BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002H10

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605963.1|  PREDICTED: BTB/POZ domain-containing protein...    168   4e-46   Nicotiana tomentosiformis
ref|XP_009769017.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-44   Nicotiana sylvestris
ref|XP_006365098.1|  PREDICTED: BTB/POZ domain-containing protein...    159   9e-43   Solanum tuberosum [potatoes]
ref|XP_004230913.1|  PREDICTED: BTB/POZ domain-containing protein...    157   2e-42   Solanum lycopersicum
ref|XP_004230912.1|  PREDICTED: BTB/POZ domain-containing protein...    156   9e-42   Solanum lycopersicum
ref|XP_003631650.1|  PREDICTED: BTB/POZ domain-containing protein...    133   1e-33   Vitis vinifera
emb|CAN67577.1|  hypothetical protein VITISV_015330                     135   1e-33   Vitis vinifera
ref|XP_011088392.1|  PREDICTED: BTB/POZ domain-containing protein...    115   6e-27   Sesamum indicum [beniseed]
ref|XP_010263676.1|  PREDICTED: BTB/POZ domain-containing protein...    109   6e-25   Nelumbo nucifera [Indian lotus]
gb|EYU37795.1|  hypothetical protein MIMGU_mgv1a005092mg                108   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_010107848.1|  hypothetical protein L484_027435                 92.4    1e-18   Morus notabilis
ref|XP_010254858.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    4e-18   Nelumbo nucifera [Indian lotus]
gb|KDP46249.1|  hypothetical protein JCGZ_10089                       89.7    8e-18   Jatropha curcas
ref|XP_006592105.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    3e-17   Glycine max [soybeans]
ref|XP_003537876.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    9e-17   Glycine max [soybeans]
ref|XP_007131838.1|  hypothetical protein PHAVU_011G045500g           83.6    1e-15   Phaseolus vulgaris [French bean]
ref|XP_006423255.1|  hypothetical protein CICLE_v10028323mg           82.4    3e-15   Citrus clementina [clementine]
ref|XP_003606902.1|  hypothetical protein MTR_4g070010                81.6    6e-15   Medicago truncatula
ref|XP_002305426.2|  hypothetical protein POPTR_0004s16200g           81.6    7e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011092786.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    2e-14   Sesamum indicum [beniseed]
gb|KDO49087.1|  hypothetical protein CISIN_1g012309mg                 79.0    4e-14   Citrus sinensis [apfelsine]
ref|NP_001274393.1|  BTB/POZ domain-containing protein At1g63850-...  77.8    1e-13   Cucumis sativus [cucumbers]
ref|XP_011037531.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    2e-13   Populus euphratica
gb|KHG28215.1|  hypothetical protein F383_15738                       77.4    2e-13   Gossypium arboreum [tree cotton]
ref|XP_007042204.1|  BTB/POZ domain-containing protein isoform 2      76.3    3e-13   
ref|XP_007042205.1|  BTB/POZ domain-containing protein isoform 3      75.5    6e-13   
ref|XP_007042203.1|  BTB/POZ domain-containing protein isoform 1      75.5    7e-13   Theobroma cacao [chocolate]
ref|XP_008447033.1|  PREDICTED: BTB/POZ domain-containing protein...  73.2    5e-12   Cucumis melo [Oriental melon]
gb|KJB79192.1|  hypothetical protein B456_013G037300                  72.8    7e-12   Gossypium raimondii
ref|XP_004292039.2|  PREDICTED: BTB/POZ domain-containing protein...  67.8    3e-10   Fragaria vesca subsp. vesca
ref|XP_007199822.1|  hypothetical protein PRUPE_ppa005350mg           67.0    5e-10   
gb|KJB47493.1|  hypothetical protein B456_008G028700                  66.6    6e-10   Gossypium raimondii
gb|KJB47492.1|  hypothetical protein B456_008G028700                  66.6    7e-10   Gossypium raimondii
gb|KJB47491.1|  hypothetical protein B456_008G028700                  66.2    7e-10   Gossypium raimondii
ref|XP_004507442.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    2e-09   Cicer arietinum [garbanzo]
gb|KHF97793.1|  hypothetical protein F383_14636                       64.7    3e-09   Gossypium arboreum [tree cotton]
ref|XP_010530839.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    9e-09   Tarenaya hassleriana [spider flower]
ref|XP_010530838.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_002509483.1|  protein binding protein, putative                62.0    3e-08   Ricinus communis
ref|XP_008236884.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    4e-08   Prunus mume [ume]
ref|XP_008356920.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    6e-08   
ref|XP_010690889.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    6e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006856016.1|  hypothetical protein AMTR_s00059p00043870        58.9    2e-07   
ref|XP_010942021.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    3e-07   
ref|XP_010942018.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    4e-07   
ref|XP_008377314.1|  PREDICTED: BTB/POZ domain-containing protein...  57.8    7e-07   Malus domestica [apple tree]
ref|XP_009374197.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_010935064.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    3e-06   Elaeis guineensis
ref|XP_008787306.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    3e-05   Phoenix dactylifera
ref|XP_009392960.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785748.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    1e-04   Phoenix dactylifera
gb|EPS62964.1|  hypothetical protein M569_11824                       50.8    1e-04   Genlisea aurea
ref|XP_010942871.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    1e-04   Elaeis guineensis



>ref|XP_009605963.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nicotiana 
tomentosiformis]
Length=512

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 13/151 (9%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLP---------ISS  218
            KKRQR GS++RLSST+  IDSSRPD  L E S KP  +RRT+SH+ +P          ++
Sbjct  16   KKRQRVGSNSRLSSTIGIIDSSRPDNTLTERSQKPPGIRRTSSHTVIPSSSTAAAAAAAA  75

Query  219  RGAFNDSASADTVLRLYVD-CP-FDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEA  392
             G FNDS+SAD VLRL+VD  P FD DD+ESISAVDS DQSDVQIYLHSD+LRRC+YF A
Sbjct  76   SGGFNDSSSADVVLRLFVDQLPLFDTDDSESISAVDS-DQSDVQIYLHSDILRRCKYFAA  134

Query  393  LLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
            LLS+RW  ES D   DSG++S+  R +LGVP
Sbjct  135  LLSDRWQKESNDVV-DSGNSSRTFRLNLGVP  164



>ref|XP_009769017.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nicotiana 
sylvestris]
Length=506

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 13/151 (9%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISS---------  218
            KKRQR GS++RLSST+  IDSSRPD  L E S KPS +RRT+SH+ +P SS         
Sbjct  16   KKRQRVGSNSRLSSTIGIIDSSRPDNNLTERSQKPSGIRRTSSHTVIPSSSTAAGAAAAG  75

Query  219  RGAFNDSASADTVLRLYVD-CP-FDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEA  392
             G FNDS++AD VLRL+VD  P FD DD+ESISAVDS DQSDVQIYLHSD++RRC+YF A
Sbjct  76   CGGFNDSSTADVVLRLFVDQLPLFDTDDSESISAVDS-DQSDVQIYLHSDIIRRCKYFAA  134

Query  393  LLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
            LLS+RW  ES D   DS ++S+  R +LGVP
Sbjct  135  LLSDRWQKESNDVV-DSRNSSRTFRLNLGVP  164



>ref|XP_006365098.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Solanum 
tuberosum]
Length=505

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 109/146 (75%), Gaps = 9/146 (6%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA----FN  233
            KKRQR+GS +RLSST+  IDSSRPD  L E + K S +RRTASH+ +  SS  A    FN
Sbjct  18   KKRQRSGSYSRLSSTIGIIDSSRPDNTLTERTQKTSGIRRTASHTFIAPSSSAAVSRGFN  77

Query  234  DSASADTVLRLYVD-CP-FDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSER  407
            DSA+AD VLRL+VD  P FD DD+ESISAVDS DQSDVQIYLHSDVL R +YF  LLS+R
Sbjct  78   DSATADVVLRLFVDQLPLFDTDDSESISAVDS-DQSDVQIYLHSDVLCRSKYFATLLSDR  136

Query  408  WLNESKDTAGDSGSASKMHRFSLGVP  485
            W  ES D   DSG++S++ R +LGVP
Sbjct  137  WQKESNDV--DSGNSSRIFRLNLGVP  160



>ref|XP_004230913.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Solanum lycopersicum]
Length=428

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 107/146 (73%), Gaps = 9/146 (6%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA----FN  233
            KKRQR+GS +RLSSTV  IDSSRPD  L E + K S +RRTAS + +  SS  A    FN
Sbjct  20   KKRQRSGSYSRLSSTVGIIDSSRPDNTLTERTQKTSGIRRTASQAFIAPSSSAAVSRGFN  79

Query  234  DSASADTVLRLYVD-CP-FDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSER  407
            DSA+AD VLRL+VD  P FD DD+ESISAVDS DQSDVQIYLHSDVL R +YF  LLS+R
Sbjct  80   DSATADVVLRLFVDQLPLFDTDDSESISAVDS-DQSDVQIYLHSDVLCRSKYFATLLSDR  138

Query  408  WLNESKDTAGDSGSASKMHRFSLGVP  485
            W  ES D   DSG++ +M R +LGVP
Sbjct  139  WQKESNDV--DSGNSLRMFRLNLGVP  162



>ref|XP_004230912.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Solanum lycopersicum]
Length=507

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 107/146 (73%), Gaps = 9/146 (6%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA----FN  233
            KKRQR+GS +RLSSTV  IDSSRPD  L E + K S +RRTAS + +  SS  A    FN
Sbjct  20   KKRQRSGSYSRLSSTVGIIDSSRPDNTLTERTQKTSGIRRTASQAFIAPSSSAAVSRGFN  79

Query  234  DSASADTVLRLYVD-CP-FDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSER  407
            DSA+AD VLRL+VD  P FD DD+ESISAVDS DQSDVQIYLHSDVL R +YF  LLS+R
Sbjct  80   DSATADVVLRLFVDQLPLFDTDDSESISAVDS-DQSDVQIYLHSDVLCRSKYFATLLSDR  138

Query  408  WLNESKDTAGDSGSASKMHRFSLGVP  485
            W  ES D   DSG++ +M R +LGVP
Sbjct  139  WQKESNDV--DSGNSLRMFRLNLGVP  162



>ref|XP_003631650.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Vitis 
vinifera]
Length=488

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 97/141 (69%), Gaps = 10/141 (7%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            KKRQR G ++RLSST A IDS   +  + E SHKPS  RRT+S + +     G FNDSAS
Sbjct  11   KKRQRIGCNSRLSSTGAVIDSCCLEGTVTEASHKPSGPRRTSSSATIS----GGFNDSAS  66

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            +D VLRL+++ CP  D D+ESIS VDS  Q D+QIYLHSDV+RR +YF ALLS+RW  +S
Sbjct  67   SDVVLRLFLEPCP-SDSDSESISTVDSFVQDDLQIYLHSDVIRRSKYFSALLSDRWQGDS  125

Query  423  KDTAGDSGSASKMHRFSLGVP  485
                GD   + K++R + GVP
Sbjct  126  ----GDGDDSPKIYRLNFGVP  142



>emb|CAN67577.1| hypothetical protein VITISV_015330 [Vitis vinifera]
Length=686

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 97/141 (69%), Gaps = 10/141 (7%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            KKRQR G ++RLSST A IDS   +  + E SHKPS  RRT+S + +     G FNDSAS
Sbjct  11   KKRQRIGCNSRLSSTGAVIDSCCLEGTVTEASHKPSGPRRTSSSATI----SGGFNDSAS  66

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            AD VLRL+++ CP  D D+ESIS VDS  Q D+QIYLHSDV+RR +YF ALLS+RW  +S
Sbjct  67   ADVVLRLFLEPCP-SDSDSESISTVDSFVQDDLQIYLHSDVIRRSKYFSALLSDRWQGDS  125

Query  423  KDTAGDSGSASKMHRFSLGVP  485
                GD   + K++R + GVP
Sbjct  126  ----GDGDDSPKIYRLNFGVP  142



>ref|XP_011088392.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Sesamum 
indicum]
Length=499

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 4/144 (3%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPI--SSRGAFNDS  239
            KK+QR GS+NRLSST+A +DSS  D  L E S+KP +LRR++SHS LPI  S  G FND+
Sbjct  9    KKKQRVGSNNRLSSTLADLDSSLSDGTLAEGSYKPPSLRRSSSHSLLPIVSSCAGGFNDA  68

Query  240  ASADTVLRLYVDCPFDDDDAESISA--VDSLDQSDVQIYLHSDVLRRCEYFEALLSERWL  413
            A+AD +L L +D  +   +    S+     LDQS++QIYLHS VLRR +YF ALLSERW 
Sbjct  69   ATADVILSLLLDQQYSQFELPEASSDTTSPLDQSEIQIYLHSHVLRRSKYFTALLSERWQ  128

Query  414  NESKDTAGDSGSASKMHRFSLGVP  485
             +++ ++ +S +A K++RF L VP
Sbjct  129  QQNESSSNNSDNAPKVYRFKLSVP  152



>ref|XP_010263676.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nelumbo 
nucifera]
Length=483

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 87/140 (62%), Gaps = 8/140 (6%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            KKRQR GSS+ LS T A I+S RPD  + E S KP  LRR     HLP SS   FND ++
Sbjct  7    KKRQRVGSSSHLS-TFADIESPRPDGTITEISQKPLGLRRL----HLP-SSSCNFNDPSN  60

Query  246  ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK  425
            AD +L LY++    D D + IS V S+D+ ++Q++LHSD+LRR +YF ALLS+RW  + K
Sbjct  61   ADVILHLYLESSLFDPDPDLISCVGSVDEDNIQLHLHSDILRRSKYFSALLSDRW--KRK  118

Query  426  DTAGDSGSASKMHRFSLGVP  485
                 S     + R +L VP
Sbjct  119  SGDDSSDDLDGILRLNLKVP  138



>gb|EYU37795.1| hypothetical protein MIMGU_mgv1a005092mg [Erythranthe guttata]
Length=497

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 100/143 (70%), Gaps = 3/143 (2%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPI---SSRGAFND  236
            KK+QRTGS++RLSS +A IDSS  D  L E SHK  +LRR++SHS LP+   SS G FND
Sbjct  8    KKKQRTGSNSRLSSVLAEIDSSYNDGTLAEGSHKSPSLRRSSSHSLLPLSAPSSAGGFND  67

Query  237  SASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLN  416
            +A+AD +L L +D  +   D    S+  ++DQS++QI+LHS VLRR +YF ALLS+RW  
Sbjct  68   AATADVILSLVLDQQYPLADFSEASSDATVDQSEIQIHLHSHVLRRSKYFAALLSDRWQQ  127

Query  417  ESKDTAGDSGSASKMHRFSLGVP  485
            +++ ++ +     K+HR++L VP
Sbjct  128  QNESSSNNPEIPPKIHRYNLTVP  150



>ref|XP_010107848.1| hypothetical protein L484_027435 [Morus notabilis]
 gb|EXC17248.1| hypothetical protein L484_027435 [Morus notabilis]
Length=501

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 83/144 (58%), Gaps = 19/144 (13%)
 Frame = +3

Query  81   TGSSNRLSSTVAAI-DSSRPDEILDECSHKPSALRRTASHSHLPISS-RGAFNDSASADT  254
            T SS RLSST A I DS+  ++ L + S  PS+          P S+ + AFNDS+SAD 
Sbjct  24   TASSRRLSSTAAVIIDSTVSNKTLTQASQSPSSTN--------PFSAAKTAFNDSSSADV  75

Query  255  VLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESKDT  431
            VLRL+V+  PF+        +  +   S+V +YLHS VLRRC+YF ALLS+RW N+ +D 
Sbjct  76   VLRLFVEPSPFESSSDPESPSTAT--DSEVVLYLHSHVLRRCKYFAALLSDRWRNDDRDV  133

Query  432  AGDSG------SASKMHRFSLGVP  485
               SG      SA    R SLGVP
Sbjct  134  GDGSGQDRDGDSADDFIRISLGVP  157



>ref|XP_010254858.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Nelumbo 
nucifera]
Length=489

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 11/144 (8%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA--FNDS  239
            KKRQR GSS+RLS+  A I+ SR D  L E SH P   RR     HLP SS  +  FN+ 
Sbjct  8    KKRQRVGSSSRLSA-FADIEFSRTDATLTEISHNPLGFRRL----HLPSSSSSSSSFNNP  62

Query  240  ASADTVLRLYVDCPFDDDDAES--ISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWL  413
            A+AD +LRLY++    D D +   +S+V S D+ D+Q++LHS+VLRR +YF ALLS+R  
Sbjct  63   ATADIILRLYLEPSPFDPDPDPDLVSSVGSADEEDIQLHLHSNVLRRSKYFSALLSDR--  120

Query  414  NESKDTAGDSGSASKMHRFSLGVP  485
             + K     S  +  + R +L VP
Sbjct  121  CKRKSADDSSDVSDGIIRLNLKVP  144



>gb|KDP46249.1| hypothetical protein JCGZ_10089 [Jatropha curcas]
Length=511

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 79/141 (56%), Gaps = 33/141 (23%)
 Frame = +3

Query  66   KKRQR------------TGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLP  209
            KKRQR            + ++ RLSST A IDS   D+ + E S K   LRRT+SH   P
Sbjct  6    KKRQRVLHHRYLSSANASATTTRLSSTAALIDSFS-DKTITETSQK---LRRTSSHPLFP  61

Query  210  ISSR------------GAFNDSASADTVLRLYVDC--PFDDDDAESISAVDSLDQSDVQI  347
             S+              +FND  +AD +LRL++D   PF D D    S+V   +QSDVQI
Sbjct  62   SSTSYSSYAFTTTNADTSFNDPTTADVILRLFLDATAPFTDGDG-CFSSVG--EQSDVQI  118

Query  348  YLHSDVLRRCEYFEALLSERW  410
            YLHS VLRR +YF ALLS+RW
Sbjct  119  YLHSQVLRRAKYFSALLSDRW  139



>ref|XP_006592105.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=485

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 78/142 (55%), Gaps = 10/142 (7%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA-FNDSA  242
            KKRQRT ++ R SST+A I SS  D  L E SH P            P +     +ND+A
Sbjct  4    KKRQRTTAACRSSSTLATI-SSLSDVTLTEISHNPRPSSPMPDDRPSPAAEDALHYNDAA  62

Query  243  SADTVLRLYVDC--PFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLN  416
            +AD VLRL++D   P     A+S+S       SD+ +YLHSDVLRR +YF ALLS+RW+ 
Sbjct  63   TADVVLRLFIDASSPLYSATADSVS------NSDLHVYLHSDVLRRSKYFSALLSDRWIG  116

Query  417  ESKDTAGDSGSASKMHRFSLGV  482
                    S S   + R +LGV
Sbjct  117  HVHSPEHSSSSNRDLFRLNLGV  138



>ref|XP_003537876.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Glycine 
max]
Length=493

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 78/145 (54%), Gaps = 16/145 (11%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA-FNDSA  242
            KKRQRT ++NR SSTV  I SS  D  L E S  P            P +     +ND++
Sbjct  9    KKRQRTTAANRSSSTVGTI-SSLSDVTLIEISQNPRPSSPMTDDRPSPAAEDALHYNDAS  67

Query  243  SADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            +AD VLRL++D P         S +DS+  SD  +YLHSDVLRR +YF ALLS+RW+   
Sbjct  68   TADVVLRLFIDAP---------SPLDSVSNSDHHVYLHSDVLRRSKYFSALLSDRWIGHV  118

Query  423  KDTAGDSGSASK-----MHRFSLGV  482
                  S S ++     + R +LGV
Sbjct  119  APELSSSSSCNRDRDLDLFRLNLGV  143



>ref|XP_007131838.1| hypothetical protein PHAVU_011G045500g [Phaseolus vulgaris]
 gb|ESW03832.1| hypothetical protein PHAVU_011G045500g [Phaseolus vulgaris]
Length=508

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 79/152 (52%), Gaps = 13/152 (9%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA------  227
            KKRQRT ++ R SSTV  I SS  D  L E S  P         S  P++   +      
Sbjct  9    KKRQRTTAARRSSSTVGTI-SSVSDVTLTEISQNPHRPSPMGDDSPSPMADDRSSSSTDE  67

Query  228  ---FNDSASADTVLRLYVDCPF---DDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFE  389
               FND+ +AD VLRL++D P        A + +  D +  SD  +YLHSD+LRR +YF 
Sbjct  68   ALHFNDAVTADVVLRLFMDSPSPLQSSPTATATATADCVSNSDFHVYLHSDILRRSKYFS  127

Query  390  ALLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
            ALLS+RW+   +     S +   + R +LGVP
Sbjct  128  ALLSDRWIGHVQAPDHASSADGDLFRLNLGVP  159



>ref|XP_006423255.1| hypothetical protein CICLE_v10028323mg [Citrus clementina]
 ref|XP_006487149.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
 gb|ESR36495.1| hypothetical protein CICLE_v10028323mg [Citrus clementina]
Length=484

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 9/89 (10%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSE  404
            +FN+S++AD +LRLYVD        ++   V+S    DVQIYLHS+VLRR +YF ALLS+
Sbjct  58   SFNESSTADVILRLYVDI-------DAPYTVNSTTGDDVQIYLHSNVLRRSKYFAALLSD  110

Query  405  RWLNESKDT--AGDSGSASKMHRFSLGVP  485
            RWLN + DT  A D+ +  K+ R + GVP
Sbjct  111  RWLNPNPDTNNAFDTDNEHKILRLNFGVP  139



>ref|XP_003606902.1| hypothetical protein MTR_4g070010 [Medicago truncatula]
 gb|AES89099.1| BTB/POZ domain plant-like protein, putative [Medicago truncatula]
Length=487

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 16/142 (11%)
 Frame = +3

Query  66   KKRQRTGSSN-RLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSA  242
            +KRQRT ++  R+SST A  +SS  D  +++  H  S           P +S   FNDS+
Sbjct  9    RKRQRTTTTTTRISSTAAIANSSFFD--INQNHHCLS-----------PTTSAFLFNDSS  55

Query  243  SADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            +AD +LRL+ D     +   SIS VDS   SD+ +YLHSD+LRR +YF ALLS+RW+N  
Sbjct  56   TADVILRLFTDTITPPESPSSIS-VDSAPISDLHVYLHSDILRRAKYFSALLSDRWINNV  114

Query  423  -KDTAGDSGSASKMHRFSLGVP  485
                + +  +  ++ R +LGVP
Sbjct  115  HPQPSPEQITDHELFRLNLGVP  136



>ref|XP_002305426.2| hypothetical protein POPTR_0004s16200g [Populus trichocarpa]
 gb|EEE85937.2| hypothetical protein POPTR_0004s16200g [Populus trichocarpa]
Length=508

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 11/119 (9%)
 Frame = +3

Query  72   RQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA----FNDS  239
            R     S  LSST A IDS  PD+ + E S K   LRRT+SH  L  +        FND 
Sbjct  27   RSTASRSTSLSSTAALIDSF-PDQTISETSKK---LRRTSSHPLLSTTPSSTTTTRFNDV  82

Query  240  ASADTVLRLYVD--CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERW  410
             +AD +LRL++D   P  +  ++S+ ++D+ +QS+VQIYLHS +LRR +YF ALLS+RW
Sbjct  83   NTADVILRLFLDPTSPIINL-SDSVYSIDNNNQSNVQIYLHSPILRRSKYFSALLSDRW  140



>ref|XP_011092786.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Sesamum 
indicum]
Length=514

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (58%), Gaps = 11/149 (7%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRG---AFND  236
            KK+QR GS++   S+  A++ S  +    E  HKP A+  ++SHS  P+SS      FND
Sbjct  21   KKKQRVGSNSL-LSSSLAVNDSFSEGNPAESRHKPPAIPLSSSHSMFPVSSSSTSCGFND  79

Query  237  SASADTVLRLYVD---CPFDDDDA--ESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLS  401
             A+ D +L L +D    PFD  +   ES S+V +L Q    IYLHS VL R +YF ALLS
Sbjct  80   PATGDVILSLRLDRQSSPFDCVEVPFES-SSVATLGQPVTHIYLHSRVLCRSKYFSALLS  138

Query  402  ERWLNESKDTAGDSGSAS-KMHRFSLGVP  485
            +RW   +  ++ +   +S K++RF L VP
Sbjct  139  DRWRQRNDTSSSNQAESSHKINRFHLVVP  167



>gb|KDO49087.1| hypothetical protein CISIN_1g012309mg [Citrus sinensis]
Length=466

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 9/88 (10%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSE  404
            +FN+S++AD +LRLYVD        ++   V+S    DVQIYLHS+VLRR +YF ALLS+
Sbjct  40   SFNESSTADVILRLYVDI-------DAPYTVNSTTGDDVQIYLHSNVLRRSKYFAALLSD  92

Query  405  RWLNESKDT--AGDSGSASKMHRFSLGV  482
            RWLN + DT  A D+ +  K+ R + GV
Sbjct  93   RWLNPNPDTNNAFDTDNEHKILRLNFGV  120



>ref|NP_001274393.1| BTB/POZ domain-containing protein At1g63850-like [Cucumis sativus]
 gb|AGZ83151.1| BTB/POZ domain-containing zinc finger protein [Cucumis sativus]
 gb|KGN44351.1| hypothetical protein Csa_7G268480 [Cucumis sativus]
Length=480

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 73/118 (62%), Gaps = 16/118 (14%)
 Frame = +3

Query  135  PDEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTVLRLYVDC-PFDDDDAESIS  311
            PD    E S KP  LRR++S S +P  + G+FND+++AD +LRLY +  PFD   ++S+S
Sbjct  34   PDNSSTEVSKKPHTLRRSSSFSSIP--AGGSFNDASTADVLLRLYSEVTPFDSSGSDSLS  91

Query  312  AVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
            +      SDVQIYLHS VLRR +YF ALLS+RW     D   DSG      R S GVP
Sbjct  92   S------SDVQIYLHSHVLRRSKYFSALLSDRWKPRKDD---DSGPL----RLSFGVP  136



>ref|XP_011037531.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=509

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = +3

Query  72   RQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA-----FND  236
            R     S  LSST AA+  S PD+ + E S K   LRRT+SH  L  +         FND
Sbjct  27   RSTASRSTSLSST-AALSDSFPDKAISETSKK---LRRTSSHPLLSTTPSSTTTITPFND  82

Query  237  SASADTVLRLYVD--CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERW  410
              +AD +LRL++D   P  +  ++S+ ++D+ +QS+VQIYLHS +L+R +YF ALLS+RW
Sbjct  83   VNTADVILRLFLDPTAPIINF-SDSVYSIDNKNQSNVQIYLHSRILQRSKYFSALLSDRW  141



>gb|KHG28215.1| hypothetical protein F383_15738 [Gossypium arboreum]
Length=502

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 81/143 (57%), Gaps = 22/143 (15%)
 Frame = +3

Query  66   KKRQRT----GSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGA--  227
            +KRQR      S+ RLSST   ++S   D+ + E S K   L RT+S +    +S  A  
Sbjct  7    RKRQRVPHRHTSATRLSSTATVVNSFS-DKTVSESSQK---LHRTSSAASTITTSPNAVT  62

Query  228  --FNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALL  398
              FND  +AD +LRL+VD  PFD D     +  DS  QSD+QIYLHS V+RR +YF A+L
Sbjct  63   SSFNDPYTADVLLRLFVDRSPFDSD-----APSDSSRQSDIQIYLHSAVIRRAKYFAAIL  117

Query  399  SERWLN----ESKDTAGDSGSAS  455
            S+ W +    ++K   G  GS S
Sbjct  118  SDCWQHRTNADAKSNNGAEGSRS  140



>ref|XP_007042204.1| BTB/POZ domain-containing protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX98035.1| BTB/POZ domain-containing protein isoform 2, partial [Theobroma 
cacao]
Length=425

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 31/149 (21%)
 Frame = +3

Query  3    NSRSIPQMKIgggggatgvaaKKRQRTG----SSNRLSSTVAAIDSSRPDEILDECSHKP  170
            NSR IP             + +KRQR      S+ R+SST AAI  +  D+ + E S K 
Sbjct  5    NSRMIPN------------SFRKRQRVPQHHISAMRISST-AAIMETFADKTMSESSQK-  50

Query  171  SALRRTASHSHLPISSRGA-----FNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQ  332
              LRRT+S S    S+        FND ++AD +LRL+++  PFD     S S  DS DQ
Sbjct  51   --LRRTSSSSTTATSTNPNTTTSSFNDPSTADVILRLFMEQSPFD-----SASPSDSADQ  103

Query  333  SDVQIYLHSDVLRRCEYFEALLSERWLNE  419
            SD+QIYLHS V+ R +YF ALLS+RW +E
Sbjct  104  SDIQIYLHSHVINRSKYFAALLSDRWQHE  132



>ref|XP_007042205.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOX98036.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=441

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 31/149 (21%)
 Frame = +3

Query  3    NSRSIPQMKIgggggatgvaaKKRQRTG----SSNRLSSTVAAIDSSRPDEILDECSHKP  170
            NSR IP             + +KRQR      S+ R+SST AAI  +  D+ + E S K 
Sbjct  5    NSRMIPN------------SFRKRQRVPQHHISAMRISST-AAIMETFADKTMSESSQK-  50

Query  171  SALRRTASHSHLPISSRGA-----FNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQ  332
              LRRT+S S    S+        FND ++AD +LRL+++  PFD     S S  DS DQ
Sbjct  51   --LRRTSSSSTTATSTNPNTTTSSFNDPSTADVILRLFMEQSPFD-----SASPSDSADQ  103

Query  333  SDVQIYLHSDVLRRCEYFEALLSERWLNE  419
            SD+QIYLHS V+ R +YF ALLS+RW +E
Sbjct  104  SDIQIYLHSHVINRSKYFAALLSDRWQHE  132



>ref|XP_007042203.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOX98034.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=508

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 31/149 (21%)
 Frame = +3

Query  3    NSRSIPQMKIgggggatgvaaKKRQRTG----SSNRLSSTVAAIDSSRPDEILDECSHKP  170
            NSR IP             + +KRQR      S+ R+SST AAI  +  D+ + E S K 
Sbjct  5    NSRMIPN------------SFRKRQRVPQHHISAMRISST-AAIMETFADKTMSESSQK-  50

Query  171  SALRRTASHSHLPISSRGA-----FNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQ  332
              LRRT+S S    S+        FND ++AD +LRL+++  PFD     S S  DS DQ
Sbjct  51   --LRRTSSSSTTATSTNPNTTTSSFNDPSTADVILRLFMEQSPFD-----SASPSDSADQ  103

Query  333  SDVQIYLHSDVLRRCEYFEALLSERWLNE  419
            SD+QIYLHS V+ R +YF ALLS+RW +E
Sbjct  104  SDIQIYLHSHVINRSKYFAALLSDRWQHE  132



>ref|XP_008447033.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Cucumis 
melo]
Length=480

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 87/145 (60%), Gaps = 20/145 (14%)
 Frame = +3

Query  66   KKRQRTG---SSNRLSSTVAAIDS-SRPDEILDECSHKPSALRRTASHSHLPISSRGAFN  233
            KKRQR     SS R SS VAA D    PD    E   KP +LRR++S S +P  + G+FN
Sbjct  7    KKRQRVQHSVSSTRNSSVVAAADCFPLPDNSSTEVCKKPHSLRRSSSFSSIP--AGGSFN  64

Query  234  DSASADTVLRLYVDC-PFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERW  410
            ++++AD +LRLY +  PFD   ++S+S+      SDVQIYLHS VLRR +YF ALLS+RW
Sbjct  65   EASTADVLLRLYSEVTPFDSSGSDSLSS------SDVQIYLHSHVLRRSKYFSALLSDRW  118

Query  411  LNESKDTAGDSGSASKMHRFSLGVP  485
                 D   DSG      + S GVP
Sbjct  119  KPRKDD---DSGPL----KLSFGVP  136



>gb|KJB79192.1| hypothetical protein B456_013G037300 [Gossypium raimondii]
Length=516

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 81/143 (57%), Gaps = 22/143 (15%)
 Frame = +3

Query  66   KKRQRT----GSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHL----PISSR  221
            +KRQR      S+ RLSST A + +S  D+ + E S K   L RT+S        P +  
Sbjct  7    RKRQRVPHRHTSATRLSST-ATVVNSFSDKTVSESSQK---LHRTSSSVSTITTSPNAVT  62

Query  222  GAFNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALL  398
             +FND  +AD +LRL+VD  PFD D     +  DS  QSD+QIYLHS V+RR +YF A+L
Sbjct  63   SSFNDPYTADVLLRLFVDRSPFDSD-----APSDSSRQSDIQIYLHSAVIRRAKYFAAIL  117

Query  399  SERWLN----ESKDTAGDSGSAS  455
            S+ W +    ++K   G  GS S
Sbjct  118  SDCWQHRTNADAKSNNGAEGSRS  140



>ref|XP_004292039.2| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Fragaria 
vesca subsp. vesca]
Length=500

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 76/147 (52%), Gaps = 29/147 (20%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDE--ILD-ECSH----KPSALRRTASHSHLPISSRG  224
            KKRQR  +    SST  +  +SRP    I+D   SH    KP+ L        LP     
Sbjct  34   KKRQRAAALAANSSTTTS--ASRPCAAIIIDSPTSHADLNKPNPLPHKPHDPSLP-----  86

Query  225  AFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSE  404
            +FND ASAD +LRL VD    D   +           DV +YLHS  LRRC+YF ALLS+
Sbjct  87   SFNDVASADVILRLSVDPTAADHSPD-----------DVVLYLHSACLRRCKYFAALLSD  135

Query  405  RWLNESKDTAGDSGSASKMHRFSLGVP  485
            RW  + +D   D+ SA+  +R +L VP
Sbjct  136  RW-QQHQD---DAVSAAAPYRINLEVP  158



>ref|XP_007199822.1| hypothetical protein PRUPE_ppa005350mg [Prunus persica]
 gb|EMJ01021.1| hypothetical protein PRUPE_ppa005350mg [Prunus persica]
Length=465

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 63/126 (50%), Gaps = 23/126 (18%)
 Frame = +3

Query  66   KKRQR----------TGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPIS  215
            KKRQR          + SS   ++ +   DS RP         KPS    TA HS     
Sbjct  8    KKRQRAVQPANSPTASSSSRPCAAVIIDSDSKRPTHPNPNPFPKPSP---TAPHS-----  59

Query  216  SRGAFNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEA  392
                FND +SAD +LRL+VD  P D       ++  +  Q DV ++LH+  LRRC+YF A
Sbjct  60   ----FNDPSSADVLLRLFVDPSPLDPPATSFSTSPTAQPQDDVVLHLHAHALRRCKYFAA  115

Query  393  LLSERW  410
            LLS+RW
Sbjct  116  LLSDRW  121



>gb|KJB47493.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=389

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 77/145 (53%), Gaps = 29/145 (20%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KRQR    +      +AI  + P + + E S K            LP +S  +FND ++
Sbjct  7    RKRQRPPHHH-----ASAIVEAFPHKTISEFSQK------------LPRTS-FSFNDPST  48

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            AD +LR ++D  PFD  +       DS   SD+QIYLHS V+ R +YF ALLS+RW +++
Sbjct  49   ADVILRFFIDRSPFDSSNPS-----DSARHSDLQIYLHSRVIFRAKYFSALLSDRWQHQA  103

Query  423  KD-TAG-DS---GSASKMHRFSLGV  482
             +  AG DS    + + M   +LGV
Sbjct  104  NNHNAGHDSRTIANCNNMFHLNLGV  128



>gb|KJB47492.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=473

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 77/145 (53%), Gaps = 29/145 (20%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KRQR    +      +AI  + P + + E S K            LP +S  +FND ++
Sbjct  7    RKRQRPPHHH-----ASAIVEAFPHKTISEFSQK------------LPRTS-FSFNDPST  48

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            AD +LR ++D  PFD  +       DS   SD+QIYLHS V+ R +YF ALLS+RW +++
Sbjct  49   ADVILRFFIDRSPFDSSNPS-----DSARHSDLQIYLHSRVIFRAKYFSALLSDRWQHQA  103

Query  423  KD-TAG-DS---GSASKMHRFSLGV  482
             +  AG DS    + + M   +LGV
Sbjct  104  NNHNAGHDSRTIANCNNMFHLNLGV  128



>gb|KJB47491.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=393

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 77/145 (53%), Gaps = 29/145 (20%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KRQR    +      +AI  + P + + E S K            LP +S  +FND ++
Sbjct  7    RKRQRPPHHH-----ASAIVEAFPHKTISEFSQK------------LPRTS-FSFNDPST  48

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            AD +LR ++D  PFD  +       DS   SD+QIYLHS V+ R +YF ALLS+RW +++
Sbjct  49   ADVILRFFIDRSPFDSSNPS-----DSARHSDLQIYLHSRVIFRAKYFSALLSDRWQHQA  103

Query  423  KD-TAG-DS---GSASKMHRFSLGV  482
             +  AG DS    + + M   +LGV
Sbjct  104  NNHNAGHDSRTIANCNNMFHLNLGV  128



>ref|XP_004507442.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Cicer 
arietinum]
Length=491

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +3

Query  228  FNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSER  407
            FND+++AD +LRL+ D     + + S  +VDS   SD+ +YLHS++LRR +YF ALLS+R
Sbjct  54   FNDASTADVILRLFTDVASPSESSHSSVSVDSAPISDLHVYLHSEILRRSKYFSALLSDR  113

Query  408  WLNE--SKDTAGDSGSASKMHRFSLGVP  485
            W+     +    +  S  ++ R +LGVP
Sbjct  114  WIGNVHPQPQPPEHTSDHELFRLNLGVP  141



>gb|KHF97793.1| hypothetical protein F383_14636 [Gossypium arboreum]
Length=473

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 75/145 (52%), Gaps = 29/145 (20%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KRQR    +      +AI  + P   + E S K   L RT+S          +FND ++
Sbjct  7    RKRQRPPHHH-----ASAIVEAFPHRTISESSQK---LPRTSS----------SFNDPST  48

Query  246  ADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNES  422
            AD +LR + D  PFD  +       DS   SD+QIYLHS V+ R +YF  LLS+RW +++
Sbjct  49   ADVILRFFTDRSPFDSSNPS-----DSARHSDLQIYLHSRVISRAKYFSTLLSDRWQHQA  103

Query  423  KD-TAG-DS---GSASKMHRFSLGV  482
             +  AG DS    + + M   +LGV
Sbjct  104  NNHNAGHDSRTIANCNNMFHLNLGV  128



>ref|XP_010530839.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Tarenaya hassleriana]
Length=416

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 49/78 (63%), Gaps = 11/78 (14%)
 Frame = +3

Query  228  FNDSASADTVLRLYVDC-PFD------DDDAESISAVDSLDQSD----VQIYLHSDVLRR  374
            FNDSA+AD +LRLY D  PF+      D    S S +DS D  D    V+IYLHSDVLRR
Sbjct  75   FNDSATADVILRLYHDSSPFERGGDDDDGSGSSPSPIDSGDGQDLGDDVRIYLHSDVLRR  134

Query  375  CEYFEALLSERWLNESKD  428
             +YF ALLS+RW   + D
Sbjct  135  AKYFAALLSDRWRTPATD  152



>ref|XP_010530838.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Tarenaya hassleriana]
Length=511

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 49/78 (63%), Gaps = 11/78 (14%)
 Frame = +3

Query  228  FNDSASADTVLRLYVDC-PFD------DDDAESISAVDSLDQSD----VQIYLHSDVLRR  374
            FNDSA+AD +LRLY D  PF+      D    S S +DS D  D    V+IYLHSDVLRR
Sbjct  75   FNDSATADVILRLYHDSSPFERGGDDDDGSGSSPSPIDSGDGQDLGDDVRIYLHSDVLRR  134

Query  375  CEYFEALLSERWLNESKD  428
             +YF ALLS+RW   + D
Sbjct  135  AKYFAALLSDRWRTPATD  152



>ref|XP_002509483.1| protein binding protein, putative [Ricinus communis]
 gb|EEF50870.1| protein binding protein, putative [Ricinus communis]
Length=498

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 58/107 (54%), Gaps = 21/107 (20%)
 Frame = +3

Query  96   RLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTVLRLYVD  275
            RLSST A IDS   D+ + E S K    RR  +          +FND  +AD +L L +D
Sbjct  33   RLSSTAAIIDSLS-DKTVTETSQK----RRLDT----------SFNDPTTADVILHLVLD  77

Query  276  --CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERW  410
               P  DD   S+S  D     DVQIYLHS +L R +YF ALLS+RW
Sbjct  78   PTAPLADD---SVSVFDD-PSDDVQIYLHSHILTRAKYFSALLSDRW  120



>ref|XP_008236884.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Prunus 
mume]
Length=486

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVD-CPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLS  401
            +FND +SAD +LRL+VD  P D       ++  +  Q DV ++LH+  LRRC+YF ALLS
Sbjct  61   SFNDPSSADVLLRLFVDPSPLDPPATSFSTSPTAQPQDDVVLHLHAHALRRCKYFAALLS  120

Query  402  ERW  410
            +RW
Sbjct  121  DRW  123



>ref|XP_008356920.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Malus 
domestica]
Length=490

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVD-CPFDDDDAE-SISAVDSLDQSDVQIYLHSDVLRRCEYFEALL  398
            +F+D +SAD +LRL+VD  P D      S+S   +  Q DV ++LH+  LRRC+YF ALL
Sbjct  63   SFDDPSSADVILRLFVDPSPLDPSATSLSLSPATTQPQDDVVLHLHAHALRRCKYFAALL  122

Query  399  SERW  410
            S+RW
Sbjct  123  SDRW  126



>ref|XP_010690889.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +3

Query  204  LPISSRGAFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEY  383
            LPIS  G FND+++AD +LRL+    +D D   SI+        +VQ+YLHS  L R +Y
Sbjct  67   LPIS--GGFNDASTADILLRLF----YDSDSLSSIAETSDSSSDEVQVYLHSSALCRAKY  120

Query  384  FEALLSERW  410
            F AL S+RW
Sbjct  121  FSALFSDRW  129



>ref|XP_006856016.1| hypothetical protein AMTR_s00059p00043870 [Amborella trichopoda]
 gb|ERN17483.1| hypothetical protein AMTR_s00059p00043870 [Amborella trichopoda]
Length=392

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  222  GAFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLS  401
            G FND+ +AD +L L  + P  D D E+   VD  DQ  +++YLHS  + R +YF ALLS
Sbjct  53   GGFNDALTADVILHLLPENPNFDVDNENSEFVD--DQQGLELYLHSSFMHRSKYFSALLS  110

Query  402  ERWLNESKDTAG  437
            +RW   S   +G
Sbjct  111  DRWRESSSVKSG  122



>ref|XP_010942021.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X2 [Elaeis guineensis]
Length=407

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 69/140 (49%), Gaps = 26/140 (19%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KR R GSS RLS          PDE L E S  P  L  +       + + G FND+A+
Sbjct  24   RKRLRAGSSTRLSP------HPEPDESLVENSPPPLLLSSS-------VPTAGGFNDTAT  70

Query  246  ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK  425
            AD +LRL ++ P       S ++   L    + ++LHS  LRR  YF  L S+RWL    
Sbjct  71   ADVLLRLQLENP-------SPASSPDLHPPFLDLHLHSAALRRSRYFAVLFSDRWL----  119

Query  426  DTAGDSGSASKMHRFSLGVP  485
              AG+S  A  + R +L VP
Sbjct  120  PAAGESPDA--IIRLNLTVP  137



>ref|XP_010942018.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942019.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942020.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
Length=495

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 69/140 (49%), Gaps = 26/140 (19%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KR R GSS RLS          PDE L E S  P  L  +       + + G FND+A+
Sbjct  24   RKRLRAGSSTRLSP------HPEPDESLVENSPPPLLLSSS-------VPTAGGFNDTAT  70

Query  246  ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK  425
            AD +LRL ++ P       S ++   L    + ++LHS  LRR  YF  L S+RWL    
Sbjct  71   ADVLLRLQLENP-------SPASSPDLHPPFLDLHLHSAALRRSRYFAVLFSDRWL----  119

Query  426  DTAGDSGSASKMHRFSLGVP  485
              AG+S  A  + R +L VP
Sbjct  120  PAAGESPDA--IIRLNLTVP  137



>ref|XP_008377314.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Malus 
domestica]
Length=487

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVD-CPFDDDDAE-SISAVDSLDQSDVQIYLHSDVLRRCEYFEALL  398
            +F+D +SAD +LRL+VD  P D      S+S   +  Q DV ++LH+  L RC+YF ALL
Sbjct  61   SFDDPSSADVILRLFVDPSPLDPSATSLSLSPATTQPQDDVVLHLHAHALFRCKYFAALL  120

Query  399  SERW  410
            S+RW
Sbjct  121  SDRW  124



>ref|XP_009374197.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like, 
partial [Pyrus x bretschneideri]
Length=454

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = +3

Query  225  AFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSE  404
            +F+D +SAD +LRL+VD       + S+S   +  Q DV ++LH+  L RC+YF ALLS+
Sbjct  33   SFDDPSSADVILRLFVD---PSATSLSLSPATTQPQDDVVLHLHTHALFRCKYFAALLSD  89

Query  405  RW  410
            RW
Sbjct  90   RW  91



>ref|XP_010935064.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Elaeis 
guineensis]
Length=482

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 20/117 (17%)
 Frame = +3

Query  135  PDEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTVLRLYVDCPFDDDDAESISA  314
            PDE L E    P+ +  +A        + G FND A+AD +LRL++D    D    S  A
Sbjct  29   PDETLAENCPPPTPIPSSAP-------TAGGFNDPATADVLLRLHLD----DSSPPSSPA  77

Query  315  VDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
                  + + ++LH   LRR  YF ALLS+RWL ++ D      S   + R SL VP
Sbjct  78   HHP---TFLDLHLHFFALRRSRYFAALLSDRWLPDATD------STDAVPRLSLMVP  125



>ref|XP_008787306.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Phoenix 
dactylifera]
Length=488

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 65/140 (46%), Gaps = 26/140 (19%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KR R  SS   SS         PDE L E     ++       S +P +S   FND  +
Sbjct  17   RKRPRARSSTHFSS------GPDPDETLAE-----NSPPPLLLSSSVPTAS--GFNDPVT  63

Query  246  ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK  425
            AD +LRL ++ P       S S+   L    + ++LHS  LRR  YF ALLS+RWL  + 
Sbjct  64   ADVLLRLQLEDP-------SPSSSPDLHSPFLDLHLHSAALRRSRYFAALLSDRWLPAAA  116

Query  426  DTAGDSGSASKMHRFSLGVP  485
            D      S   + R +L VP
Sbjct  117  D------SLDTIIRLNLAVP  130



>ref|XP_009392960.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=474

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 62/140 (44%), Gaps = 29/140 (21%)
 Frame = +3

Query  66   KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS  245
            +KRQR GSS  LSS   A+   R           PS  R        P    G FND + 
Sbjct  4    RKRQRVGSSGHLSSLDGALAEER---------SSPSPFR-------CPAFDPGGFNDPSF  47

Query  246  ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK  425
            +D +L L  D    D D    + +  LD     +++ S  LRR +YF ALLS+RW   S 
Sbjct  48   SDVLLHLQFD---PDHDPHPDAYLTCLD-----LHVQSAALRRSDYFAALLSDRWQRPS-  98

Query  426  DTAGDSGSASKMHRFSLGVP  485
                 SG A  + R +L +P
Sbjct  99   ---ASSGDAIPL-RVTLKIP  114



>ref|XP_008785748.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like, 
partial [Phoenix dactylifera]
Length=444

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 41/79 (52%), Gaps = 16/79 (20%)
 Frame = +3

Query  207  PISSRGAFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYF  386
            P SS G FND A+AD +L L  D   D D  +S+           +++LHS  LRR  YF
Sbjct  15   PASSLGGFNDPATADVLLLLQPD---DPDSFQSL-----------ELHLHSAALRRSRYF  60

Query  387  EALLSERWLNESKDTAGDS  443
             ALLS+RW     D  GD 
Sbjct  61   SALLSDRW--HHPDPGGDG  77



>gb|EPS62964.1| hypothetical protein M569_11824, partial [Genlisea aurea]
Length=354

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  321  SLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESKD--TAGDSGSASKMHRFSLGVP  485
            S ++S+VQIYLHS+VLRR +YF ALLS+RW  E  D  + G    +  + +F+  +P
Sbjct  12   STEESEVQIYLHSNVLRRSKYFSALLSDRW-KEPSDPISVGFRNESGGIRQFNFHLP  67



>ref|XP_010942871.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Elaeis 
guineensis]
Length=482

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +3

Query  138  DEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTVLRLYVDCPFDDDDAESISAV  317
            DE L E    P+ L  +A        + G FND A+AD +LRL++D   D     S +  
Sbjct  30   DETLAENCPPPTPLSSSAP-------TAGGFNDPATADVLLRLHLD---DSSPPSSPAPH  79

Query  318  DSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESKDTAGDSGSASKMHRFSLGVP  485
             +     + ++LHS  L R  YF A+LS+RWL ++ D      S   + R +L VP
Sbjct  80   PTF----LDLHLHSFALHRSRYFAAVLSDRWLPDAAD------STDAVPRLNLTVP  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960