BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002J03

Length=263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...  77.0    5e-14   Solanum lycopersicum
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...  75.9    1e-13   Solanum tuberosum [potatoes]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...  75.9    2e-13   Dimocarpus longan [longan]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...  75.1    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...  75.1    2e-13   Nicotiana tomentosiformis
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...  73.2    1e-12   Sesamum indicum [beniseed]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...  72.8    2e-12   Nicotiana sylvestris
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...  72.4    2e-12   Sesamum indicum [beniseed]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...  71.6    4e-12   Solanum peruvianum [Peruvian tomato]
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...  71.6    4e-12   Solanum lycopersicum
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...  71.6    4e-12   Solanum tuberosum [potatoes]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                 71.2    5e-12   Citrus sinensis [apfelsine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    5e-12   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg           71.2    5e-12   Citrus clementina [clementine]
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...  71.2    6e-12   Solanum pennellii
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...  70.1    1e-11   Morus notabilis
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg              69.7    2e-11   Erythranthe guttata [common monkey flower]
emb|CBI35733.3|  unnamed protein product                              68.2    6e-11   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...  68.2    6e-11   Vitis vinifera
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265           67.8    8e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...  67.8    8e-11   Cucumis sativus [cucumbers]
emb|CDP02660.1|  unnamed protein product                              67.4    1e-10   Coffea canephora [robusta coffee]
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...  67.0    1e-10   Nicotiana tomentosiformis
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...  66.2    3e-10   Nicotiana sylvestris
gb|EPS74129.1|  hypothetical protein M569_00625                       63.2    3e-09   Genlisea aurea
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein       62.8    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg           61.6    1e-08   Capsella rubella
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg           61.6    1e-08   Prunus persica
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...  58.5    1e-07   Cucumis sativus [cucumbers]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  58.5    1e-07   
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...  58.5    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...  58.5    1e-07   Cucumis melo [Oriental melon]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g           57.8    2e-07   Phaseolus vulgaris [French bean]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g           57.8    2e-07   Phaseolus vulgaris [French bean]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor         57.8    2e-07   
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg           57.4    3e-07   
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...  57.4    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...  57.4    3e-07   
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...  57.4    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  57.0    4e-07   
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12              57.0    4e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                  56.6    5e-07   Arabis alpina [alpine rockcress]
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...  55.8    9e-07   Fragaria vesca subsp. vesca
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg           55.1    2e-06   
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...  55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...  54.7    2e-06   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807           54.7    2e-06   
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...  54.7    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...  54.7    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...  54.7    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg           54.7    3e-06   Capsella rubella
gb|AES94465.2|  LRR receptor-like kinase family protein               54.7    3e-06   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                     54.7    3e-06   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...  54.3    3e-06   
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...  53.9    4e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW55761.1|  hypothetical protein EUGRSUZ_I01593                   53.5    6e-06   Eucalyptus grandis [rose gum]
ref|XP_003608587.1|  Receptor-like protein kinase                     53.1    8e-06   Medicago truncatula
ref|XP_010028929.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    9e-06   Eucalyptus grandis [rose gum]
gb|KDO45983.1|  hypothetical protein CISIN_1g001566mg                 53.1    9e-06   Citrus sinensis [apfelsine]
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...  53.1    9e-06   
ref|XP_006446913.1|  hypothetical protein CICLE_v10014114mg           53.1    9e-06   Citrus clementina [clementine]
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                  52.8    1e-05   Arabis alpina [alpine rockcress]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g           52.8    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    1e-05   Camelina sativa [gold-of-pleasure]
ref|NP_001237688.1|  receptor-like protein kinase precursor           52.8    1e-05   Glycine max [soybeans]
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...  52.4    1e-05   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg           52.4    2e-05   
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...  52.0    2e-05   Camelina sativa [gold-of-pleasure]
gb|EAY72573.1|  hypothetical protein OsI_00439                        52.0    2e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001042048.1|  Os01g0152800                                     51.6    2e-05   
gb|EEE53890.1|  hypothetical protein OsJ_00410                        51.6    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...  51.6    3e-05   Cucumis melo [Oriental melon]
ref|XP_006468910.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    3e-05   Citrus sinensis [apfelsine]
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g           51.2    4e-05   Populus trichocarpa [western balsam poplar]
gb|KJB18115.1|  hypothetical protein B456_003G034500                  50.8    5e-05   Gossypium raimondii
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...  50.8    5e-05   Populus euphratica
gb|KCW60106.1|  hypothetical protein EUGRSUZ_H02840                   50.4    6e-05   Eucalyptus grandis [rose gum]
ref|XP_010026765.1|  PREDICTED: probable LRR receptor-like serine...  50.4    6e-05   
gb|KCW71733.1|  hypothetical protein EUGRSUZ_E00240                   50.4    7e-05   Eucalyptus grandis [rose gum]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200        50.4    7e-05   
ref|XP_007048749.1|  Leucine-rich repeat receptor-like protein ki...  49.3    8e-05   
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor         50.1    8e-05   Glycine max [soybeans]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...  50.1    9e-05   
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...  50.1    9e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...  50.1    1e-04   Gossypium arboreum [tree cotton]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...  49.7    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...  49.7    1e-04   Tarenaya hassleriana [spider flower]
gb|EEC81438.1|  hypothetical protein OsI_24717                        49.7    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    1e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ38534.1|  hypothetical protein OsJ_22922                        49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC10827.1|  putative protein kinase Xa21, receptor type prec...  49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058786.2|  Os07g0121200                                     49.3    2e-04   
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...  48.9    2e-04   Cicer arietinum [garbanzo]
gb|EMT21833.1|  Putative LRR receptor-like serine/threonine-prote...  48.9    2e-04   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  48.9    2e-04   Populus euphratica
gb|KJB73885.1|  hypothetical protein B456_011G258600                  48.5    3e-04   Gossypium raimondii
gb|KJB18113.1|  hypothetical protein B456_003G034400                  48.5    3e-04   Gossypium raimondii
gb|KDP32143.1|  hypothetical protein JCGZ_12604                       48.5    3e-04   Jatropha curcas
gb|KJB48795.1|  hypothetical protein B456_008G087500                  48.5    3e-04   Gossypium raimondii
ref|XP_010068080.1|  PREDICTED: putative receptor-like protein ki...  48.1    3e-04   
ref|XP_007048745.1|  Leucine-rich repeat receptor protein kinase ...  48.1    3e-04   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...  48.1    3e-04   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                   48.1    4e-04   Eucalyptus grandis [rose gum]
ref|NP_001045978.1|  Os02g0161700                                     48.1    4e-04   
ref|XP_010682896.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    4e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ21833.1|  hypothetical protein OsJ_05479                        47.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD25211.1|  putative Hcr2-5B                                     47.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor         47.8    5e-04   Glycine max [soybeans]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...  47.8    5e-04   Gossypium arboreum [tree cotton]
gb|EMT30323.1|  Putative LRR receptor-like serine/threonine-prote...  47.8    5e-04   
ref|XP_007141641.1|  hypothetical protein PHAVU_008G213200g           47.8    5e-04   Phaseolus vulgaris [French bean]
ref|XP_002459536.1|  hypothetical protein SORBIDRAFT_02g006250        47.8    5e-04   
ref|XP_002446181.1|  hypothetical protein SORBIDRAFT_06g003120        47.8    5e-04   Sorghum bicolor [broomcorn]
gb|KCW62804.1|  hypothetical protein EUGRSUZ_G003951                  46.2    6e-04   Eucalyptus grandis [rose gum]
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...  47.4    6e-04   Elaeis guineensis
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...  47.4    6e-04   
ref|XP_006307391.1|  hypothetical protein CARUB_v10009017mg           47.0    7e-04   Capsella rubella
gb|EEE56354.1|  hypothetical protein OsJ_05477                        47.4    7e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010064755.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    7e-04   
gb|KCW68458.1|  hypothetical protein EUGRSUZ_F02118                   47.0    7e-04   Eucalyptus grandis [rose gum]
ref|XP_007214468.1|  hypothetical protein PRUPE_ppa023770mg           46.2    8e-04   
gb|KJB73887.1|  hypothetical protein B456_011G258900                  46.6    8e-04   Gossypium raimondii
gb|KDP44797.1|  hypothetical protein JCGZ_01297                       47.0    9e-04   Jatropha curcas
ref|XP_007213538.1|  hypothetical protein PRUPE_ppa019671mg           45.8    9e-04   



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDL
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDL  75



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  98   GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
             KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+
Sbjct  23   AKPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDI  77



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  98   GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
             KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+
Sbjct  23   AKPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDI  77



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDL  70



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDL
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDL  78



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  89   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNI  76



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  89   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDI  74



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDI  75



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 4/64 (6%)
 Frame = +2

Query  74   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVV  250
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD S  HV 
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  251  SLDL  262
            +LD+
Sbjct  73   ALDI  76



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSL  256
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  257  DL  262
            D+
Sbjct  71   DI  72



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSL  256
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  257  DL  262
            D+
Sbjct  72   DI  73



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSL  256
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  257  DL  262
            D+
Sbjct  72   DI  73



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDL
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDL  69



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDL
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDL  69



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDL
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDL  71



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDI  73



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  110  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
             V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDL
Sbjct  25   AVPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDL  75



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  83   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLD  259
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD S   V SLD
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  260  L  262
            +
Sbjct  76   I  76



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+L
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNL  94



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+L
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNL  75



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 3/56 (5%)
 Frame = +2

Query  98   GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
             KP  +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD SL HV SLDL
Sbjct  22   AKP--ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDL  75



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDL  75



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS   HV +LD+
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDI  74



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDI  74



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  89   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCDSLLHVVSLDL  262
            + A KP  + E  ALLS+K A + D QS+L SWN S  TSHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVS  253
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL  HV  
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  254  LDL  262
            LD+
Sbjct  75   LDI  77



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD SL HV SLDL
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDL  76



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD S  HV SLDL
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDL  72



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDL
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDL  71



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCDSLLHVVSLDL  262
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDL
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDL  90



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCDSLLHVVSLDL  262
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDL
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDL  90



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 6/54 (11%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---DSLLH---VVSLDL  262
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C    SL H   VVSL++
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNI  77



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCDSLLHVVSLDL  262
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDL
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDL  88



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  107  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNL  69



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNL  76



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDL  74



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 6/60 (10%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD S  HV SLDL
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSL  256
            S  AGA     +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCD S  +V SL
Sbjct  15   SLSAGA-----MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSL  69

Query  257  DL  262
            DL
Sbjct  70   DL  71



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSL  256
            S  AGA     +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCD S  +V SL
Sbjct  15   SLSAGA-----MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSL  69

Query  257  DL  262
            DL
Sbjct  70   DL  71



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  107  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCD S  +V SLDL
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDL  72



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  107  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCD S  +V SLDL
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDL  72



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 10/63 (16%)
 Frame = +2

Query  101  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH---------VVS  253
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC    H         V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  254  LDL  262
            LD+
Sbjct  80   LDI  82



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 7/60 (12%)
 Frame = +2

Query  98   GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD S  HV SLDL
Sbjct  20   GKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLDL  77



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +2

Query  128  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDL
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDL  81



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 6/60 (10%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD S  HV SLDL
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 6/60 (10%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            A +P  ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  19   ASRP--ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDL  76



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNL  72



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDL  76



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDL  77



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDL  77



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDL  77



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD S  HV SLDL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDL  77



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNL  74



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNL  74



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  107  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCD S  +V SLDL
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDL  72



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC  229
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITC  89



>gb|KCW55761.1| hypothetical protein EUGRSUZ_I01593 [Eucalyptus grandis]
Length=1028

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  128  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDS  235
            +LLS K++ +AD    L+ WN+STSHCTWR VTCD+
Sbjct  2    SLLSFKSSVSADPAGLLSGWNVSTSHCTWRGVTCDA  37



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNL  74



>ref|XP_010028929.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RPK2 [Eucalyptus grandis]
Length=1056

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  131  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDS  235
            LLS K++ +AD    L+ WN+STSHCTWR VTCD+
Sbjct  31   LLSFKSSVSADPAGLLSGWNVSTSHCTWRGVTCDA  65



>gb|KDO45983.1| hypothetical protein CISIN_1g001566mg [Citrus sinensis]
 gb|KDO45984.1| hypothetical protein CISIN_1g001566mg [Citrus sinensis]
Length=1052

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            S GA A + +  T+ A+LLS KA+ + D  + L +WN ST HCTW  VTCD
Sbjct  37   SGGANA-ESVPTTDSASLLSFKASISRDPSNLLATWNSSTDHCTWHGVTCD  86



>ref|XP_008225333.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1522

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH--VVS  253
            S G GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +  H  VVS
Sbjct  19   SIGTGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARRHLRVVS  78

Query  254  LDL  262
            L+L
Sbjct  79   LNL  81



>ref|XP_006446913.1| hypothetical protein CICLE_v10014114mg [Citrus clementina]
 gb|ESR60153.1| hypothetical protein CICLE_v10014114mg [Citrus clementina]
Length=1051

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            S GA A + +  T+ A+LLS KA+ + D  + L +WN ST HCTW  VTCD
Sbjct  37   SGGANA-ESVPTTDSASLLSFKASISRDPSNLLATWNSSTDHCTWHGVTCD  86



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +2

Query  95   AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCD-SLLHV  247
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD SL HV
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHV  67



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V SLDL
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDL  78



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSS-LTSWNIS-TSHCTWRRVTCD-SLLHVVSLDL  262
            +TE  ALLS+K++ T D  S  L+SWN+S T+ C+W  VTCD S  HV SLDL
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDL  74



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNL  69



>ref|XP_008791706.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Phoenix 
dactylifera]
Length=994

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            +T+Q ALLS K   T+D    L+SWN ST+ C W RV C++   V +LDL
Sbjct  18   ITDQEALLSFKTLITSDPSDVLSSWNDSTTVCQWSRVLCNNKRRVSTLDL  67



>ref|XP_007214129.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
 gb|EMJ15328.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
Length=1216

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  92   GAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            GA K    T+Q+ALL++++  T+D Q+ L +W+ STS C W  VTC +  L VVSL+L
Sbjct  251  GAAKTNITTDQSALLAMRSHITSDPQNILVNWSTSTSVCNWVGVTCGARHLRVVSLNL  308



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSS-LTSWNIS-TSHCTWRRVTCD-SLLHVVSLDL  262
            +TE  ALLS+K++ T D  S  L+SWN+S T+ C+W  VTCD S  HV SLDL
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDL  75



>gb|EAY72573.1| hypothetical protein OsI_00439 [Oryza sativa Indica Group]
Length=1051

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCD  71



>ref|NP_001042048.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAD61117.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAD61339.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAF03962.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAG95699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1051

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCD  71



>gb|EEE53890.1| hypothetical protein OsJ_00410 [Oryza sativa Japonica Group]
Length=1014

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCD  71



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSS-LTSWNI-STSHCTWRRVTCD-SLLHVVSLDL  262
            +TE  ALLS+K++ T D  S  LTSWN+ ST+ C+W  V CD S  HV SLDL
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDL  75



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  167  QSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            +SSL SWN STSHCTW  VTCD   HV +LDL
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDL  33



>ref|XP_006468910.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RPK2-like isoform X1 [Citrus sinensis]
 ref|XP_006468911.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RPK2-like isoform X2 [Citrus sinensis]
Length=1052

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   GAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            G    +    T+ A+LLS KA+ + D  + L +WN ST HCTW  VTCD
Sbjct  38   GGANAESAPTTDSASLLSFKASISRDPSNLLATWNSSTDHCTWHGVTCD  86



>ref|XP_006382632.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
 gb|ERP60429.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
Length=1060

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            T++ ALLS+K+  T D  ++L+SWN S+S C W RV+C+ +   V+ LDL
Sbjct  68   TDKEALLSLKSQVTTDPSNTLSSWNNSSSPCNWTRVSCNQVNQRVIGLDL  117



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD +  HV S+DL
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDL  77



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V SLDL
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDL  78



>gb|KCW60106.1| hypothetical protein EUGRSUZ_H02840, partial [Eucalyptus grandis]
Length=968

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL-HVVSLDL  262
            +T++ ALL+ KAA T D    L+SWN +T HC W  VTC  L   V  LDL
Sbjct  1    MTDKLALLAFKAAMTEDPYGVLSSWNDTTDHCQWSGVTCSRLYGSVTRLDL  51



>ref|XP_010026765.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=987

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL-HVVSLDL  262
            +T++ ALL+ KAA T D    L+SWN +T HC W  VTC  L   V  LDL
Sbjct  1    MTDKLALLAFKAAMTEDPYGVLSSWNDTTDHCQWSGVTCSRLYGSVTRLDL  51



>gb|KCW71733.1| hypothetical protein EUGRSUZ_E00240, partial [Eucalyptus grandis]
Length=961

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L H V  LDL
Sbjct  14   ITDKLALLAFKATITMDPFEALNSWNHTTDHCQWHGVMCGRLHHRVTGLDL  64



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD S  HVVSLDL
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDL  75



>ref|XP_007048749.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
 gb|EOX92906.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
Length=361

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLD  259
            ++   A  P+GVTE  ALL  KA+   +SQS+L+SW + T  CTW  + C S   +  L+
Sbjct  26   ASSISATAPVGVTEVEALLVWKASLDKESQSTLSSW-VGTRPCTWIGIICGSFGSITHLN  84

Query  260  L  262
            L
Sbjct  85   L  85



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNL  74



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +2

Query  89   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            + A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD +  HV S+DL
Sbjct  17   SSAARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDL  73



>ref|XP_010690942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Beta vulgaris subsp. vulgaris]
Length=1030

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            T+Q ALL +K+  T D    ++SWN +   CTW  VTCD + H V++LDL
Sbjct  29   TDQKALLEMKSKITHDPLGVMSSWNDNLPFCTWHGVTCDRVHHRVIALDL  78



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD +  HV S+DL
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDL  77



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLD  259
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  260  L  262
            L
Sbjct  76   L  76



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 7/60 (12%)
 Frame = +2

Query  98   GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            G+P  ++E  ALLSIK++ +      + S L +WN ST+ C W  VTCD S  HV+SLDL
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79



>gb|EEC81438.1| hypothetical protein OsI_24717 [Oryza sativa Indica Group]
Length=812

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            T+ A+LL  K A T D   +++SWN +T  C W+ VTCD   H VV+LDL
Sbjct  37   TDLASLLDFKRAITNDPFGAMSSWNTNTHLCRWKGVTCDQRAHRVVALDL  86



>ref|XP_010676066.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Beta vulgaris subsp. vulgaris]
Length=853

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC  229
            ++E+ ALLSIK+A T D  +SL+SW  +T HC+W  +TC
Sbjct  24   LSERQALLSIKSAITYDPFNSLSSWKNTTHHCSWPYITC  62



>gb|EAZ38534.1| hypothetical protein OsJ_22922 [Oryza sativa Japonica Group]
Length=1017

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            T+ A+LL  K A T D   +++SWN +T  C W+ VTCD   H VV+LDL
Sbjct  37   TDLASLLDFKRAITNDPFGAMSSWNTNTHLCRWKGVTCDQRAHRVVALDL  86



>dbj|BAC10827.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
 dbj|BAD30948.1| putative protein kinase Xa21, receptor type precursor [Oryza 
sativa Japonica Group]
Length=1016

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            T+ A+LL  K A T D   +++SWN +T  C W+ VTCD   H VV+LDL
Sbjct  37   TDLASLLDFKRAITNDPFGAMSSWNTNTHLCRWKGVTCDQRAHRVVALDL  86



>ref|NP_001058786.2| Os07g0121200 [Oryza sativa Japonica Group]
 dbj|BAF20700.2| Os07g0121200 [Oryza sativa Japonica Group]
Length=1134

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
            T+ A+LL  K A T D   +++SWN +T  C W+ VTCD   H VV+LDL
Sbjct  154  TDLASLLDFKRAITNDPFGAMSSWNTNTHLCRWKGVTCDQRAHRVVALDL  203



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 2/52 (4%)
 Frame = +2

Query  113  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCDS-LLHVVSLDL  262
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DL
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDL  73



>gb|EMT21833.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1007

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL--HVVSLDL  262
            ++ ALLS K++ ++D +  L+SW+ STS C+WR VTC   L   VVSL+L
Sbjct  42   DRQALLSFKSSISSDPRGVLSSWSTSTSFCSWRGVTCGITLPTRVVSLNL  91



>ref|XP_011036960.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1022

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            T++ ALLS+K+  T D  ++L SWN ++S C W RV+C+ +   VV LDL
Sbjct  37   TDKEALLSLKSQVTTDPSNTLFSWNNNSSPCNWTRVSCNQVNQRVVGLDL  86



>gb|KJB73885.1| hypothetical protein B456_011G258600 [Gossypium raimondii]
Length=988

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            VT+Q ALL  KA  T D    + SWN S+  C WR VTCD
Sbjct  15   VTDQLALLQFKAKITGDQLKIMESWNSSSHFCQWRGVTCD  54



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD +  HV S+DL
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDL  77



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCD  61



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVSLDL  262
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD +  HV SL+L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNL  74



>ref|XP_010068080.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=530

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 29/51 (57%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            +T++ ALL+ KA  T D    L SWN +T HC W  V CD L   V  LDL
Sbjct  1    MTDKLALLAFKATITMDPFGVLNSWNHTTDHCRWHGVMCDRLHRRVTGLDL  51



>ref|XP_007048745.1| Leucine-rich repeat receptor protein kinase family protein [Theobroma 
cacao]
 gb|EOX92902.1| Leucine-rich repeat receptor protein kinase family protein [Theobroma 
cacao]
Length=1026

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLD  259
            ++   A  P+GVTE  ALL  KA+   +SQS+L+SW   T  CTW  + C S   +  L+
Sbjct  69   ASSRSATAPVGVTEVEALLLWKASLDKESQSTLSSW-FGTRPCTWVGIRCGSFGSITHLN  127

Query  260  L  262
            L
Sbjct  128  L  128



>ref|XP_010058160.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=757

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            +T++ ALL+ KAA T D   +L SWN +T HC W  V C  L   V  LDL
Sbjct  1    MTDKLALLAFKAAITMDPFGALNSWNHTTDHCQWHGVMCGRLHRRVTRLDL  51



>gb|KCW71731.1| hypothetical protein EUGRSUZ_E00238, partial [Eucalyptus grandis]
Length=935

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            +T++ ALL+ KAA T D   +L SWN +T HC W  V C  L   V  LDL
Sbjct  1    MTDKLALLAFKAAITMDPFGALNSWNHTTDHCQWHGVMCGRLHRRVTRLDL  51



>ref|NP_001045978.1| Os02g0161700 [Oryza sativa Japonica Group]
 dbj|BAF07892.1| Os02g0161700 [Oryza sativa Japonica Group]
Length=735

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            TE  ALL  K+    D+ +SL+SW+I+ S C+W  VTCD+  HV  LDL
Sbjct  13   TEAEALLRWKSTLI-DATNSLSSWSIANSTCSWFGVTCDAAGHVTELDL  60



>ref|XP_010682896.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RPK2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010682897.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RPK2 [Beta vulgaris subsp. vulgaris]
Length=1046

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL-HVVSLDL  262
            + AALL+ K+A + D  + L++W+ +T HC WR ++CDS+   VVSL+L
Sbjct  24   DAAALLTFKSAISHDPYNLLSNWSPATHHCYWRGISCDSVNGRVVSLNL  72



>gb|EAZ21833.1| hypothetical protein OsJ_05479 [Oryza sativa Japonica Group]
Length=744

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            TE  ALL  K+    D+ +SL+SW+I+ S C+W  VTCD+  HV  LDL
Sbjct  13   TEAEALLRWKSTLI-DATNSLSSWSIANSTCSWFGVTCDAAGHVTELDL  60



>dbj|BAD25211.1| putative Hcr2-5B [Oryza sativa Japonica Group]
Length=754

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 1/62 (2%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSL  256
            HS           TE  ALL  K+    D+ +SL+SW+I+ S C+W  VTCD+  HV  L
Sbjct  19   HSTTKATDDSGAETEAEALLRWKSTLI-DATNSLSSWSIANSTCSWFGVTCDAAGHVTEL  77

Query  257  DL  262
            DL
Sbjct  78   DL  79



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +2

Query  113  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCDSLLHV  247
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHV  64



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 6/63 (10%)
 Frame = +2

Query  77   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD-SLLHVVS  253
            H +GA       V E  ALL++K++ T D QS L++WN +   C++  VTCD +  HV S
Sbjct  17   HCSGART-----VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTS  71

Query  254  LDL  262
            LDL
Sbjct  72   LDL  74



>gb|EMT30323.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1004

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL--HVVSLDL  262
            ++ ALLS K + T+D +  L+SWN S S C+WR VTC   L   V+SL+L
Sbjct  42   DRQALLSFKESITSDPRQVLSSWNHSISFCSWRGVTCGITLPTRVISLNL  91



>ref|XP_007141641.1| hypothetical protein PHAVU_008G213200g [Phaseolus vulgaris]
 gb|ESW13635.1| hypothetical protein PHAVU_008G213200g [Phaseolus vulgaris]
Length=1023

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            V E  ALL  KA+    SQ+SL+SW    SHC W+ + CD    V ++++
Sbjct  36   VREAGALLEWKASLENQSQASLSSWRRGVSHCNWKEIICDKSNFVTTINV  85



>ref|XP_002459536.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor]
 gb|EER96057.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor]
Length=1036

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH---VVSLDL  262
            ++ ALL+ KA F++DS  +L SWN STS+C+W  VTC S  H   VV+LDL
Sbjct  39   DERALLAFKAKFSSDS-GALASWNQSTSYCSWDGVTC-SRRHRWRVVALDL  87



>ref|XP_002446181.1| hypothetical protein SORBIDRAFT_06g003120 [Sorghum bicolor]
 gb|EES10509.1| hypothetical protein SORBIDRAFT_06g003120 [Sorghum bicolor]
Length=987

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 29/51 (57%), Gaps = 3/51 (6%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLL---HVVSLDL  262
            E  ALL+ K   T D   +L++WNIS S CTW  V C   L    VVSLDL
Sbjct  36   ELQALLNFKQGITNDPSGALSTWNISGSFCTWSGVVCGKALPPSRVVSLDL  86



>gb|KCW62804.1| hypothetical protein EUGRSUZ_G003951, partial [Eucalyptus grandis]
Length=215

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL  238
            +T++ ALL+ KA  T D    L SWN +T HC W  V CD L
Sbjct  1    MTDKLALLAFKATITMDPFGVLNSWNHTTDHCRWHGVMCDRL  42



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 7/64 (11%)
 Frame = +2

Query  89   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCDSLL-HVV  250
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  VV
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  251  SLDL  262
            SLDL
Sbjct  84   SLDL  87



>ref|XP_010026767.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=948

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL  238
            +T++ ALL+ KA  T D   +L SWN +T+HC W  VTC  L
Sbjct  1    MTDKLALLAFKATITEDPFEALNSWNHTTNHCRWHGVTCGCL  42



>ref|XP_006307391.1| hypothetical protein CARUB_v10009017mg [Capsella rubella]
 gb|EOA40289.1| hypothetical protein CARUB_v10009017mg [Capsella rubella]
Length=478

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 33/61 (54%), Gaps = 3/61 (5%)
 Frame = +2

Query  80   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLD  259
            S GA    P    ++A LL+ KA  T D    L+SWN ST  C+W+ VTC +   V  L+
Sbjct  22   STGAATCHP---DDEAGLLAFKAGITQDPSGMLSSWNKSTPCCSWKGVTCLNSDRVTILE  78

Query  260  L  262
            L
Sbjct  79   L  79



>gb|EEE56354.1| hypothetical protein OsJ_05477 [Oryza sativa Japonica Group]
Length=809

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            TE  ALL  K+    D+ +SL+SW+I+ S C+W  VTCD+  HV  LDL
Sbjct  24   TEAEALLRWKSTLI-DATNSLSSWSIANSTCSWFGVTCDAAGHVTELDL  71



>ref|XP_010064755.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=704

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  119  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            E  ALL+ K+   ++S+ +L+SWN  TS C+WR + CD L  VVSL+L
Sbjct  49   EVEALLTWKSKLDSESRYNLSSWN-GTSPCSWRGIDCDPLGSVVSLNL  95



>gb|KCW68458.1| hypothetical protein EUGRSUZ_F02118 [Eucalyptus grandis]
Length=685

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +2

Query  89   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLHVVSLDL  262
            AGAGK     E  ALL+ K+A  + S  +L+SWN  ++ C W  + CD L  +VSL+L
Sbjct  39   AGAGKQTVNEELEALLTWKSALDSQSHCALSSWN-GSNPCLWHGIDCDPLGSIVSLNL  95



>ref|XP_007214468.1| hypothetical protein PRUPE_ppa023770mg, partial [Prunus persica]
 gb|EMJ15667.1| hypothetical protein PRUPE_ppa023770mg, partial [Prunus persica]
Length=300

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  116  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            T+QAALL++++  T+D  + L +W+ +TS C W  VTC +  L V SL+L
Sbjct  38   TDQAALLALRSHITSDPHNILVNWSTTTSFCNWVGVTCGARHLRVASLNL  87



>gb|KJB73887.1| hypothetical protein B456_011G258900 [Gossypium raimondii]
Length=411

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = +2

Query  113  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCD  232
            VT+Q ALL  KA  T D    + SWN S+  C WR V CD
Sbjct  51   VTDQLALLQFKAKITGDQLKIMESWNSSSHFCQWRGVACD  90



>gb|KDP44797.1| hypothetical protein JCGZ_01297 [Jatropha curcas]
Length=1977

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query  116   TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSLLH-VVSLDL  262
             T+Q ALLS+K+  T+D    + SWN +T  C W  VTC  L   V+ LDL
Sbjct  1038  TDQVALLSLKSKITSDPFDVMQSWNATTHFCQWHGVTCGHLHQRVIMLDL  1087



>ref|XP_007213538.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
 gb|EMJ14737.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
Length=249

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  92   GAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCDSL-LHVVSLDL  262
            GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +  L VVSL+L
Sbjct  23   GAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARHLRVVSLNL  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569309995650