BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002I20

Length=359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07384.1|  unnamed protein product                                167   9e-46   Coffea canephora [robusta coffee]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     166   2e-45   
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                164   2e-44   Erythranthe guttata [common monkey flower]
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                162   8e-44   Erythranthe guttata [common monkey flower]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     160   4e-43   Solanum tuberosum [potatoes]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     160   5e-43   Solanum lycopersicum
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     159   1e-42   Nicotiana tomentosiformis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     159   2e-42   Nicotiana sylvestris
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     156   3e-42   Nicotiana tomentosiformis
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     157   8e-42   Nicotiana sylvestris
dbj|BAL42332.1|  Heat shock protein 90                                  157   8e-42   Nicotiana tabacum [American tobacco]
dbj|BAL42333.1|  Heat shock protein 90                                  157   9e-42   Nicotiana tabacum [American tobacco]
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    156   2e-41   Catharanthus roseus [chatas]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     155   5e-41   Vitis vinifera
emb|CAN79404.1|  hypothetical protein VITISV_028074                     154   2e-40   Vitis vinifera
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         151   8e-40   Jatropha curcas
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     150   2e-39   Sesamum indicum [beniseed]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     149   8e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     148   1e-38   Tarenaya hassleriana [spider flower]
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   145   1e-38   Citrus sinensis [apfelsine]
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   145   2e-38   Citrus sinensis [apfelsine]
ref|XP_010109992.1|  Endoplasmin-like protein                           148   2e-38   
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             147   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     147   3e-38   Populus euphratica
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          147   3e-38   Cicer arietinum [garbanzo]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          147   3e-38   Cicer arietinum [garbanzo]
ref|XP_002510550.1|  endoplasmin, putative                              147   4e-38   Ricinus communis
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   146   5e-38   Citrus sinensis [apfelsine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     146   5e-38   Citrus sinensis [apfelsine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   146   5e-38   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             146   5e-38   Citrus clementina [clementine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     146   6e-38   
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          145   1e-37   Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          145   1e-37   Glycine max [soybeans]
ref|XP_003589505.1|  Endoplasmin-like protein                           145   2e-37   Medicago truncatula
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    144   3e-37   
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     144   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          144   4e-37   Glycine max [soybeans]
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     144   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          144   4e-37   
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     143   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     142   1e-36   Fragaria vesca subsp. vesca
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     142   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     142   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             142   2e-36   Prunus persica
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     141   3e-36   Prunus mume [ume]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             140   7e-36   Phaseolus vulgaris [French bean]
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     140   9e-36   Eucalyptus grandis [rose gum]
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     140   1e-35   Elaeis guineensis
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     139   2e-35   Elaeis guineensis
gb|AIZ68158.1|  heat shock protein 90                                   139   2e-35   Ornithogalum longebracteatum [sea-onion]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     137   8e-35   Cucumis melo [Oriental melon]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     136   2e-34   Phoenix dactylifera
gb|EPS69355.1|  hypothetical protein M569_05408                         135   6e-34   Genlisea aurea
gb|AAX19870.1|  unknown                                                 129   1e-33   Doryanthes excelsa
dbj|BAD94659.1|  HSP90-like protein                                     129   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAN34791.1|  Grp94                                                   133   3e-33   Xerophyta viscosa
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     132   4e-33   Phoenix dactylifera
gb|AFW81490.1|  hypothetical protein ZEAMMB73_031063                    121   9e-33   
gb|ACR38010.1|  unknown                                                 121   1e-32   Zea mays [maize]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          130   2e-32   
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     130   4e-32   Oryza brachyantha
ref|NP_001151475.1|  endoplasmin precursor                              129   8e-32   Zea mays [maize]
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     129   8e-32   Setaria italica
ref|NP_194150.1|  HSP90-like protein GRP94                              129   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             129   8e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               129   9e-32   
dbj|BAB86368.1|  SHEPHERD                                               129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             128   1e-31   Capsella rubella
ref|NP_001058590.1|  Os06g0716700                                       128   2e-31   
dbj|BAA90487.1|  heat shock protein 90                                  128   2e-31   Oryza sativa [red rice]
gb|AAL79732.1|AC091774_23  heat shock protein 90                        127   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    127   3e-31   
gb|AFW75767.1|  endoplasmin                                             127   3e-31   
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    126   5e-31   Hordeum vulgare [barley]
ref|NP_974606.1|  HSP90-like protein GRP94                              126   7e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    125   1e-30   Gossypium raimondii
gb|KJB14398.1|  hypothetical protein B456_002G122800                    125   1e-30   Gossypium raimondii
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          125   1e-30   Amborella trichopoda
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             125   1e-30   Eutrema salsugineum [saltwater cress]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    125   2e-30   Arabis alpina [alpine rockcress]
emb|CDY10992.1|  BnaA03g46510D                                          125   2e-30   Brassica napus [oilseed rape]
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   119   3e-30   Gossypium raimondii
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   119   3e-30   Gossypium raimondii
gb|KHG17445.1|  Endoplasmin                                             124   5e-30   Gossypium arboreum [tree cotton]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     124   5e-30   Camelina sativa [gold-of-pleasure]
emb|CDY24830.1|  BnaA08g14800D                                          124   5e-30   Brassica napus [oilseed rape]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          124   6e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CDY03477.1|  BnaC01g16050D                                          123   7e-30   
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     123   7e-30   Brassica rapa
emb|CDY34264.1|  BnaA01g13670D                                          123   7e-30   Brassica napus [oilseed rape]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          123   8e-30   Oryza sativa Indica Group [Indian rice]
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   119   9e-30   Gossypium raimondii
gb|ABV82432.1|  Hsp90-like protein                                      122   2e-29   Dactylis glomerata [cocksfoot]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     122   2e-29   Brachypodium distachyon [annual false brome]
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   122   2e-29   Gossypium raimondii
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     122   3e-29   Cucumis sativus [cucumbers]
emb|CDX92620.1|  BnaC07g38780D                                          121   5e-29   
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    118   5e-29   
emb|CDY08910.1|  BnaC08g11400D                                          120   1e-28   Brassica napus [oilseed rape]
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    120   1e-28   
gb|EMT19498.1|  Endoplasmin-like protein                                120   2e-28   
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              116   2e-28   
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              115   6e-28   
gb|ABV21762.1|  GRP94                                                   118   6e-28   Pinus taeda
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    115   6e-27   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    115   6e-27   
gb|EMS56078.1|  Endoplasmin-like protein                                114   2e-26   Triticum urartu
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    105   2e-23   
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   104   4e-23   Gossypium raimondii
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                   92.8    1e-20   
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343           94.4    1e-19   Selaginella moellendorffii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847           94.4    1e-19   Selaginella moellendorffii
gb|KHN44921.1|  Endoplasmin like                                      91.3    1e-19   Glycine soja [wild soybean]
ref|XP_001770511.1|  predicted protein                                91.3    2e-18   
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                   86.3    6e-18   
tpg|DAA64300.1|  TPA: hypothetical protein ZEAMMB73_830062            74.3    4e-13   
gb|KHN05402.1|  Endoplasmin like                                      68.6    1e-11   Glycine soja [wild soybean]
gb|KHN06641.1|  Cytosolic 5'-nucleotidase III                         67.8    2e-11   Glycine soja [wild soybean]
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696            68.2    1e-10   Volvox carteri f. nagariensis
gb|KHN25141.1|  Endoplasmin like                                      60.1    5e-09   Glycine soja [wild soybean]
ref|XP_001701885.1|  heat shock protein 90B                           63.5    5e-09   Chlamydomonas reinhardtii
ref|XP_006914764.1|  PREDICTED: endoplasmin-like                      60.1    6e-09   
dbj|BAG61085.1|  unnamed protein product                              60.1    7e-09   Homo sapiens [man]
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                      61.6    2e-08   Hydra vulgaris
gb|KHN71590.1|  Endoplasmin                                           60.8    4e-08   Toxocara canis
ref|XP_003907109.1|  PREDICTED: endoplasmin                           60.8    4e-08   
gb|AIC62039.1|  HSP90B1                                               59.3    5e-08   synthetic construct
gb|AAH09195.1|  HSP90B1 protein                                       59.3    5e-08   Homo sapiens [man]
ref|XP_004373828.1|  PREDICTED: endoplasmin                           60.5    6e-08   Trichechus manatus latirostris
gb|EAW97723.1|  heat shock protein 90kDa beta (Grp94), member 1, ...  59.7    6e-08   Homo sapiens [man]
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...  57.8    7e-08   Amblyomma variegatum
ref|XP_007096540.1|  PREDICTED: endoplasmin                           59.7    9e-08   Panthera tigris altaica
ref|XP_004326676.1|  PREDICTED: endoplasmin                           59.7    9e-08   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_007165840.1|  PREDICTED: endoplasmin                           59.7    9e-08   Balaenoptera acutorostrata scammoni
ref|XP_004269495.1|  PREDICTED: endoplasmin                           59.7    9e-08   
ref|XP_004414318.1|  PREDICTED: endoplasmin                           59.7    1e-07   Odobenus rosmarus divergens
ref|XP_007109922.1|  PREDICTED: endoplasmin                           59.7    1e-07   Physeter catodon
ref|XP_011311739.1|  PREDICTED: endoplasmin                           59.7    1e-07   Fopius arisanus
gb|ELK10318.1|  Endoplasmin                                           59.7    1e-07   Pteropus alecto
ref|XP_004623907.1|  PREDICTED: endoplasmin                           59.7    1e-07   Octodon degus
ref|XP_006740281.1|  PREDICTED: endoplasmin isoform X2                59.7    1e-07   Leptonychotes weddellii
ref|XP_008703910.1|  PREDICTED: endoplasmin                           59.7    1e-07   Ursus maritimus [white bear]
ref|NP_001003327.1|  endoplasmin precursor                            59.7    1e-07   Canis lupus familiaris [dogs]
ref|XP_004743081.1|  PREDICTED: endoplasmin                           59.7    1e-07   
ref|XP_006740280.1|  PREDICTED: endoplasmin isoform X1                59.7    1e-07   Leptonychotes weddellii
ref|XP_006934044.1|  PREDICTED: endoplasmin                           59.7    1e-07   
ref|NP_035761.1|  endoplasmin precursor                               59.7    1e-07   Mus musculus [mouse]
ref|XP_004053833.1|  PREDICTED: endoplasmin                           59.7    1e-07   
ref|XP_003783342.1|  PREDICTED: endoplasmin-like                      59.7    1e-07   Otolemur garnettii
ref|XP_003405348.1|  PREDICTED: endoplasmin                           59.3    1e-07   Loxodonta africana [African bush elephant]
ref|NP_777125.1|  endoplasmin precursor                               59.3    1e-07   Bos taurus [bovine]
ref|XP_006084129.1|  PREDICTED: endoplasmin                           59.3    1e-07   Myotis lucifugus
gb|AAH81917.1|  Tra1 protein                                          59.3    1e-07   Rattus norvegicus [brown rat]
ref|XP_006888611.1|  PREDICTED: endoplasmin                           59.3    1e-07   Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAE29874.1|  unnamed protein product                              59.3    1e-07   Mus musculus [mouse]
ref|XP_004589651.1|  PREDICTED: endoplasmin                           59.3    1e-07   Ochotona princeps [southern American pika]
ref|XP_002915502.1|  PREDICTED: endoplasmin isoform X1                59.3    1e-07   Ailuropoda melanoleuca
ref|XP_008142964.1|  PREDICTED: endoplasmin                           59.3    1e-07   Eptesicus fuscus
ref|NP_001012197.2|  endoplasmin precursor                            59.3    1e-07   Rattus norvegicus [brown rat]
ref|XP_006769416.1|  PREDICTED: endoplasmin                           59.3    1e-07   Myotis davidii
ref|NP_001127573.1|  endoplasmin precursor                            59.3    1e-07   Pongo abelii [orang utan]
ref|XP_011218345.1|  PREDICTED: endoplasmin isoform X2                59.3    1e-07   
ref|XP_008568503.1|  PREDICTED: endoplasmin                           59.3    1e-07   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004006728.1|  PREDICTED: endoplasmin                           59.3    1e-07   
ref|XP_004879102.1|  PREDICTED: endoplasmin                           59.3    1e-07   
ref|XP_005865309.1|  PREDICTED: endoplasmin                           59.3    1e-07   Myotis brandtii
ref|XP_003269991.2|  PREDICTED: endoplasmin                           59.3    1e-07   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001157345.1|  glucose-regulated protein precursor              59.3    1e-07   Equus caballus [domestic horse]
ref|NP_001182453.1|  heat shock protein 90kDa beta (Grp94), membe...  59.3    1e-07   Macaca mulatta [rhesus macaque]
ref|XP_005322404.1|  PREDICTED: endoplasmin                           59.3    1e-07   Ictidomys tridecemlineatus
ref|XP_005680600.1|  PREDICTED: endoplasmin                           59.3    1e-07   
gb|EHH66650.1|  hypothetical protein EGM_03684                        59.3    1e-07   Macaca fascicularis [crab eating macaque]
gb|EHH21126.1|  hypothetical protein EGK_04124                        59.3    1e-07   Macaca mulatta [rhesus macaque]
gb|AAH10445.1|  Heat shock protein 90, beta (Grp94), member 1         59.3    1e-07   Mus musculus [mouse]
ref|XP_011385167.1|  PREDICTED: endoplasmin                           59.3    1e-07   
ref|XP_008002644.1|  PREDICTED: endoplasmin                           59.3    1e-07   Chlorocebus sabaeus
ref|XP_003929672.1|  PREDICTED: endoplasmin                           59.3    1e-07   Saimiri boliviensis boliviensis
ref|XP_005358282.1|  PREDICTED: endoplasmin                           59.3    1e-07   Microtus ochrogaster [prairie voles]
ref|XP_006141474.1|  PREDICTED: endoplasmin                           59.3    1e-07   Tupaia chinensis
ref|XP_005374635.1|  PREDICTED: endoplasmin                           59.3    1e-07   Chinchilla lanigera
gb|EFB13451.1|  hypothetical protein PANDA_003512                     59.3    1e-07   Ailuropoda melanoleuca
ref|XP_008657570.1|  PREDICTED: 40S ribosomal protein S4-like         57.4    1e-07   
ref|XP_007619353.1|  PREDICTED: endoplasmin                           59.3    1e-07   
ref|XP_005068020.1|  PREDICTED: endoplasmin                           59.3    1e-07   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003505898.1|  PREDICTED: endoplasmin                           59.3    1e-07   Cricetulus griseus [Chinese hamsters]
ref|NP_001233416.1|  endoplasmin precursor                            59.3    1e-07   Pan troglodytes
dbj|BAP28370.1|  heat shock protein 90 kDa beta member 1              59.3    1e-07   Canis lupus familiaris [dogs]
gb|ELR54024.1|  Endoplasmin                                           59.3    1e-07   Bos mutus
ref|XP_006979926.1|  PREDICTED: endoplasmin                           59.3    1e-07   Peromyscus maniculatus bairdii
ref|NP_003290.1|  endoplasmin precursor                               59.3    1e-07   Homo sapiens [man]
gb|EHA99498.1|  Endoplasmin                                           59.3    1e-07   Heterocephalus glaber [naked mole rat]
ref|XP_004418096.1|  PREDICTED: endoplasmin                           59.3    1e-07   Ceratotherium simum simum [southern square-lipped rhinoceros]
emb|CAI64497.1|  tumor rejection antigen (gp96) 1                     59.3    1e-07   Homo sapiens [man]
gb|AAQ02595.1|  tumor rejection antigen 1gp96                         59.3    1e-07   synthetic construct
dbj|BAD92771.1|  tumor rejection antigen (gp96) 1 variant             58.9    1e-07   Homo sapiens [man]
gb|EPQ07146.1|  Endoplasmin                                           59.3    1e-07   Myotis brandtii
ref|XP_010629639.1|  PREDICTED: endoplasmin                           59.3    1e-07   Fukomys damarensis [Damara mole rat]
ref|XP_004844893.1|  PREDICTED: endoplasmin isoform X1                59.3    1e-07   
ref|XP_006205953.1|  PREDICTED: endoplasmin                           58.9    2e-07   Vicugna pacos
ref|XP_006193753.1|  PREDICTED: endoplasmin                           58.9    2e-07   Camelus ferus
gb|EPY74066.1|  endoplasmin precursor                                 58.9    2e-07   Camelus ferus
sp|Q29092.3|ENPL_PIG  RecName: Full=Endoplasmin; AltName: Full=94...  58.5    2e-07   Sus scrofa [pigs]
emb|CAA62352.1|  protein kinase                                       58.5    2e-07   Sus scrofa [pigs]
gb|KFM57735.1|  Endoplasmin                                           58.5    2e-07   Stegodyphus mimosarum
gb|ELK25961.1|  Endoplasmin                                           58.5    2e-07   Myotis davidii
ref|XP_007454336.1|  PREDICTED: endoplasmin                           58.5    3e-07   Lipotes vexillifer [baiji]
ref|XP_003461118.1|  PREDICTED: endoplasmin isoform X1                58.5    3e-07   Cavia porcellus [guinea pig]
ref|XP_005984835.1|  PREDICTED: endoplasmin                           58.5    3e-07   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008255217.1|  PREDICTED: endoplasmin                           58.2    3e-07   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008062311.1|  PREDICTED: endoplasmin isoform X1                58.2    3e-07   
ref|XP_004602837.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      58.2    3e-07   Sorex araneus [Eurasian shrew]
ref|XP_007893493.1|  PREDICTED: endoplasmin                           58.2    3e-07   Callorhinchus milii [Australian ghost shark]
ref|NP_999268.1|  endoplasmin precursor                               58.2    3e-07   Sus scrofa [pigs]
ref|XP_008657579.1|  PREDICTED: acyl-protein thioesterase 1-like      55.1    3e-07   Zea mays [maize]
ref|XP_007950582.1|  PREDICTED: endoplasmin                           58.2    3e-07   Orycteropus afer afer
ref|XP_008841379.1|  PREDICTED: endoplasmin                           57.8    4e-07   Nannospalax galili
ref|XP_004999393.1|  PREDICTED: endoplasmin isoform X2                57.8    4e-07   
ref|XP_004675798.1|  PREDICTED: endoplasmin                           57.8    4e-07   
ref|XP_001365625.1|  PREDICTED: endoplasmin                           57.8    5e-07   Monodelphis domestica
ref|XP_004650619.1|  PREDICTED: endoplasmin                           57.8    5e-07   
ref|XP_003202424.1|  PREDICTED: endoplasmin                           57.4    6e-07   Meleagris gallopavo [common turkey]
gb|KHN42517.1|  Endoplasmin like                                      53.1    6e-07   Glycine soja [wild soybean]
ref|XP_006871146.1|  PREDICTED: endoplasmin                           57.4    7e-07   Chrysochloris asiatica
gb|AAK74072.1|  heat shock protein gp96 precursor                     57.0    7e-07   Homo sapiens [man]
ref|XP_009861771.1|  PREDICTED: endoplasmin-like                      57.0    7e-07   Ciona intestinalis [sea vase]
ref|XP_002752963.1|  PREDICTED: endoplasmin                           57.0    9e-07   Callithrix jacchus [common marmoset]
ref|XP_004446859.1|  PREDICTED: endoplasmin isoform 1                 56.6    1e-06   
gb|ADY39524.1|  putative heat shock protein gp-96                     53.9    1e-06   Hottentotta judaicus
ref|XP_004446860.1|  PREDICTED: endoplasmin isoform 2                 56.6    1e-06   
gb|AAA48827.1|  108K heat shock protein                               56.6    1e-06   Gallus gallus [bantam]
ref|XP_007527982.1|  PREDICTED: endoplasmin                           56.6    1e-06   Erinaceus europaeus [common hedgehog]
dbj|BAI23208.1|  heat shock protein 90kDa beta (Grp94), member 1      56.6    1e-06   Coturnix japonica
ref|NP_989620.1|  endoplasmin precursor                               56.6    1e-06   Gallus gallus [bantam]
gb|ACF35012.1|  heat shock protein 108                                56.2    1e-06   Gallus gallus [bantam]
emb|CAA28629.1|  hsp 108                                              56.2    1e-06   Gallus gallus [bantam]
ref|XP_004700402.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      56.2    1e-06   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001084280.1|  heat shock protein 90kDa beta (Grp94), membe...  56.2    1e-06   Xenopus laevis [clawed frog]
ref|XP_001662951.1|  AAEL012827-PA                                    56.2    1e-06   Aedes aegypti
ref|XP_003745792.1|  PREDICTED: endoplasmin-like                      55.8    2e-06   Galendromus occidentalis
ref|NP_001039228.1|  heat shock protein 90kDa beta (Grp94), membe...  55.8    2e-06   Xenopus tropicalis [western clawed frog]
gb|KFP55508.1|  Endoplasmin                                           55.5    2e-06   Cariama cristata
ref|XP_009700867.1|  PREDICTED: endoplasmin                           55.5    2e-06   Cariama cristata
gb|ETE69540.1|  Endoplasmin                                           55.5    2e-06   Ophiophagus hannah
ref|XP_002428463.1|  Hsp90 protein, putative                          55.5    3e-06   Pediculus humanus corporis [human body lice]
ref|NP_001083114.1|  uncharacterized protein LOC398753 precursor      55.5    3e-06   Xenopus laevis [clawed frog]
ref|XP_003772640.1|  PREDICTED: endoplasmin-like                      55.5    3e-06   Sarcophilus harrisii
gb|ETN62729.1|  endoplasmin                                           55.1    3e-06   Anopheles darlingi [American malaria mosquito]
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                55.1    4e-06   Capitella teleta
gb|KFP71026.1|  Endoplasmin                                           54.7    4e-06   Acanthisitta chloris
gb|KFB42185.1|  AGAP001424-PA-like protein                            55.1    4e-06   Anopheles sinensis
ref|XP_011494775.1|  PREDICTED: endoplasmin                           54.7    4e-06   Ceratosolen solmsi marchali
ref|XP_006782653.1|  PREDICTED: endoplasmin-like                      54.7    4e-06   Neolamprologus brichardi [lyretail cichlid]
gb|AAI29529.1|  Unknown (protein for MGC:160189)                      54.7    4e-06   Xenopus laevis [clawed frog]
ref|XP_001844128.1|  endoplasmin                                      54.7    4e-06   Culex quinquefasciatus
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum     54.7    5e-06   Ostreococcus lucimarinus CCE9901
gb|AAT97075.1|  tumor rejection antigen-like protein                  51.6    5e-06   Lymnaea stagnalis
ref|XP_006599833.1|  PREDICTED: uncharacterized protein LOC102663115  53.9    5e-06   
gb|AGX25162.1|  heat shock protein                                    53.5    6e-06   Leptinotarsa decemlineata
gb|KFP21894.1|  Endoplasmin                                           54.3    6e-06   Egretta garzetta
gb|KFP37272.1|  Endoplasmin                                           54.3    6e-06   Chlamydotis macqueenii
ref|XP_003220951.1|  PREDICTED: endoplasmin                           54.3    7e-06   Anolis carolinensis [Carolina anole]
ref|XP_001899398.1|  Endoplasmin precursor                            53.9    7e-06   Brugia malayi [agent of lymphatic filariasis]
ref|XP_321706.5|  AGAP001424-PA                                       53.9    7e-06   Anopheles gambiae str. PEST
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                      53.1    8e-06   Tinamus guttatus
ref|XP_011474862.1|  PREDICTED: endoplasmin                           53.9    8e-06   
ref|XP_007438500.1|  PREDICTED: endoplasmin                           53.9    8e-06   Python bivittatus
gb|EFX71215.1|  hypothetical protein DAPPUDRAFT_309186                53.9    9e-06   Daphnia pulex
ref|NP_937853.1|  endoplasmin precursor                               53.9    9e-06   Danio rerio [leopard danio]
emb|CAG08708.1|  unnamed protein product                              53.9    9e-06   Tetraodon nigroviridis
ref|XP_009019107.1|  hypothetical protein HELRODRAFT_157169           53.5    1e-05   Helobdella robusta
gb|KFQ43502.1|  Endoplasmin                                           53.5    1e-05   Nestor notabilis
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                      52.8    1e-05   
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1               53.5    1e-05   Apis mellifera [bee]
gb|AEE63339.1|  unknown                                               53.5    1e-05   Dendroctonus ponderosae
gb|KDR24512.1|  Endoplasmin                                           53.5    1e-05   Zootermopsis nevadensis
gb|ERL91651.1|  hypothetical protein D910_08979                       53.5    1e-05   Dendroctonus ponderosae
gb|ENN73291.1|  hypothetical protein YQE_10055                        53.5    1e-05   
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...  53.5    1e-05   
ref|XP_003083767.1|  heat shock protein 90 (ISS)                      53.5    1e-05   
ref|XP_002072044.1|  GK22636                                          53.5    1e-05   
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                      53.5    1e-05   
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330             53.1    1e-05   
ref|XP_009906642.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      53.1    1e-05   
gb|KFV06212.1|  Endoplasmin                                           53.1    1e-05   
gb|EMC80264.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ97565.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_009560285.1|  PREDICTED: endoplasmin                           53.1    1e-05   
ref|XP_005527932.1|  PREDICTED: endoplasmin                           53.1    1e-05   
gb|KFV74906.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ54644.1|  Endoplasmin                                           53.1    1e-05   
gb|KFU95780.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_002199813.1|  PREDICTED: endoplasmin                           53.1    1e-05   
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                      53.1    1e-05   
gb|KFO95435.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_009464118.1|  PREDICTED: endoplasmin                           53.1    1e-05   
gb|KFP75492.1|  Endoplasmin                                           53.1    1e-05   
gb|KFM13671.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ80494.1|  Endoplasmin                                           53.1    1e-05   
gb|KFP29919.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ37930.1|  Endoplasmin                                           53.1    1e-05   
gb|KFZ45999.1|  Endoplasmin                                           53.1    1e-05   
gb|KFO61201.1|  Endoplasmin                                           53.1    1e-05   
gb|KFO76957.1|  Endoplasmin                                           53.1    1e-05   
gb|KFW84338.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_011212529.1|  PREDICTED: endoplasmin                           53.1    1e-05   
gb|KFV41897.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ78325.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_971540.1|  PREDICTED: endoplasmin                              53.1    1e-05   
gb|KFW73460.1|  Endoplasmin                                           53.1    1e-05   
gb|KFV83935.1|  Endoplasmin                                           53.1    1e-05   
gb|KFQ04275.1|  Endoplasmin                                           53.1    1e-05   
gb|KHN13326.1|  Endoplasmin like                                      49.7    1e-05   
ref|XP_009917591.1|  PREDICTED: endoplasmin                           53.1    1e-05   
gb|KGL95273.1|  Endoplasmin                                           53.1    1e-05   
ref|XP_010564611.1|  PREDICTED: endoplasmin                           53.1    1e-05   
gb|KFV91223.1|  Endoplasmin                                           53.1    2e-05   
gb|KFO04912.1|  Endoplasmin                                           53.1    2e-05   
ref|XP_010195758.1|  PREDICTED: endoplasmin                           53.1    2e-05   
ref|XP_005494809.1|  PREDICTED: endoplasmin                           53.1    2e-05   
ref|XP_010409181.1|  PREDICTED: endoplasmin                           52.8    2e-05   
ref|XP_009286695.1|  PREDICTED: endoplasmin                           52.8    2e-05   
ref|XP_002012968.1|  GL23644                                          52.8    2e-05   
ref|XP_005040044.1|  PREDICTED: endoplasmin isoform X2                52.8    2e-05   
ref|XP_001358252.1|  GA18946                                          52.8    2e-05   
ref|XP_003443932.1|  PREDICTED: endoplasmin-like                      52.8    2e-05   
ref|XP_005500402.1|  PREDICTED: endoplasmin                           52.8    2e-05   
gb|KFP99533.1|  Endoplasmin                                           52.8    2e-05   
ref|XP_006138079.1|  PREDICTED: endoplasmin                           52.8    2e-05   
gb|AAK69350.1|AF387865_1  heat shock protein 108                      52.8    2e-05   
ref|XP_005040043.1|  PREDICTED: endoplasmin isoform X1                52.8    2e-05   
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084           52.8    2e-05   
ref|XP_005929149.1|  PREDICTED: endoplasmin-like                      52.4    2e-05   
gb|KFQ16767.1|  Endoplasmin                                           52.4    3e-05   
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                      52.4    3e-05   
ref|NP_001274194.1|  heat shock protein 90kDa beta (Grp94), membe...  52.4    3e-05   
gb|KFU98338.1|  Endoplasmin                                           52.4    3e-05   
ref|XP_008934413.1|  PREDICTED: endoplasmin                           52.4    3e-05   
ref|XP_005150492.1|  PREDICTED: endoplasmin                           52.4    3e-05   
ref|XP_005180198.1|  PREDICTED: endoplasmin                           52.4    3e-05   
ref|XP_002508627.1|  predicted protein                                52.4    3e-05   
ref|XP_005310776.1|  PREDICTED: endoplasmin                           52.4    3e-05   
ref|XP_010073947.1|  PREDICTED: endoplasmin                           52.4    3e-05   
gb|KFO89906.1|  Endoplasmin                                           52.4    3e-05   
ref|XP_007512535.1|  predicted protein                                52.4    3e-05   
ref|XP_004567801.1|  PREDICTED: endoplasmin-like                      52.4    3e-05   
ref|XP_005022616.1|  PREDICTED: endoplasmin                           52.0    3e-05   
ref|XP_001599282.1|  PREDICTED: endoplasmin                           52.0    3e-05   
ref|XP_005728136.1|  PREDICTED: endoplasmin-like                      52.0    3e-05   
ref|XP_001507634.2|  PREDICTED: endoplasmin                           52.0    3e-05   
ref|XP_001637407.1|  predicted protein                                52.0    3e-05   
gb|AAG21337.1|AF273735_1  hypothetical esophageal gland cell secr...  49.7    3e-05   
gb|AFV39794.1|  94 kDa glucose-regulated protein                      52.0    3e-05   
ref|XP_003140246.1|  endoplasmin                                      52.0    4e-05   
ref|XP_005796337.1|  PREDICTED: endoplasmin-like                      52.0    4e-05   
ref|XP_008281449.1|  PREDICTED: endoplasmin                           52.0    4e-05   
ref|XP_001999079.1|  GI24315                                          51.6    4e-05   
gb|ACS75351.1|  endoplasmin                                           51.6    5e-05   
ref|XP_009942600.1|  PREDICTED: endoplasmin                           51.6    5e-05   
gb|KFR02424.1|  Endoplasmin                                           51.6    5e-05   
ref|XP_007541888.1|  PREDICTED: endoplasmin                           51.6    5e-05   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                       51.6    6e-05   
ref|XP_001753222.1|  predicted protein                                51.2    6e-05   
gb|ADR79285.1|  Hsp90 beta                                            51.2    6e-05   
ref|XP_011330408.1|  PREDICTED: endoplasmin                           51.2    6e-05   
gb|ABG56395.1|  glucose-regulated protein 94                          51.2    7e-05   
ref|XP_004523400.1|  PREDICTED: endoplasmin-like                      50.8    7e-05   
emb|CBN74418.1|  Heat shock protein 90                                50.8    8e-05   
ref|XP_003063917.1|  predicted protein                                50.8    8e-05   
ref|XP_008310403.1|  PREDICTED: endoplasmin                           50.8    8e-05   
ref|XP_002288873.1|  heat shock protein                               50.8    9e-05   
gb|KFZ55452.1|  Endoplasmin                                           50.4    1e-04   
ref|XP_002056124.1|  GJ10398                                          50.4    1e-04   
ref|XP_001955651.1|  GF18871                                          50.4    1e-04   
ref|XP_006599151.1|  PREDICTED: uncharacterized protein LOC102669...  48.1    1e-04   
ref|XP_011186065.1|  PREDICTED: endoplasmin                           50.4    1e-04   
gb|EFA78289.1|  heat shock protein Hsp90 family protein               50.4    1e-04   
ref|XP_004339231.1|  heat shock protein gp96, putative                50.4    1e-04   
ref|XP_002098730.1|  GE23773                                          50.4    1e-04   
ref|XP_004349108.2|  glucose-regulated protein 94                     50.4    1e-04   
ref|NP_999808.1|  heat shock protein gp96 precursor                   50.4    1e-04   
ref|XP_006633152.1|  PREDICTED: endoplasmin-like                      50.4    1e-04   
gb|ADA70351.1|  heat shock protein                                    50.4    1e-04   
gb|ABE73261.1|  IP13374p                                              50.1    1e-04   
ref|XP_002042993.1|  GM16365                                          50.1    1e-04   
ref|XP_002105205.1|  GD21359                                          50.1    1e-04   
ref|XP_001981484.1|  GG11583                                          50.1    1e-04   
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative         50.1    1e-04   
ref|XP_010901527.1|  PREDICTED: endoplasmin-like                      50.1    1e-04   
emb|CDG41617.1|  GRP94a protein                                       50.1    1e-04   
ref|NP_001181938.1|  94 kD glucose-regulated protein precursor        50.1    1e-04   
ref|XP_010665948.1|  PREDICTED: heat shock protein 83                 50.1    2e-04   
ref|XP_006004183.1|  PREDICTED: endoplasmin isoform X1                50.1    2e-04   
ref|XP_001990119.1|  GH18412                                          50.1    2e-04   
ref|XP_006004184.1|  PREDICTED: endoplasmin isoform X2                50.1    2e-04   
ref|XP_010684690.1|  PREDICTED: heat shock protein 83-like            50.1    2e-04   
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388            49.7    2e-04   
emb|CDQ84254.1|  unnamed protein product                              49.7    2e-04   
gb|ADQ86003.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|ADQ86002.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|ADQ86000.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|AHG52035.1|  90 kDa heat shock protein                             47.4    2e-04   
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                      49.7    2e-04   
gb|ADQ85999.1|  90 kDa heat shock protein                             47.4    2e-04   
emb|CDQ78594.1|  unnamed protein product                              49.7    2e-04   
gb|AFD53629.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|ADQ86001.1|  90 kDa heat shock protein                             47.4    2e-04   
gb|AGZ62517.1|  90 kDa heat shock protein                             47.4    2e-04   
gb|AFD53634.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|AHK14392.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|ADQ85998.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|AFD53632.1|  90 kDa heat shock protein                             47.0    2e-04   
gb|EPS70213.1|  hypothetical protein M569_04546                       48.9    3e-04   
ref|XP_011061023.1|  PREDICTED: endoplasmin                           49.3    3e-04   
ref|XP_010547210.1|  PREDICTED: heat shock protein 83-like isofor...  48.9    3e-04   
ref|XP_006407799.1|  hypothetical protein EUTSA_v10020096mg           48.9    3e-04   
ref|XP_010885352.1|  PREDICTED: endoplasmin                           48.9    3e-04   
ref|XP_010547208.1|  PREDICTED: heat shock protein 90-1-like isof...  48.9    3e-04   
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg           48.9    3e-04   
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                      48.9    3e-04   
gb|EYU43186.1|  hypothetical protein MIMGU_mgv1a001565mg              48.9    3e-04   
ref|XP_010457327.1|  PREDICTED: heat shock protein 90-1-like          48.9    4e-04   
gb|KFK33530.1|  hypothetical protein AALP_AA5G025000                  48.9    4e-04   
ref|XP_010464416.1|  PREDICTED: heat shock protein 90-1-like          48.9    4e-04   
gb|AAF13098.1|AC009176_25  putative heat-shock protein                48.9    4e-04   
ref|XP_007252444.1|  PREDICTED: endoplasmin-like isoform X2           48.9    4e-04   
ref|XP_002882549.1|  hypothetical protein ARALYDRAFT_896948           48.9    4e-04   
ref|NP_187434.2|  HEAT SHOCK PROTEIN 89.1                             48.9    4e-04   
dbj|BAF00175.1|  putative heat shock protein                          48.9    4e-04   
ref|XP_007252443.1|  PREDICTED: endoplasmin-like isoform X1           48.9    4e-04   
gb|KFK38234.1|  hypothetical protein AALP_AA3G086500                  48.9    4e-04   
ref|XP_008559868.1|  PREDICTED: endoplasmin                           48.9    4e-04   
ref|XP_010486347.1|  PREDICTED: heat shock protein 90-1-like          48.9    4e-04   
ref|XP_003617951.1|  Heat-shock protein                               48.9    4e-04   
gb|EWM27572.1|  heat shock protein 90                                 48.9    4e-04   
ref|NP_651601.1|  glycoprotein 93                                     48.5    4e-04   
ref|XP_011155603.1|  PREDICTED: endoplasmin                           48.5    5e-04   
dbj|BAF63637.1|  glucose-regulated protein 94                         48.5    5e-04   
ref|XP_011444480.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.5    5e-04   
ref|XP_005651682.1|  heat shock protein Hsp90                         48.1    6e-04   
ref|XP_010755578.1|  PREDICTED: endoplasmin isoform X1                48.1    6e-04   
gb|EYC44141.1|  hypothetical protein Y032_0471g2056                   48.1    6e-04   
ref|XP_004994487.1|  heat shock protein gp96                          48.1    6e-04   
gb|ADQ85997.1|  90 kDa heat shock protein                             46.2    6e-04   
gb|ADQ85996.1|  90 kDa heat shock protein                             46.2    7e-04   
emb|CDP19234.1|  unnamed protein product                              45.8    7e-04   
ref|XP_009798975.1|  PREDICTED: heat shock protein 83                 47.8    8e-04   
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                 47.8    8e-04   
ref|XP_006363008.1|  PREDICTED: endoplasmin homolog                   47.8    8e-04   
ref|XP_004243554.1|  PREDICTED: heat shock protein 83                 47.8    8e-04   
gb|KJB10747.1|  hypothetical protein B456_001G220600                  47.8    9e-04   
gb|KIH66348.1|  Hsp90 protein                                         47.8    9e-04   
gb|KHG03999.1|  Endoplasmin                                           47.8    9e-04   
ref|XP_010045864.1|  PREDICTED: heat shock protein 83                 47.8    9e-04   
ref|XP_007049300.1|  Heat shock protein 89.1 isoform 2                47.8    9e-04   
gb|KJB10746.1|  hypothetical protein B456_001G220600                  47.8    9e-04   
gb|KJB10745.1|  hypothetical protein B456_001G220600                  47.8    9e-04   
emb|CDW52501.1|  endoplasmin                                          47.8    0.001   
gb|KCW88689.1|  hypothetical protein EUGRSUZ_A01044                   47.4    0.001   
ref|XP_007049299.1|  Heat shock protein 89.1 isoform 1                47.4    0.001   
emb|CBJ27906.1|  Heat shock protein 90                                47.4    0.001   



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW VPAVLFLLCLLFLLPDQGRKIHANAEVD+DAPVDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTVPAVLFLLCLLFLLPDQGRKIHANAEVDADAPVDPPKVEEKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAESMS+RTLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESMSRRTLRATAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDAP+DPPKVEEKIGGVP+GLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAPLDPPKVEEKIGGVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAESMS+RTLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESMSRRTLRANAEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  53   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  232
            TMRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDA VDPPKVEEK+G VPHGLSTD D
Sbjct  70   TMRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAAVDPPKVEEKLGAVPHGLSTDSD  129

Query  233  VAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            V KREAESMS+R LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  130  VVKREAESMSRRNLRTNAEKFEFQAEVSRLMDIIINSLYSNK  171



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGRKIHANAE DSD P+DPPKVEEKIG VPHGLSTD +V
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIHANAEADSDVPLDPPKVEEKIGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAESMS++TLRA A+KFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESMSRKTLRASAQKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P VLFLLCL+FL+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWTIPFVLFLLCLIFLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAESMS++TLRA AEKFEFQA VSRLMDI+INSLYSNK
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNK  101



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P VLFLLCL++L+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWKIPFVLFLLCLIYLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAESMS++TLRA AEKFEFQA VSRLMDI+INSLYSNK
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNK  101



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKLGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKFGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMS++TLRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNK  101



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW VP+VLFLLC       QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAESMS R LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR LRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNK  101



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  266  MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  325

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR LRA AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  326  AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNK  366



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL ++ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSVISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW + +VLFLLCLLFL PDQGRKIH NA+ DSDA VDPPKVEEKIG VP+GLSTD +V
Sbjct  1    MRKWTI-SVLFLLCLLFLFPDQGRKIHVNAKGDSDASVDPPKVEEKIGAVPNGLSTDSNV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAESMS+RTLRA AE+FEFQA VSRLMDIIINSLYSNK
Sbjct  60   AKREAESMSRRTLRANAERFEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  229
            MRKWA+P+ L LL LL  +PD+GRK+HANAE   DSD  VDPPKVE+K+G VPHGLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTIPDRGRKLHANAEDSGDSDELVDPPKVEDKLGAVPHGLSTDS  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            +VAKREAES+S+RTLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   EVAKREAESISRRTLRSNAEKFEFQAEVSRLMDIIINSLYSNK  103



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VLF +CL+FLLPDQGRK+HANA+  SD  VDPPKVEEK+GG+  GLSTD DV
Sbjct  1    MRKWTIPSVLFFVCLIFLLPDQGRKLHANADGSSDEVVDPPKVEEKVGGIHGGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
              RE+ESMSKRTLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VHRESESMSKRTLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ LFLLCLLFLLPDQGRK+ ANAE  SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALFLLCLLFLLPDQGRKLQANAEGSSDDLVDPPKVEEKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKRTLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKRTLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL L+ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR+ AEKF+FQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRSLRSDAEKFQFQAEVSRLMDIIINSLYSNK  101



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL LL L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLLALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE DSD  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEADSDELVDPPKVEEKIGAVPSGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+ R+ A+ FEFQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNK  101



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LL LL LL DQG+K  ANAE +SD  VDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSTLLLLSLLLLLADQGQKFQANAEGNSDEIVDPPKVEEKLGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+ R+ A+ FEFQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNK  101



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+ R+ A+ FEFQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNK  101



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  229
            MRKWA+P+ L LL LL  +PD+GR +HANAE   DSD  VDPPKVEEK+G VP+GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTVPDRGRNLHANAEDSGDSDELVDPPKVEEKLGAVPNGLSTDA  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            +VAKREAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   EVAKREAESISRKTLRSNAEKFEFQAEVSRLMDIIINSLYSNK  103



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LL LL LLPDQG K+HA+AE +S+  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLLLLSLLPDQGHKLHASAE-ESEELVDPPKVEEKIGAVPNGLSTDSDV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAESMSKR  R  A++FEFQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESMSKR--RGNAQQFEFQAEVSRLMDIIIHSLYSNK  99



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LL LL LLPDQG KIHANAE +S+  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWMIPSALLLLLLLSLLPDQGHKIHANAE-ESEDLVDPPKVEEKIGAVPKGLSTDSDV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+SKR+LR+ AEKFEFQA VSRLMDI++NSLYSNK
Sbjct  60   ARREAESISKRSLRSNAEKFEFQAEVSRLMDILVNSLYSNK  100



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            M+KW + + +FLLC+LFL PDQGR+IHANAE DSD   +PPKVEEK+G VP+GLSTD DV
Sbjct  1    MKKWTLTSAIFLLCILFLFPDQGRRIHANAEGDSDEIANPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ESMSK+TLR  A+KFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESMSKKTLRNSAQKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEDSSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AE+F+FQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNK  101



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEGGSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKREAES+SKR+LR+ AE+F+FQA VSRLMDIII+SLYSNK
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNK  101



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V +VL LL LLFL  DQGRK  ANA  DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASVLLLLSLLFLFADQGRKFQANAAGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAES+SKR+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESISKRSLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            M KW +P+VL +LCLL  LPDQGRK+ ANAE DS+  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MGKWTIPSVLLVLCLLCALPDQGRKLRANAEGDSEELVDPPKVEEKLGAVPNGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR  AEKFEFQA VSRLMDI++NSLYSNK
Sbjct  61   VKRESESISKRSLRNSAEKFEFQAEVSRLMDILVNSLYSNK  101



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  229
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTDP
Sbjct  1    MRKWALPSALLLLLLLSFLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDP  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            DVAKREAES+S++TLR+ AEKFEFQA VSRL+DIIINSLYSNK
Sbjct  61   DVAKREAESISRKTLRSNAEKFEFQAEVSRLLDIIINSLYSNK  103



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +2

Query  50   VTMRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLST  223
            + MRKWA+P+ L LL LL   PDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLST
Sbjct  20   IAMRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLST  79

Query  224  DPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            D DVAKREAES+S++TL + AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  80   DSDVAKREAESISRKTLGSNAEKFEFQAEVSRLMDIIINSLYSNK  124



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE-VDSDAPVDPPKVEEKIGGVPHGLSTDPD  232
            MRKWA+P+VL LL LL  LPDQGRKIHANAE  D D  VDPPKVEEKIG VP GLSTD D
Sbjct  1    MRKWALPSVLLLLVLLSTLPDQGRKIHANAEESDGDELVDPPKVEEKIGAVPSGLSTDSD  60

Query  233  VAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            VAKREAES+S+++LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VAKREAESISRKSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  102



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW + + L LLC+L L+PD+G + HA A+ D+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+SKR+LR+  EKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISKRSLRSSGEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  229
            MRKWA+P+ L LL LL   PDQGRK+HANAE   D+D   DPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDADELADPPKVEEKLGAVPGGLSTDS  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            DVAKREAES+S++TLR+ AEKF+FQA VSRLMDIIINSLYSNK
Sbjct  61   DVAKREAESISRKTLRSNAEKFDFQAEVSRLMDIIINSLYSNK  103



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW V ++L LLC+L +LPDQGRK   NAE + DA   PPKVEEKIGG+P GLSTD +V
Sbjct  1    MRKWTVTSILLLLCILLVLPDQGRKARVNAESEKDAATGPPKVEEKIGGIPSGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KREAES+S R LRA AEKF+FQA VSRLMDIIINSLYSNK
Sbjct  61   VKREAESISGRNLRAEAEKFQFQAEVSRLMDIIINSLYSNK  101



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = +2

Query  116  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  295
            DQGRK+ ANAE +S+  VDPPKVEEK+G VP GLSTD DVAKREAES+S++TLR+ AEKF
Sbjct  23   DQGRKLQANAE-ESEELVDPPKVEEKLGAVPGGLSTDSDVAKREAESISRKTLRSSAEKF  81

Query  296  EFQAXVSRLMDIIINSLYSNK  358
            EFQA VSRLMDIIINSLYSNK
Sbjct  82   EFQAEVSRLMDIIINSLYSNK  102



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 83/105 (79%), Gaps = 4/105 (4%)
 Frame = +2

Query  56   MRKWAVP--AVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  223
            MR W++P   VL LL  L  +PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct  1    MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST  60

Query  224  DPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            D DVAKREAESMS++ LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   DADVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNK  105



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  229
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDS  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            DVAKREAES+S++++R+  EKFEFQA VSRL+DIIINSLYSNK
Sbjct  61   DVAKREAESISRKSMRSDGEKFEFQAEVSRLLDIIINSLYSNK  103



>gb|AFW81490.1| hypothetical protein ZEAMMB73_031063, partial [Zea mays]
Length=102

 Score =   121 bits (304),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  304
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  305  AXVSRLMDIIINSLYSNK  358
            A VSRLMDIIINSLYSNK
Sbjct  72   AEVSRLMDIIINSLYSNK  89



>gb|ACR38010.1| unknown [Zea mays]
Length=104

 Score =   121 bits (304),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  304
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  305  AXVSRLMDIIINSLYSNK  358
            A VSRLMDIIINSLYSNK
Sbjct  72   AEVSRLMDIIINSLYSNK  89



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NA+  +D  VDPPKVEE+IG VPHGLSTD +V
Sbjct  1    MRKWALASALLLLFLLTTLPDPAKKLQVNADDSADELVDPPKVEERIGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDAEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL L  L PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWALSSALLLLLLTTL-PDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             +REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  100



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL L  L PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWALSSALLLLLLTTL-PDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             +REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  100



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfll-PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  232
            MRKWA+ + L LL LL    PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +
Sbjct  1    MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE  60

Query  233  VAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            V +REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  102



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            A+REAES+S++TLR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNK  101



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+   L L+ LL  LPD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             +RE+ES+S++TLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQG K+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGTKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE++S+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE++S+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAP--VDPPKVEEKIGGVPHGLSTDP  229
            MRK A+ + +FL+ LL LLP QGR + ANAE ++ A   VDPPKVEEKIG +P  LSTD 
Sbjct  1    MRKGAMTSAIFLVFLLALLPYQGRHLQANAEENNGAEGLVDPPKVEEKIGAIPDALSTDS  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            DVAKREAESMS+++LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   DVAKREAESMSRKSLRGNAEKFEFQAEVSRLMDIIINSLYSNK  103



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRK  + +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKRTIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HGGLSTDSDV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
              RE+ES+SK++LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VHRESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  100



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRK  + +VLFL+CL+FLLPDQGRK+HANAE  ++   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVLFLVCLVFLLPDQGRKLHANAEGSTEEYSDPPKVEEKLGG-HGGLSTDSDV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
              RE+ESMSKR+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VHRESESMSKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  100



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HSGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKRE+ES+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKRE+ES+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            M  W +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGNWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE++S+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEE IGG   GLSTD DV  RE+ES+SK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEPIGG-HGGLSTDSDVVHRESESISKKTLRSSAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRK  + +V+FL  LLFLLP+QGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVMFLFSLLFLLPEQGRKLHANAEESSDDVTDPPKVEEKLGG-HGGLSTDSDV  59

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
              R +ES+SK++LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VHRSSESISKKSLRSSAEKFEFQAEVSRLMDIIINSLYSNK  100



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  301
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  50   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  109

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA VSRLMDIIINSLYSNK
Sbjct  110  QAEVSRLMDIIINSLYSNK  128



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  301
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  49   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  108

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA VSRLMDIIINSLYSNK
Sbjct  109  QAEVSRLMDIIINSLYSNK  127



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            AKRE+ES+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  98



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MR+WA+ + L L+ LL  LPD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRRWALSSALLLVLLLTTLPDPAKRLQVNAEESSDELTDLPKVEEKLGAVPHGLSTDSEV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             +RE+ES+S++TLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNK  101



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfl-lPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  232
            MRKWA+ + L L+ LL    PD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +
Sbjct  1    MRKWALSSALLLVFLLATLSPDPAKRLQVNAEESSDELADLPKVEEKLGAVPHGLSTDSE  60

Query  233  VAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            V KRE+ES+S++TLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VVKRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNK  102



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +2

Query  53   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  232
            TMRKWA+P+ L LLCLL LL D GRK+ ANAE   +  VDPPKVEEKIG VPHGL TD D
Sbjct  19   TMRKWAIPSALVLLCLLSLLSDHGRKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSD  75

Query  233  VAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            V KRE+ES+S R+LR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  76   VVKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNK  117



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKW + + L LLC+L L+PD+G + HA A+VD+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADVDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+S+R+LR+  EKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   VKRESESISRRSLRSSGEKFEFQAEVSRLMDIIINSLYSNK  101



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  113  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
            PDQGRK+HA+AE  +D   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHASAEDSTDEVTDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            FEFQA VSRLMDIIINSLYSNK
Sbjct  79   FEFQAEVSRLMDIIINSLYSNK  100



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  119  QGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFE  298
            Q  K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+ EAES+S++TLR+ AEKFE
Sbjct  244  QANKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQSEAESISRKTLRSSAEKFE  303

Query  299  FQAXVSRLMDIIINSLYSNK  358
            FQA VSRLMDIIINSLY+NK
Sbjct  304  FQAEVSRLMDIIINSLYNNK  323



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRK A+ +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVE+K+GG   GLSTD DV
Sbjct  1    MRKRAIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEKKLGG-HGGLSTDSDV  59

Query  236  AKR-EAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             +R E+ES+SK++LR+  EKFEFQA VSRLMDIIINSLYSNK
Sbjct  60   VRRLESESISKKSLRSSGEKFEFQAEVSRLMDIIINSLYSNK  101



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  301
             +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEF
Sbjct  216  AKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEF  275

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA VSRLMDIIINSLYSNK
Sbjct  276  QAEVSRLMDIIINSLYSNK  294



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 10/111 (9%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGR----------KIHANAEVDSDAPVDPPKVEEKIGGV  205
            MRKWA+   L L+ LL  LPD G+          K+  NAE  SD   D PKVEEK+G V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPGKPPQSLPLNTKKLQVNAEESSDEVGDFPKVEEKLGAV  60

Query  206  PHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            PHGLSTD +V +RE+ES+S++TLR  AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  61   PHGLSTDSEVVQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNK  111



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  304
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  305  AXVSRLMDIIINSLYSNK  358
            A VSRLMDIIINSLY+NK
Sbjct  198  AEVSRLMDIIINSLYNNK  215



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  304
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  305  AXVSRLMDIIINSLYSNK  358
            A VSRLMDIIINSLY+NK
Sbjct  198  AEVSRLMDIIINSLYNNK  215



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVD-SDAPVDPPKVEEKIGG-VPHGLSTDP  229
            MRKWAVP  LFLL +L  +P Q   + ANAE   +D    PPKVEE IGG +P  LSTD 
Sbjct  1    MRKWAVPTALFLLIILTFVPHQSPHLRANAEASPADENASPPKVEEGIGGAIPDALSTDA  60

Query  230  DVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
            DVA+RE+ES+S++TLRA A+KFEFQA VSRLMDI+INSLYSNK
Sbjct  61   DVAQRESESISRKTLRANAQKFEFQAEVSRLMDILINSLYSNK  103



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+S R+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  98



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  56   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  235
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  236  AKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
             KRE+ES+S R+LR+ AEKFEFQA VSRLMDIIINSLYSNK
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNK  98



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  301
             +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V +RE+ES+S++TLR  AEKFEF
Sbjct  92   AKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSAEKFEF  151

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA VSRLMDIIINSLYSNK
Sbjct  152  QAEVSRLMDIIINSLYSNK  170



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +2

Query  116  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  295
            DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV KRE+ES+S R+LR+ AEKF
Sbjct  13   DQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDVVKRESESISSRSLRSNAEKF  69

Query  296  EFQAXVSRLMDIIINSLYSNK  358
            EFQA VSRLMDIIINSLYSNK
Sbjct  70   EFQAEVSRLMDIIINSLYSNK  90



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  304
            RK+ ANAE   +  VDPPKVEEKIG VPHGL TD DV KRE+ES+S R+LR  AEKFEFQ
Sbjct  1    RKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSDVVKRESESISSRSLRNNAEKFEFQ  57

Query  305  AXVSRLMDIIINSLYSNK  358
            A VSRLMDIIINSLYSNK
Sbjct  58   AEVSRLMDIIINSLYSNK  75



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  197  GGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSNK  358
              VPHGLSTD +VA+REAES+S++TLR+  EKFEFQA VSRLMDIIINSLYSNK
Sbjct  13   NAVPHGLSTDSEVAQREAESISRKTLRSSIEKFEFQAEVSRLMDIIINSLYSNK  66



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 4/86 (5%)
 Frame = +2

Query  113  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  280
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  281  GAEKFEFQAXVSRLMDIIINSLYSNK  358
             A++F FQA VSRLMDII+NSLYSNK
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNK  105



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 4/86 (5%)
 Frame = +2

Query  113  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  280
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  281  GAEKFEFQAXVSRLMDIIINSLYSNK  358
             A++F FQA VSRLMDII+NSLYSNK
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNK  105



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 54/79 (68%), Gaps = 12/79 (15%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  301
            GRK  ANAE DSD  VDPPKV++KI  VPHGL TD +V            +++  EKFEF
Sbjct  92   GRKFQANAEGDSDELVDPPKVKDKISDVPHGLLTDSNV------------IKSNVEKFEF  139

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA VS LMDIIINSLYSNK
Sbjct  140  QAEVSWLMDIIINSLYSNK  158



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSN  355
            PK+EE +G VP G +TD +V KRE+ESM+ + LR+ AEKFEFQA VSRLMDIII+SLYSN
Sbjct  51   PKLEENLGAVPAGSTTDSEVVKRESESMTSKNLRSNAEKFEFQAEVSRLMDIIIHSLYSN  110

Query  356  K  358
            K
Sbjct  111  K  111



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  176  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMDIIINSLYSN  355
            P+V  +   VP GLSTD +VA+REAES+S++TLR+  EKFEFQA VSRLMDIIINSLY+ 
Sbjct  69   PRVTTQRSVVPRGLSTDSEVAQREAESISRKTLRSSTEKFEFQAEVSRLMDIIINSLYNK  128

Query  356  K  358
            K
Sbjct  129  K  129



>tpg|DAA64300.1| TPA: hypothetical protein ZEAMMB73_830062 [Zea mays]
Length=387

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  122  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  292
             +K+  NAE  S    +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEK
Sbjct  227  AKKLQVNAEESSHDLANPPKVEEKLGVVPHGLSTDSEVAQREAESISRKTLRSSAEK  283



>gb|KHN05402.1| Endoplasmin like [Glycine soja]
Length=227

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 40/64 (63%), Gaps = 12/64 (19%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAX  310
              ANAE DSD  VDPPKVE+KIG VPHGLSTD DV K              AEKFEFQA 
Sbjct  2    FQANAEGDSDKLVDPPKVEDKIGVVPHGLSTDSDVVK------------INAEKFEFQAE  49

Query  311  VSRL  322
            VS L
Sbjct  50   VSWL  53



>gb|KHN06641.1| Cytosolic 5'-nucleotidase III [Glycine soja]
Length=263

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 41/64 (64%), Gaps = 12/64 (19%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAX  310
              ANAE DSD  VDPPKVE+KIG VPHGLSTD +V K            + AEKFEFQA 
Sbjct  2    FQANAEGDSDELVDPPKVEDKIGVVPHGLSTDSNVVK------------SNAEKFEFQAK  49

Query  311  VSRL  322
            VS L
Sbjct  50   VSWL  53



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = +2

Query  134  HANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRT--LRAGAEKFEFQA  307
             A+  +D+ A    PKV+  +    H  +TD     RE ESMS     LR+GAE+F FQA
Sbjct  23   FADTSIDATAA---PKVDNGVSS-GHATTTDATSIHREKESMSNTANRLRSGAEQFAFQA  78

Query  308  XVSRLMDIIINSLYSNK  358
             VSRLMDIIINSLYSNK
Sbjct  79   EVSRLMDIIINSLYSNK  95



>gb|KHN25141.1| Endoplasmin like [Glycine soja]
Length=127

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 12/63 (19%)
 Frame = +2

Query  134  HANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXV  313
             ANAE DSD  VD PKV++KIG VPHGLS D DV            +++ AEKFEFQ  V
Sbjct  3    QANAEGDSDELVDQPKVKDKIGVVPHGLSIDSDV------------IKSNAEKFEFQVEV  50

Query  314  SRL  322
            S L
Sbjct  51   SWL  53



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +2

Query  158  DAPVDP---PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAXVSRLMD  328
            D+ VD    PKV+  +    H  +TD     RE E+MSK+ +R   E+F FQA V+RLMD
Sbjct  1    DSAVDATAAPKVDNGVSS-GHATATDATSIHREKEAMSKQRVRDSGEQFAFQAEVTRLMD  59

Query  329  IIINSLYSNK  358
            III+SLYSNK
Sbjct  60   IIIHSLYSNK  69



>ref|XP_006914764.1| PREDICTED: endoplasmin-like [Pteropus alecto]
Length=140

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>dbj|BAG61085.1| unnamed protein product [Homo sapiens]
Length=163

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 8/76 (11%)
 Frame = +2

Query  155  SDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAX  310
            S+  VD PKV + IG    G  TD +V KRE E+++         + LR  AEK  FQA 
Sbjct  28   SEDEVDTPKVTDDIGKSRDGSKTDDEVVKREEEAINIDGLSVAEVKQLRESAEKHAFQAE  87

Query  311  VSRLMDIIINSLYSNK  358
            VSR+M +IINSLY NK
Sbjct  88   VSRMMKLIINSLYKNK  103



>gb|KHN71590.1| Endoplasmin [Toxocara canis]
Length=786

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 8/78 (10%)
 Frame = +2

Query  149  VDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQ  304
            V+++  ++ P V+E IG       TD +V +RE E++          + +RA AEK+EFQ
Sbjct  27   VEAEDDIEEPTVKENIGKAQDASKTDDEVVQREEEAIKLDGMSVAEMKEMRARAEKYEFQ  86

Query  305  AXVSRLMDIIINSLYSNK  358
            A V+R+M +IINSLY NK
Sbjct  87   AEVNRMMKLIINSLYRNK  104



>ref|XP_003907109.1| PREDICTED: endoplasmin [Papio anubis]
Length=800

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK----RTLRAGAEKFE  298
            + A+ EVD D  V     EE +G    G  TD +V +RE E++      R LR  +EKF 
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAILNASQIRELREKSEKFA  73

Query  299  FQAXVSRLMDIIINSLYSNK  358
            FQA V+R+M +IINSLY NK
Sbjct  74   FQAEVNRMMKLIINSLYKNK  93



>gb|AIC62039.1| HSP90B1, partial [synthetic construct]
Length=315

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|AAH09195.1| HSP90B1 protein [Homo sapiens]
Length=315

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004373828.1| PREDICTED: endoplasmin [Trichechus manatus latirostris]
Length=803

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADGEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|EAW97723.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_a, 
partial [Homo sapiens]
Length=367

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  47   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  101

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  102  EKFAFQAEVNRMMKLIINSLYKNK  125



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 8/75 (11%)
 Frame = +2

Query  158  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAXV  313
            DA    PKVE+ +G    G  TD  V +RE E++          + +R  AEK  FQA V
Sbjct  23   DAESSTPKVEDDLGATREGSRTDDQVVEREEEAIKLDGLNVAQMKEMREKAEKHAFQAEV  82

Query  314  SRLMDIIINSLYSNK  358
            +R+M +IINSLY NK
Sbjct  83   TRMMKLIINSLYRNK  97



>ref|XP_007096540.1| PREDICTED: endoplasmin [Panthera tigris altaica]
Length=804

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004326676.1| PREDICTED: endoplasmin [Tursiops truncatus]
Length=805

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_007165840.1| PREDICTED: endoplasmin [Balaenoptera acutorostrata scammoni]
Length=805

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004269495.1| PREDICTED: endoplasmin [Orcinus orca]
Length=805

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004414318.1| PREDICTED: endoplasmin [Odobenus rosmarus divergens]
Length=804

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADNEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_007109922.1| PREDICTED: endoplasmin [Physeter catodon]
Length=805

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_011311739.1| PREDICTED: endoplasmin [Fopius arisanus]
Length=794

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A A+++ D   D P VE+ +G       TD +V +RE+E+++         + LR  AEK
Sbjct  18   ARAQLEIDEADDVPSVEQNLGSSREASRTDDEVVQRESEAINIDGLNPSQIQELRNRAEK  77

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQ  V+R+M +IINSLY NK
Sbjct  78   FTFQTEVNRMMKLIINSLYRNK  99



>gb|ELK10318.1| Endoplasmin [Pteropus alecto]
Length=680

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004623907.1| PREDICTED: endoplasmin [Octodon degus]
Length=806

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006740281.1| PREDICTED: endoplasmin isoform X2 [Leptonychotes weddellii]
Length=748

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008703910.1| PREDICTED: endoplasmin [Ursus maritimus]
Length=804

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001003327.1| endoplasmin precursor [Canis lupus familiaris]
 sp|P41148.1|ENPL_CANFA RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Canis lupus familiaris]
 gb|AAA17708.1| GRP94 [Canis lupus familiaris]
Length=804

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004743081.1| PREDICTED: endoplasmin [Mustela putorius furo]
 ref|XP_004787181.1| PREDICTED: endoplasmin [Mustela putorius furo]
Length=803

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006740280.1| PREDICTED: endoplasmin isoform X1 [Leptonychotes weddellii]
Length=803

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006934044.1| PREDICTED: endoplasmin [Felis catus]
Length=804

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_035761.1| endoplasmin precursor [Mus musculus]
 sp|P08113.2|ENPL_MOUSE RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Endoplasmic reticulum 
resident protein 99; Short=ERp99; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Polymorphic tumor 
rejection antigen 1; AltName: Full=Tumor rejection antigen 
gp96; Flags: Precursor [Mus musculus]
 gb|AAA37573.1| endoplasmic reticulum transmembrane protein precursor [Mus musculus]
 dbj|BAE38494.1| unnamed protein product [Mus musculus]
 dbj|BAE40874.1| unnamed protein product [Mus musculus]
 dbj|BAE27505.1| unnamed protein product [Mus musculus]
 dbj|BAE32087.1| unnamed protein product [Mus musculus]
 dbj|BAE30378.1| unnamed protein product [Mus musculus]
 dbj|BAE35526.1| unnamed protein product [Mus musculus]
 dbj|BAE40758.1| unnamed protein product [Mus musculus]
 gb|EDL21440.1| heat shock protein 90kDa beta (Grp94), member 1 [Mus musculus]
Length=802

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004053833.1| PREDICTED: endoplasmin [Gorilla gorilla gorilla]
Length=803

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003783342.1| PREDICTED: endoplasmin-like [Otolemur garnettii]
Length=804

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003405348.1| PREDICTED: endoplasmin [Loxodonta africana]
Length=801

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_777125.1| endoplasmin precursor [Bos taurus]
 ref|XP_005899141.1| PREDICTED: endoplasmin [Bos mutus]
 ref|XP_006077264.1| PREDICTED: endoplasmin [Bubalus bubalis]
 ref|XP_010851722.1| PREDICTED: endoplasmin [Bison bison bison]
 sp|Q95M18.1|ENPL_BOVIN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Bos taurus]
 dbj|BAB69766.1| glucose-regulated protein GRP94 precursor [Bos taurus]
 gb|AAI04550.1| Tumor rejection antigen (gp96) 1 [Bos taurus]
 tpg|DAA29741.1| TPA: endoplasmin precursor [Bos taurus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006084129.1| PREDICTED: endoplasmin [Myotis lucifugus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|AAH81917.1| Tra1 protein [Rattus norvegicus]
Length=643

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006888611.1| PREDICTED: endoplasmin [Elephantulus edwardii]
Length=801

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>dbj|BAE29874.1| unnamed protein product [Mus musculus]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004589651.1| PREDICTED: endoplasmin [Ochotona princeps]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_002915502.1| PREDICTED: endoplasmin isoform X1 [Ailuropoda melanoleuca]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008142964.1| PREDICTED: endoplasmin [Eptesicus fuscus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001012197.2| endoplasmin precursor [Rattus norvegicus]
 sp|Q66HD0.2|ENPL_RAT RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Rattus norvegicus]
 gb|EDM17052.1| rCG49111 [Rattus norvegicus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006769416.1| PREDICTED: endoplasmin [Myotis davidii]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001127573.1| endoplasmin precursor [Pongo abelii]
 sp|Q5R6F7.1|ENPL_PONAB RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Pongo abelii]
 emb|CAH92659.1| hypothetical protein [Pongo abelii]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_011218345.1| PREDICTED: endoplasmin isoform X2 [Ailuropoda melanoleuca]
Length=799

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008568503.1| PREDICTED: endoplasmin [Galeopterus variegatus]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004006728.1| PREDICTED: endoplasmin [Ovis aries]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004879102.1| PREDICTED: endoplasmin [Heterocephalus glaber]
 ref|XP_004844894.1| PREDICTED: endoplasmin isoform X2 [Heterocephalus glaber]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005865309.1| PREDICTED: endoplasmin [Myotis brandtii]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003269991.2| PREDICTED: endoplasmin [Nomascus leucogenys]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001157345.1| glucose-regulated protein precursor [Equus caballus]
 ref|XP_008535120.1| PREDICTED: endoplasmin [Equus przewalskii]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001182453.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Macaca 
mulatta]
 ref|NP_001270655.1| endoplasmin precursor [Macaca fascicularis]
 ref|XP_010355583.1| PREDICTED: endoplasmin [Rhinopithecus roxellana]
 sp|Q4R520.1|ENPL_MACFA RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Macaca fascicularis]
 dbj|BAE01805.1| unnamed protein product [Macaca fascicularis]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005322404.1| PREDICTED: endoplasmin [Ictidomys tridecemlineatus]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005680600.1| PREDICTED: endoplasmin [Capra hircus]
Length=800

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  15   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  69

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  70   EKFAFQAEVNRMMKLIINSLYKNK  93



>gb|EHH66650.1| hypothetical protein EGM_03684 [Macaca fascicularis]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|EHH21126.1| hypothetical protein EGK_04124 [Macaca mulatta]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|AAH10445.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
 gb|AAH11439.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_011385167.1| PREDICTED: endoplasmin [Pteropus vampyrus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008002644.1| PREDICTED: endoplasmin [Chlorocebus sabaeus]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003929672.1| PREDICTED: endoplasmin [Saimiri boliviensis boliviensis]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+AEVD D  V     E  +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADAEVDVDGTV-----EADLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005358282.1| PREDICTED: endoplasmin [Microtus ochrogaster]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006141474.1| PREDICTED: endoplasmin [Tupaia chinensis]
 gb|ELW71596.1| Endoplasmin [Tupaia chinensis]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005374635.1| PREDICTED: endoplasmin [Chinchilla lanigera]
Length=806

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|EFB13451.1| hypothetical protein PANDA_003512 [Ailuropoda melanoleuca]
Length=778

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  3    VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  57

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  58   EKFAFQAEVNRMMKLIINSLYKNK  81



>ref|XP_008657570.1| PREDICTED: 40S ribosomal protein S4-like [Zea mays]
Length=233

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKR  244
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+R
Sbjct  15   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQR  54



>ref|XP_007619353.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|ERE88868.1| endoplasmin [Cricetulus griseus]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005068020.1| PREDICTED: endoplasmin [Mesocricetus auratus]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003505898.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|EGW09701.1| Endoplasmin [Cricetulus griseus]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_001233416.1| endoplasmin precursor [Pan troglodytes]
 dbj|BAK62934.1| endoplasmin precursor [Pan troglodytes]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>dbj|BAP28370.1| heat shock protein 90 kDa beta member 1, partial [Canis lupus 
familiaris]
Length=663

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  12   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  66

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  67   EKFAFQAEVNRMMKLIINSLYKNK  90



>gb|ELR54024.1| Endoplasmin, partial [Bos mutus]
Length=795

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006979926.1| PREDICTED: endoplasmin [Peromyscus maniculatus bairdii]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|NP_003290.1| endoplasmin precursor [Homo sapiens]
 ref|XP_003832615.1| PREDICTED: endoplasmin [Pan paniscus]
 sp|P14625.1|ENPL_HUMAN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=Tumor rejection antigen 
1; AltName: Full=gp96 homolog; Flags: Precursor [Homo sapiens]
 emb|CAA33261.1| precursor polypeptide (AA-21 to 782) [Homo sapiens]
 gb|AAH66656.1| Heat shock protein 90kDa beta (Grp94), member 1 [Homo sapiens]
 gb|EAW97724.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_b 
[Homo sapiens]
 gb|ACJ13662.1| epididymis luminal protein 35 [Homo sapiens]
 gb|ACS44652.1| epididymis secretory sperm binding protein Li 125m [Homo sapiens]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|EHA99498.1| Endoplasmin, partial [Heterocephalus glaber]
Length=792

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004418096.1| PREDICTED: endoplasmin [Ceratotherium simum simum]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>emb|CAI64497.1| tumor rejection antigen (gp96) 1 [Homo sapiens]
Length=802

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|AAQ02595.1| tumor rejection antigen 1gp96, partial [synthetic construct]
Length=803

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>dbj|BAD92771.1| tumor rejection antigen (gp96) 1 variant [Homo sapiens]
Length=576

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  45   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  99

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  100  EKFAFQAEVNRMMKLIINSLYKNK  123



>gb|EPQ07146.1| Endoplasmin [Myotis brandtii]
Length=825

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_010629639.1| PREDICTED: endoplasmin [Fukomys damarensis]
 gb|KFO30279.1| Endoplasmin [Fukomys damarensis]
Length=806

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDLDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004844893.1| PREDICTED: endoplasmin isoform X1 [Heterocephalus glaber]
Length=844

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006205953.1| PREDICTED: endoplasmin [Vicugna pacos]
Length=804

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_006193753.1| PREDICTED: endoplasmin [Camelus ferus]
 ref|XP_010968744.1| PREDICTED: endoplasmin [Camelus bactrianus]
 ref|XP_010988330.1| PREDICTED: endoplasmin [Camelus dromedarius]
Length=804

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|EPY74066.1| endoplasmin precursor [Camelus ferus]
Length=723

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>sp|Q29092.3|ENPL_PIG RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=98 kDa protein kinase; 
Short=PPK 98; Short=ppk98; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=gp96 homolog; Flags: 
Precursor [Sus scrofa]
 emb|CAA53948.1| Ppk 98; a protein kinase [Sus scrofa]
Length=804

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>emb|CAA62352.1| protein kinase [Sus scrofa]
Length=808

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|KFM57735.1| Endoplasmin, partial [Stegodyphus mimosarum]
Length=785

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = +2

Query  170  DPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAXVSRLM  325
            D P VE  IG    G  TD +V +RE E++          + LR  AEKF FQA V+R+M
Sbjct  24   DEPTVEPDIGSSREGSRTDDEVVQREEEAIKIDGLNVAQIKELREKAEKFTFQAEVNRMM  83

Query  326  DIIINSLYSNK  358
             +IINSLY NK
Sbjct  84   KLIINSLYRNK  94



>gb|ELK25961.1| Endoplasmin [Myotis davidii]
Length=1226

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_007454336.1| PREDICTED: endoplasmin [Lipotes vexillifer]
Length=803

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003461118.1| PREDICTED: endoplasmin isoform X1 [Cavia porcellus]
Length=807

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 13/82 (16%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQA V+R+M +IINSLY NK
Sbjct  76   FAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_005984835.1| PREDICTED: endoplasmin [Pantholops hodgsonii]
Length=804

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 13/82 (16%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQA V+R+M +IINSLY NK
Sbjct  76   FAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008255217.1| PREDICTED: endoplasmin [Oryctolagus cuniculus]
Length=802

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 13/82 (16%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQA V+R+M +IINSLY NK
Sbjct  76   FAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008062311.1| PREDICTED: endoplasmin isoform X1 [Tarsius syrichta]
Length=804

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 13/82 (16%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQA V+R+M +IINSLY NK
Sbjct  76   FAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004602837.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin [Sorex araneus]
Length=759

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ E+D D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDELDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_007893493.1| PREDICTED: endoplasmin [Callorhinchus milii]
Length=805

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = +2

Query  143  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  298
            A   +D P+    VEE +G    G  TD +V KRE E++          + LR  +EKF 
Sbjct  17   ASARADEPLADETVEEDLGKSRDGSKTDDEVTKREEEAIQLDGLNPAQIKELRDKSEKFV  76

Query  299  FQAXVSRLMDIIINSLYSNK  358
            FQA V+R+M +IINSLY NK
Sbjct  77   FQAEVNRMMKLIINSLYKNK  96



>ref|NP_999268.1| endoplasmin precursor [Sus scrofa]
 emb|CAA70347.1| gp96/GRP94 [Sus scrofa]
Length=804

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EVD D  V     EE +G    G  TD ++ +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEIVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008657579.1| PREDICTED: acyl-protein thioesterase 1-like [Zea mays]
Length=130

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  128  KIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREA  250
            K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+R A
Sbjct  90   KLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQRCA  130



>ref|XP_007950582.1| PREDICTED: endoplasmin [Orycteropus afer afer]
Length=804

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD +  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVEGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_008841379.1| PREDICTED: endoplasmin [Nannospalax galili]
Length=804

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004999393.1| PREDICTED: endoplasmin isoform X2 [Cavia porcellus]
Length=863

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 13/82 (16%)
 Frame = +2

Query  137  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  292
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  293  FEFQAXVSRLMDIIINSLYSNK  358
            F FQA V+R+M +IINSLY NK
Sbjct  76   FAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004675798.1| PREDICTED: endoplasmin [Condylura cristata]
Length=803

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 14/84 (17%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + AN EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAN-EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQLRELREKS  72

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  73   EKFAFQAEVNRMMKLIINSLYKNK  96



>ref|XP_001365625.1| PREDICTED: endoplasmin [Monodelphis domestica]
Length=804

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = +2

Query  149  VDSDAPVD-PPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            V +D PVD    VEE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  20   VKADDPVDVEATVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  79

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  80   QAEVNRMMKLIINSLYKNK  98



>ref|XP_004650619.1| PREDICTED: endoplasmin [Jaculus jaculus]
Length=806

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD +  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVEGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003202424.1| PREDICTED: endoplasmin [Meleagris gallopavo]
Length=795

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD+DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDADATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>gb|KHN42517.1| Endoplasmin like [Glycine soja]
Length=58

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = +2

Query  128  KIH----ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREA  250
            KIH    ANAE DS+  VDPPKVE+KI  VPHGLSTD D  KR A
Sbjct  6    KIHQMFLANAEGDSNELVDPPKVEDKIDVVPHGLSTDSDAFKRCA  50



>ref|XP_006871146.1| PREDICTED: endoplasmin [Chrysochloris asiatica]
Length=794

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EKF F
Sbjct  23   EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>gb|AAK74072.1| heat shock protein gp96 precursor [Homo sapiens]
Length=782

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EKF F
Sbjct  3    EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAF  57

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  58   QAEVNRMMKLIINSLYKNK  76



>ref|XP_009861771.1| PREDICTED: endoplasmin-like [Ciona intestinalis]
Length=826

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = +2

Query  134  HANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAE  289
            H  ++ +     D PKVE  IG    G  TD +V +RE ES+          + LR  +E
Sbjct  21   HVKSDDEGTTSDDTPKVEPDIGKAADGSKTDDEVVQREEESIHLDGLSPSEVKQLREQSE  80

Query  290  KFEFQAXVSRLMDIIINSLYSNK  358
            K  FQA V+R+M +IINSLY NK
Sbjct  81   KHVFQAEVNRMMKLIINSLYRNK  103



>ref|XP_002752963.1| PREDICTED: endoplasmin [Callithrix jacchus]
Length=804

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EVD D  V     E  +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EADLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_004446859.1| PREDICTED: endoplasmin isoform 1 [Dasypus novemcinctus]
Length=805

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EV  D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVHVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|ADY39524.1| putative heat shock protein gp-96 [Hottentotta judaicus]
Length=171

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQA  307
            + D   +  KVE+ +G       TD +  KRE E++          + +R  AEKF FQA
Sbjct  22   EEDEAENEIKVEDDLGSSREASRTDDEAVKREEEAIKLDGLSVSQIKEMREKAEKFAFQA  81

Query  308  XVSRLMDIIINSLYSNK  358
             V+R+M +IINSLY NK
Sbjct  82   EVNRMMKLIINSLYRNK  98



>ref|XP_004446860.1| PREDICTED: endoplasmin isoform 2 [Dasypus novemcinctus]
Length=807

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ EV  D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVHVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|AAA48827.1| 108K heat shock protein [Gallus gallus]
Length=795

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>ref|XP_007527982.1| PREDICTED: endoplasmin [Erinaceus europaeus]
Length=805

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = +2

Query  182  VEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAXVSRLMDIII  337
            VEE +G    G  TD +V +RE E++          R LR  +EKF FQA V+R+M +II
Sbjct  32   VEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLII  91

Query  338  NSLYSNK  358
            NSLY NK
Sbjct  92   NSLYKNK  98



>dbj|BAI23208.1| heat shock protein 90kDa beta (Grp94), member 1 [Coturnix japonica]
Length=794

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>ref|NP_989620.1| endoplasmin precursor [Gallus gallus]
 sp|P08110.1|ENPL_CHICK RecName: Full=Endoplasmin; AltName: Full=Heat shock 108 kDa protein; 
Short=HSP 108; Short=HSP108; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Transferrin-binding 
protein; Flags: Precursor [Gallus gallus]
 gb|AAA48826.1| heat shock protein 108 [Gallus gallus]
Length=795

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>gb|ACF35012.1| heat shock protein 108 [Gallus gallus]
Length=790

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>emb|CAA28629.1| hsp 108 [Gallus gallus]
Length=792

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  78   QAEVNRMMKLIINSLYKNK  96



>ref|XP_004700402.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin, partial [Echinops 
telfairi]
Length=796

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = +2

Query  182  VEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAXVSRLMDIII  337
            VEE +G    G  TD +V +RE E++          R LR  +EKF FQA V+R+M +II
Sbjct  30   VEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLII  89

Query  338  NSLYSNK  358
            NSLY NK
Sbjct  90   NSLYKNK  96



>ref|NP_001084280.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Xenopus 
laevis]
 gb|AAO21339.1| heat shock protein gp96 [Xenopus laevis]
Length=804

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            +HA  +V+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct  19   VHAEDDVEVDATV-----EDDIGKSRDGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_001662951.1| AAEL012827-PA [Aedes aegypti]
 gb|EAT34979.1| AAEL012827-PA [Aedes aegypti]
Length=795

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 9/80 (11%)
 Frame = +2

Query  143  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  298
            AE D+D   D P VE  +G    G  TD +  +RE E++          + LR  +EKF 
Sbjct  22   AEDDADIE-DLPVVEMNLGASKEGSRTDAEAVQREEEAIKLDGLNVSQIKELREKSEKFT  80

Query  299  FQAXVSRLMDIIINSLYSNK  358
            FQA V+R+M +IINSLY NK
Sbjct  81   FQAEVNRMMKLIINSLYRNK  100



>ref|XP_003745792.1| PREDICTED: endoplasmin-like [Metaseiulus occidentalis]
Length=785

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 8/74 (11%)
 Frame = +2

Query  161  APVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTL--------RAGAEKFEFQAXVS  316
            A  DP +VE+ IG +  G  TD +V  RE E++   +L        R  AEK  FQA V+
Sbjct  26   ANFDPTRVEDDIGKMAEGGRTDAEVVGREEEAIKIDSLSVSQLKEIRDKAEKQVFQAEVA  85

Query  317  RLMDIIINSLYSNK  358
            R+M +IINSLY NK
Sbjct  86   RMMKLIINSLYRNK  99



>ref|NP_001039228.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Xenopus 
(Silurana) tropicalis]
 emb|CAJ82870.1| tumor rejection antigen (gp96) 1 [Xenopus (Silurana) tropicalis]
 gb|AAI21251.1| heat shock protein 90kDa beta (Grp94), member 1 [Xenopus (Silurana) 
tropicalis]
Length=803

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + LR  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSRDGSRTDDEVVSREEEAIQIDGLNAAQIKELREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>gb|KFP55508.1| Endoplasmin, partial [Cariama cristata]
Length=782

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD D  V     E+ +G    G  TD +V +RE ES+          + +R  AEKF F
Sbjct  11   EVDVDGTV-----EDDLGKSREGSRTDDEVVQREEESIQLDGLNASQIKEIREKAEKFAF  65

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  66   QAEVNRMMKLIINSLYKNK  84



>ref|XP_009700867.1| PREDICTED: endoplasmin, partial [Cariama cristata]
Length=777

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 13/79 (16%)
 Frame = +2

Query  146  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  301
            EVD D  V     E+ +G    G  TD +V +RE ES+          + +R  AEKF F
Sbjct  6    EVDVDGTV-----EDDLGKSREGSRTDDEVVQREEESIQLDGLNASQIKEIREKAEKFAF  60

Query  302  QAXVSRLMDIIINSLYSNK  358
            QA V+R+M +IINSLY NK
Sbjct  61   QAEVNRMMKLIINSLYKNK  79



>gb|ETE69540.1| Endoplasmin, partial [Ophiophagus hannah]
Length=916

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +2

Query  143  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  298
            A   +D P     VE+ +G    G  TD +V +RE ES+          + LR  +EKF 
Sbjct  147  ASAQADEPDVDGTVEDDLGKSREGSRTDDEVVQREEESIQLDGLNASQIKQLREKSEKFA  206

Query  299  FQAXVSRLMDIIINSLYSNK  358
            FQA V+R+M +IINSLY NK
Sbjct  207  FQAEVNRMMKLIINSLYKNK  226



>ref|XP_002428463.1| Hsp90 protein, putative [Pediculus humanus corporis]
 gb|EEB15725.1| Hsp90 protein, putative [Pediculus humanus corporis]
Length=778

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 8/72 (11%)
 Frame = +2

Query  167  VDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAXVSRL  322
            V+   VE  +G     L TD +V +RE E++          + LR  AEKF FQA V+R+
Sbjct  31   VETVTVEPDLGASREALRTDDNVVQREEEAIKLDGLNVAQIKELREKAEKFHFQAEVNRM  90

Query  323  MDIIINSLYSNK  358
            M +IINSLY NK
Sbjct  91   MKLIINSLYRNK  102



>ref|NP_001083114.1| uncharacterized protein LOC398753 precursor [Xenopus laevis]
 gb|AAH60352.1| MGC68448 protein [Xenopus laevis]
Length=805

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSREGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS  73

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNK  97



>ref|XP_003772640.1| PREDICTED: endoplasmin-like [Sarcophilus harrisii]
Length=803

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 13/84 (15%)
 Frame = +2

Query  131  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  286
            + A+ ++D +A V     EE +G    G  TD +V +RE E++          + LR  +
Sbjct  20   VKADDQLDVEATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKELREKS  74

Query  287  EKFEFQAXVSRLMDIIINSLYSNK  358
            EKF FQA V+R+M +IINSLY NK
Sbjct  75   EKFAFQAEVNRMMKLIINSLYKNK  98



>gb|ETN62729.1| endoplasmin [Anopheles darlingi]
Length=813

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 11/85 (13%)
 Frame = +2

Query  128  KIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAG  283
            ++ A A+ D D     P V+  +G    G  TD +  KRE E++          + LR  
Sbjct  31   QVRAEADDDDDTL---PLVDNNLGASKEGSRTDAEAVKREEEAIKLDGLNVAQIKELREK  87

Query  284  AEKFEFQAXVSRLMDIIINSLYSNK  358
            +EKF FQA V+R+M +IINSLY NK
Sbjct  88   SEKFTFQAEVNRMMKLIINSLYRNK  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565659253830