BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002K14

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU39465.1|  hypothetical protein MIMGU_mgv1a011231mg              55.1    2e-06   Erythranthe guttata [common monkey flower]
gb|AGH32912.1|  biotin carboxyl carrier protein subunit               50.1    1e-04   Camellia chekiangoleosa



>gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Erythranthe guttata]
Length=288

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 54/97 (56%), Gaps = 6/97 (6%)
 Frame = +2

Query  152  NVLNSSKCLPLFRHHYS-----QSHPklklklrfssskdlHSNWNHSVVAKAQLNKVSVD  316
            N   SS CLPL RH +S      +    +L  R        + WN S + KAQLN+V+VD
Sbjct  19   NAHKSSTCLPLGRHRHSFLRSNSNKVSFRLSPRSRLHFSSKTGWNCSAMIKAQLNEVAVD  78

Query  317  GSSNAAPGTPPELEVSSA-SNDVKLSSETSPAVLASE  424
            GS  AA  T  + E+ S  + DVKLS+E+ P VLA+E
Sbjct  79   GSPKAAASTASKSELLSVEAKDVKLSNESPPTVLATE  115



>gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa]
Length=283

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  257  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPELEVSSAS-NDVKLSSETSPAVLASE  424
             S+WN S V KAQLN+V+VD SSNAA  TP + EV +A   D K SS  SPA LASE
Sbjct  51   QSSWNRSNVIKAQLNEVAVDESSNAA-STPTKSEVPAAEPKDAKPSSVPSPAALASE  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175