BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002F19

Length=425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9         53.5    1e-05   Prunus mume [ume]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg           53.5    1e-05   Prunus persica
emb|CDP02673.1|  unnamed protein product                              52.0    3e-05   Coffea canephora [robusta coffee]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9         50.8    7e-05   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                 50.1    1e-04   Malus domestica [apple tree]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                    48.1    5e-04   



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNY
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNY  40



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNY
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNY  40



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG   EGQGN SVMASS ++DC+S  G  LKERNY
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNY  40



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG   EGQ NGS++A S ++DCIS  GS LKERNY
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNY  40



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 3/40 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG   EGQ NGS++A S ++DCISQ  S LKERNY
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNY  40



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +1

Query  256  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNY  366
            MSP +LG E +G+ S++ASS T+DCISQ GS LKE NY
Sbjct  1    MSPPLLGGEEEGHSSLVASSPTIDCISQNGSGLKEWNY  38



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350