPT      K ++ +   +RL++A+FSGLR   C     + REASFSDV+ AQL  +A
Sbjct  10   SRIPTGRLQHGKAASSKL--QRLDLADFSGLRPGSCSVSVAATREASFSDVLGAQLVARA  67

Query  231  TGA-PVKGVTVAKL  269
            +G   V+    AKL
Sbjct  68   SGENAVRAPAEAKL  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563612653200