BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF002C24

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB72027.1|  hypothetical protein B456_011G154000                    282   5e-91   Gossypium raimondii
gb|KJB72029.1|  hypothetical protein B456_011G154000                    282   1e-90   Gossypium raimondii
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      282   2e-90   Gossypium hirsutum [American cotton]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    281   2e-90   Gossypium raimondii
gb|KJB72024.1|  hypothetical protein B456_011G154000                    282   2e-90   Gossypium raimondii
gb|KHG17040.1|  Adenosylhomocysteinase                                  282   2e-90   Gossypium arboreum [tree cotton]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    282   2e-90   Gossypium raimondii
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             281   5e-90   Citrus sinensis [apfelsine]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   281   5e-90   Citrus sinensis [apfelsine]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             281   6e-90   Citrus clementina [clementine]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    280   2e-89   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  280   3e-89   Gossypium arboreum [tree cotton]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             278   7e-89   Setaria italica
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             278   1e-88   
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                278   1e-88   Cucumis melo [Oriental melon]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       278   1e-88   Gentiana triflora
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     278   1e-88   Cucumis sativus [cucumbers]
gb|AGT16642.1|  Adenosylhomocysteinase                                  277   2e-88   Saccharum hybrid cultivar R570
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             277   2e-88   Setaria italica
ref|NP_001148534.1|  adenosylhomocysteinase                             277   2e-88   
gb|ACN34730.1|  unknown                                                 277   2e-88   Zea mays [maize]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  277   2e-88   Sesamum indicum [beniseed]
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             273   6e-88   Oryza sativa Japonica Group [Japonica rice]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         276   6e-88   Jatropha curcas
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  275   1e-87   Populus euphratica
ref|XP_002300147.1|  adenosylhomocysteinase family protein              275   1e-87   Populus trichocarpa [western balsam poplar]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             274   1e-87   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                275   1e-87   Eucalyptus grandis [rose gum]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    275   2e-87   Gossypium raimondii
gb|AGF95113.1|  adenosylhomocysteinase                                  268   2e-87   Prunus persica
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               274   3e-87   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             274   4e-87   Sesamum indicum [beniseed]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     274   4e-87   Populus tomentosa [Chinese white poplar]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             274   4e-87   Sesamum indicum [beniseed]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     274   4e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     274   4e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     274   4e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     274   4e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     274   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     274   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     274   5e-87   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    273   5e-87   Catharanthus roseus [chatas]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     273   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     273   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     273   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     273   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     273   5e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     273   6e-87   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     273   6e-87   Populus tomentosa [Chinese white poplar]
ref|NP_001067845.2|  Os11g0455500                                       274   7e-87   
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                274   9e-87   
gb|EMS57067.1|  Adenosylhomocysteinase                                  271   1e-86   Triticum urartu
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   273   1e-86   Ricinus communis
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-86   Populus tomentosa [Chinese white poplar]
emb|CDP11183.1|  unnamed protein product                                272   2e-86   Coffea canephora [robusta coffee]
ref|XP_009350351.1|  PREDICTED: adenosylhomocysteinase-like             265   2e-86   Pyrus x bretschneideri [bai li]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     272   2e-86   Populus tomentosa [Chinese white poplar]
gb|KHN12344.1|  Adenosylhomocysteinase                                  270   2e-86   Glycine soja [wild soybean]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       272   3e-86   Gentiana triflora
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  271   3e-86   Eucalyptus grandis [rose gum]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-86   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     271   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  271   4e-86   Nelumbo nucifera [Indian lotus]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             271   4e-86   Populus euphratica
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-86   Populus tomentosa [Chinese white poplar]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              271   5e-86   Populus trichocarpa [western balsam poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   271   5e-86   Populus tomentosa [Chinese white poplar]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     272   5e-86   Eucalyptus grandis [rose gum]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   271   5e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   271   5e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   271   5e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     271   5e-86   Populus tomentosa [Chinese white poplar]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             271   6e-86   Nelumbo nucifera [Indian lotus]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     271   6e-86   Populus tomentosa [Chinese white poplar]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             271   6e-86   Cicer arietinum [garbanzo]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    271   7e-86   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             271   7e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     266   7e-86   
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   271   8e-86   Populus tomentosa [Chinese white poplar]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    270   8e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     270   8e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     270   8e-86   Populus tomentosa [Chinese white poplar]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                273   9e-86   Erythranthe guttata [common monkey flower]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     270   9e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     270   9e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     270   1e-85   Populus tomentosa [Chinese white poplar]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  270   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             270   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        270   1e-85   
ref|XP_010097949.1|  hypothetical protein L484_026840                   270   1e-85   Morus notabilis
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    270   1e-85   Triticum aestivum [Canadian hard winter wheat]
gb|EMT01272.1|  Adenosylhomocysteinase                                  270   1e-85   
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             270   1e-85   
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     270   2e-85   Populus tomentosa [Chinese white poplar]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             270   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             270   2e-85   Phoenix dactylifera
ref|NP_001078387.1|  adenosylhomocysteinase 1                           265   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             270   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             270   2e-85   
ref|NP_001031627.1|  adenosylhomocysteinase 1                           266   2e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     270   2e-85   Populus tomentosa [Chinese white poplar]
gb|EPS72602.1|  adenosylhomocysteinase                                  272   2e-85   Genlisea aurea
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    269   2e-85   Medicago sativa [alfalfa]
dbj|BAH19670.1|  AT4G13940                                              264   2e-85   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                269   2e-85   Erythranthe guttata [common monkey flower]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   269   2e-85   Populus tomentosa [Chinese white poplar]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             269   2e-85   Glycine max [soybeans]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   269   3e-85   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    271   3e-85   Linum usitatissimum
gb|AEI54335.1|  adenosylhomocysteinase                                  269   3e-85   Glycine max [soybeans]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   269   3e-85   Populus tomentosa [Chinese white poplar]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             269   3e-85   Glycine max [soybeans]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        268   3e-85   Nicotiana sylvestris
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        269   4e-85   Kalanchoe daigremontiana
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             269   4e-85   Pyrus x bretschneideri [bai li]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       269   4e-85   Prunus mume [ume]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     269   4e-85   Populus tomentosa [Chinese white poplar]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  269   4e-85   Malus domestica [apple tree]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  268   5e-85   
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             268   5e-85   Prunus persica
emb|CDX85127.1|  BnaC07g07790D                                          268   5e-85   
ref|XP_003601687.1|  Adenosylhomocysteinase                             268   6e-85   Medicago truncatula
ref|NP_001031628.1|  adenosylhomocysteinase 1                           267   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             268   6e-85   Nicotiana sylvestris
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  268   7e-85   Pyrus x bretschneideri [bai li]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   268   7e-85   Populus tomentosa [Chinese white poplar]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  268   7e-85   Malus domestica [apple tree]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   268   8e-85   Populus tomentosa [Chinese white poplar]
emb|CDX77483.1|  BnaA07g06210D                                          267   8e-85   
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  268   8e-85   Nelumbo nucifera [Indian lotus]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             268   8e-85   Phaseolus vulgaris [French bean]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             268   8e-85   Arabidopsis lyrata subsp. lyrata
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                270   9e-85   Erythranthe guttata [common monkey flower]
emb|CDY58805.1|  BnaC08g46780D                                          267   1e-84   Brassica napus [oilseed rape]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           268   1e-84   Brassica rapa
ref|NP_189023.1|  adenosylhomocysteinase 2                              268   1e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    268   1e-84   Arabis alpina [alpine rockcress]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                268   1e-84   Brassica rapa
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             268   1e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       267   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           267   1e-84   Brassica rapa
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  267   1e-84   Fragaria vesca subsp. vesca
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             267   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  267   1e-84   Vitis vinifera
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             267   1e-84   Elaeis guineensis
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      266   2e-84   Brassica oleracea var. alboglabra [Chinese broccoli]
emb|CDY53211.1|  BnaC03g74050D                                          267   2e-84   Brassica napus [oilseed rape]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   267   2e-84   Populus tomentosa [Chinese white poplar]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             267   2e-84   Capsella rubella
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       268   2e-84   
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    266   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            266   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            266   3e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   266   3e-84   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        266   3e-84   Trifolium pratense [peavine clover]
ref|NP_193130.1|  adenosylhomocysteinase 1                              266   3e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47309.1|  BnaAnng08830D                                          266   3e-84   Brassica napus [oilseed rape]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             266   3e-84   Nicotiana tomentosiformis
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     266   3e-84   Nicotiana tabacum [American tobacco]
gb|AAM62888.1|  adenosylhomocysteinase                                  266   3e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            266   3e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50106.1|  BnaC01g43540D                                          267   4e-84   Brassica napus [oilseed rape]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              266   4e-84   Populus tomentosa [Chinese white poplar]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    266   4e-84   Arabis alpina [alpine rockcress]
ref|XP_003629610.1|  Adenosylhomocysteinase                             266   4e-84   Medicago truncatula
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             266   4e-84   Cucumis melo [Oriental melon]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             266   4e-84   Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    266   4e-84   
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    266   5e-84   Arabis alpina [alpine rockcress]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             266   5e-84   Oryza brachyantha
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             266   6e-84   Phaseolus vulgaris [French bean]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        266   6e-84   Cicer arietinum [garbanzo]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             268   7e-84   
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     265   7e-84   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           265   9e-84   Camelina sativa [gold-of-pleasure]
gb|EMS57266.1|  Adenosylhomocysteinase                                  271   1e-83   Triticum urartu
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    265   1e-83   Petroselinum crispum
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  265   1e-83   Phoenix dactylifera
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              259   1e-83   Allium cepa
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    265   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                264   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             264   2e-83   Solanum tuberosum [potatoes]
emb|CDY01177.1|  BnaA04g06420D                                          264   2e-83   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                264   2e-83   Brassica rapa
emb|CDY50423.1|  BnaCnng19320D                                          264   2e-83   Brassica napus [oilseed rape]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             264   2e-83   Solanum lycopersicum
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     263   4e-83   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       263   5e-83   Nicotiana benthamiana
ref|NP_001289538.1|  adenosylhomocysteinase                             263   6e-83   Nicotiana sylvestris
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      263   6e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     263   6e-83   Nicotiana tabacum [American tobacco]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       263   8e-83   Nicotiana suaveolens
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    263   8e-83   Phalaenopsis sp.
emb|CDP15078.1|  unnamed protein product                                262   1e-82   Coffea canephora [robusta coffee]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    262   2e-82   Lupinus luteus
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    262   2e-82   Lupinus luteus
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          261   3e-82   Amborella trichopoda
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             261   3e-82   Elaeis guineensis
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  261   4e-82   Solanum lycopersicum
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                261   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                260   8e-82   Brassica rapa
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                260   8e-82   Tarenaya hassleriana [spider flower]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                260   9e-82   Solanum tuberosum [potatoes]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           260   1e-81   Tarenaya hassleriana [spider flower]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    260   1e-81   
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             258   8e-81   Phoenix dactylifera
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             256   2e-80   Vitis vinifera
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    256   2e-80   Mesembryanthemum crystallinum
gb|ABR16138.1|  unknown                                                 256   2e-80   Picea sitchensis
gb|ABR16547.1|  unknown                                                 256   3e-80   Picea sitchensis
gb|ABR16616.1|  unknown                                                 255   3e-80   Picea sitchensis
gb|ABK25129.1|  unknown                                                 256   4e-80   Picea sitchensis
gb|ABK24229.1|  unknown                                                 256   4e-80   Picea sitchensis
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  256   5e-80   Beta vulgaris subsp. vulgaris [field beet]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    255   7e-80   Pinus pinaster [cluster pine]
gb|ABR16573.1|  unknown                                                 255   7e-80   Picea sitchensis
gb|ABR17322.1|  unknown                                                 255   7e-80   Picea sitchensis
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               254   1e-79   Capsicum annuum
gb|ACN40278.1|  unknown                                                 254   2e-79   Picea sitchensis
ref|XP_001755906.1|  predicted protein                                  254   3e-79   
ref|XP_001755926.1|  predicted protein                                  253   4e-79   
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             253   4e-79   Selaginella moellendorffii
ref|XP_001755929.1|  predicted protein                                  253   4e-79   
gb|AFV46215.1|  hypothetical protein                                    247   7e-79   Scutellaria baicalensis [Baikal skullcap]
ref|NP_001234012.1|  adenosylhomocysteinase                             248   4e-77   
gb|AAD56027.1|AF181566_1  S-adenosyl-L-homocysteine hydrolase           234   1e-75   Solanum chacoense
ref|XP_008361487.1|  PREDICTED: adenosylhomocysteinase-like             238   2e-75   Malus domestica [apple tree]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     241   1e-74   Phaseolus vulgaris [French bean]
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              240   6e-74   Volvox carteri f. nagariensis
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  239   1e-73   Gossypium arboreum [tree cotton]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                238   2e-73   Chlorella variabilis
gb|ABR16332.1|  unknown                                                 238   4e-73   Picea sitchensis
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       237   7e-73   Dunaliella salina
gb|KJB19538.1|  hypothetical protein B456_003G108500                    237   8e-73   Gossypium raimondii
gb|EMT11613.1|  Adenosylhomocysteinase                                  231   1e-72   
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                236   1e-72   
dbj|BAH57232.1|  AT4G13940                                              230   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    230   3e-72   Camelina sativa [gold-of-pleasure]
gb|KHN44476.1|  Adenosylhomocysteinase                                  227   4e-71   Glycine soja [wild soybean]
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     233   5e-71   Helicosporidium sp. ATCC 50920
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             232   5e-71   Guillardia theta CCMP2712
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  231   2e-70   Chlamydomonas reinhardtii
gb|KIZ05177.1|  adenosylhomocysteinase                                  238   2e-70   Monoraphidium neglectum
gb|KJB72026.1|  hypothetical protein B456_011G154000                    226   3e-70   Gossypium raimondii
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       229   5e-70   Chlamydomonas sp. ICE-L
ref|XP_011397211.1|  Adenosylhomocysteinase                             231   5e-70   Auxenochlorella protothecoides
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     225   2e-68   Eucalyptus grandis [rose gum]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      224   5e-68   Petunia x hybrida [garden petunia]
emb|CCA20123.1|  unnamed protein product                                223   1e-67   Albugo laibachii Nc14
ref|XP_010024040.1|  PREDICTED: adenosylhomocysteinase-like             220   6e-67   
ref|XP_008893590.1|  adenosylhomocysteinase                             220   2e-66   
ref|XP_005708566.1|  adenosylhomocysteinase                             220   3e-66   
emb|CCI50303.1|  unnamed protein product                                219   4e-66   
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             219   5e-66   
ref|XP_008611237.1|  adenosylhomocysteinase                             219   6e-66   
emb|CCI11273.1|  unnamed protein product                                214   1e-65   
ref|XP_002902721.1|  adenosylhomocysteinase                             217   2e-65   
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      217   3e-65   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           214   3e-64   
gb|EPT24453.1|  S-Adenosyl homocysteine hydrolase                       210   4e-64   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           213   9e-64   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                215   9e-64   
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     213   1e-63   
ref|XP_008353884.1|  PREDICTED: adenosylhomocysteinase-like             201   2e-63   
ref|XP_003057172.1|  adenosylhomocysteinase                             213   2e-63   
gb|KFG60763.1|  putative adenosylhomocysteinase                         209   2e-63   
ref|WP_027290196.1|  adenosylhomocysteinase                             212   3e-63   
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                213   4e-63   
gb|ACF28652.1|  adenosylhomocysteinase                                  207   4e-63   
ref|WP_010148776.1|  S-adenosyl-L-homocysteine hydrolase                211   4e-63   
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                211   5e-63   
ref|WP_033418634.1|  S-adenosyl-L-homocysteine hydrolase                211   6e-63   
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                211   6e-63   
ref|WP_040477321.1|  S-adenosyl-L-homocysteine hydrolase                211   7e-63   
ref|WP_018155357.1|  S-adenosyl-L-homocysteine hydrolase                211   8e-63   
ref|WP_015752724.1|  S-adenosyl-L-homocysteine hydrolase                211   8e-63   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   210   1e-62   
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    211   1e-62   
ref|WP_044657572.1|  adenosylhomocysteinase                             201   1e-62   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   210   1e-62   
ref|WP_020880885.1|  Adenosylhomocysteinase                             210   1e-62   
ref|WP_003797960.1|  S-adenosyl-L-homocysteine hydrolase                210   1e-62   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                210   2e-62   
ref|XP_010024046.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    208   2e-62   
ref|WP_029970146.1|  adenosylhomocysteinase                             210   2e-62   
ref|WP_028280202.1|  S-adenosyl-L-homocysteine hydrolase                210   2e-62   
ref|WP_039701391.1|  hypothetical protein                               210   2e-62   
gb|EST38040.1|  hypothetical protein N566_09645                         205   2e-62   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                210   2e-62   
ref|WP_041448694.1|  adenosylhomocysteinase                             209   2e-62   
ref|XP_010024045.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    208   2e-62   
ref|WP_017618754.1|  S-adenosyl-L-homocysteine hydrolase                209   2e-62   
ref|XP_002505983.1|  adenosylhomocysteinase                             209   2e-62   
ref|WP_026544237.1|  S-adenosyl-L-homocysteine hydrolase                209   3e-62   
gb|ABS24379.1|  adenosylhomocysteinase                                  210   3e-62   
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    209   4e-62   
ref|WP_028266423.1|  S-adenosyl-L-homocysteine hydrolase                209   4e-62   
ref|WP_018123759.1|  S-adenosyl-L-homocysteine hydrolase                209   4e-62   
ref|WP_039708639.1|  hypothetical protein                               206   4e-62   
ref|WP_038286830.1|  hypothetical protein                               209   5e-62   
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     208   5e-62   
ref|WP_024366069.1|  S-adenosyl-L-homocysteine hydrolase                209   6e-62   
ref|WP_013600344.1|  S-adenosyl-L-homocysteine hydrolase                209   6e-62   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  208   7e-62   
ref|WP_028072995.1|  hypothetical protein                               204   7e-62   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        211   7e-62   
gb|EPR62066.1|  putative adenosylhomocysteinase                         211   7e-62   
ref|WP_011774045.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    208   8e-62   
gb|KFG42936.1|  putative adenosylhomocysteinase                         210   8e-62   
gb|KFG55060.1|  putative adenosylhomocysteinase                         210   8e-62   
gb|KFH13893.1|  putative adenosylhomocysteinase                         210   9e-62   
gb|ESS32583.1|  putative adenosylhomocysteinase                         210   9e-62   
ref|WP_024820127.1|  S-adenosyl-L-homocysteine hydrolase                208   9e-62   
ref|XP_002767678.1|  conserved hypothetical protein                     204   1e-61   
ref|WP_026547066.1|  S-adenosyl-L-homocysteine hydrolase                208   1e-61   
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                208   1e-61   
ref|WP_017198663.1|  S-adenosyl-L-homocysteine hydrolase                208   1e-61   
ref|WP_026542795.1|  S-adenosyl-L-homocysteine hydrolase                208   1e-61   
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                207   1e-61   
ref|WP_028072996.1|  hypothetical protein                               203   1e-61   
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
ref|WP_038287745.1|  hypothetical protein                               207   2e-61   
ref|WP_028648434.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
ref|WP_026106799.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
emb|CCQ46988.1|  adenosylhomocysteinase                                 207   2e-61   
ref|WP_039240331.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
ref|WP_018777321.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
ref|WP_039960509.1|  adenosylhomocysteinase                             202   2e-61   
ref|WP_005274043.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-61   
ref|XP_010024052.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    206   2e-61   
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 207   3e-61   
ref|WP_009356244.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
ref|WP_018770150.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
ref|WP_027182367.1|  adenosylhomocysteinase                             207   3e-61   
ref|WP_012246377.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       209   3e-61   
ref|WP_011368885.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
ref|WP_027139388.1|  hypothetical protein                               207   3e-61   
ref|WP_007270592.1|  adenosylhomocysteinase                             207   3e-61   
ref|WP_027177311.1|  adenosylhomocysteinase                             206   3e-61   
ref|WP_026819263.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
ref|WP_015936483.1|  S-adenosyl-L-homocysteine hydrolase                207   3e-61   
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                206   3e-61   
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    206   3e-61   
ref|WP_015336419.1|  Adenosylhomocysteinase                             206   4e-61   
ref|WP_034267542.1|  hypothetical protein                               206   4e-61   
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                206   4e-61   
ref|WP_015442404.1|  adenosylhomocysteinase                             206   4e-61   
ref|XP_010024051.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    205   4e-61   
ref|WP_012631604.1|  S-adenosyl-L-homocysteine hydrolase                206   4e-61   
ref|WP_012524242.1|  S-adenosyl-L-homocysteine hydrolase                206   4e-61   
ref|WP_043124476.1|  S-adenosyl-L-homocysteine hydrolase                207   4e-61   
ref|WP_014259438.1|  S-adenosyl-L-homocysteine hydrolase                206   5e-61   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              206   5e-61   
ref|WP_005986067.1|  adenosylhomocysteinase                             206   5e-61   
ref|WP_021471479.1|  S-adenosyl-L-homocysteine hydrolase                206   5e-61   
ref|WP_027366923.1|  adenosylhomocysteinase                             206   5e-61   
ref|WP_037057837.1|  hypothetical protein                               206   5e-61   
ref|WP_019245937.1|  S-adenosyl-L-homocysteine hydrolase                206   6e-61   
ref|WP_038286492.1|  hypothetical protein                               206   6e-61   
ref|WP_028587624.1|  adenosylhomocysteinase                             206   7e-61   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  206   7e-61   
ref|WP_018762939.1|  S-adenosyl-L-homocysteine hydrolase                206   8e-61   
ref|WP_027183261.1|  adenosylhomocysteinase                             205   8e-61   
ref|WP_015731971.1|  S-adenosyl-L-homocysteine hydrolase                206   9e-61   
ref|WP_011691059.1|  S-adenosyl-L-homocysteine hydrolase                206   9e-61   
ref|WP_030742429.1|  adenosylhomocysteinase                             205   9e-61   
gb|EJY87176.1|  Adenosylhomocysteinase                                  205   1e-60   
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    205   1e-60   
ref|WP_043454941.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|WP_038289513.1|  hypothetical protein                               205   1e-60   
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|WP_037910293.1|  adenosylhomocysteinase                             205   1e-60   
ref|WP_033173798.1|  adenosylhomocysteinase                             205   1e-60   
ref|WP_036316376.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|WP_043282700.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|WP_029248244.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
gb|ADL25743.1|  adenosylhomocysteinase                                  205   1e-60   
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                205   1e-60   
ref|XP_002177758.1|  adenosylhomocysteinase                             205   2e-60   
ref|WP_041105019.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
ref|WP_026206556.1|  adenosylhomocysteinase                             205   2e-60   
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
ref|WP_036384980.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
ref|WP_031077053.1|  hypothetical protein                               205   2e-60   
gb|KFC52819.1|  S-adenosyl-L-homocysteine hydrolase                     205   2e-60   
ref|WP_044659612.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
gb|EZP36242.1|  Adenosylhomocysteinase                                  206   2e-60   
ref|WP_028276501.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
ref|WP_042387828.1|  hypothetical protein                               204   2e-60   
ref|WP_043474120.1|  adenosylhomocysteinase                             204   2e-60   
ref|WP_018774678.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    205   2e-60   
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                204   2e-60   
ref|WP_027721098.1|  adenosylhomocysteinase                             204   2e-60   
gb|EZP31085.1|  Adenosylhomocysteinase                                  205   2e-60   
gb|ACS30071.1|  adenosylhomocysteinase                                  205   2e-60   
ref|WP_025273626.1|  hypothetical protein                               204   2e-60   
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                204   2e-60   
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                204   2e-60   
ref|WP_026551461.1|  S-adenosyl-L-homocysteine hydrolase                205   2e-60   
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                204   2e-60   
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 204   2e-60   
ref|WP_028929529.1|  adenosylhomocysteinase                             204   2e-60   
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                204   2e-60   
ref|WP_030912635.1|  adenosylhomocysteinase                             204   2e-60   
ref|WP_030837066.1|  adenosylhomocysteinase                             204   2e-60   
ref|WP_030543976.1|  adenosylhomocysteinase                             204   2e-60   
ref|WP_034088535.1|  hypothetical protein                               204   3e-60   
ref|WP_031519542.1|  adenosylhomocysteinase                             204   3e-60   
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               204   3e-60   
ref|XP_002765933.1|  conserved hypothetical protein                     204   3e-60   
ref|WP_042456565.1|  hypothetical protein                               204   3e-60   
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                204   3e-60   
ref|WP_018171957.1|  S-adenosyl-L-homocysteine hydrolase                204   3e-60   
ref|WP_024476377.1|  S-adenosyl-L-homocysteine hydrolase                204   4e-60   
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               204   4e-60   
ref|WP_028270426.1|  S-adenosyl-L-homocysteine hydrolase                204   4e-60   
dbj|BAQ16042.1|  adenosylhomocysteinase                                 203   4e-60   
ref|WP_030276178.1|  hypothetical protein                               204   4e-60   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      204   4e-60   
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                204   4e-60   
ref|WP_027749816.1|  adenosylhomocysteinase                             204   5e-60   
ref|WP_034608627.1|  adenosylhomocysteinase                             203   5e-60   
ref|WP_030572588.1|  adenosylhomocysteinase                             203   5e-60   
ref|WP_040494749.1|  adenosylhomocysteinase                             203   5e-60   
ref|WP_019983817.1|  S-adenosyl-L-homocysteine hydrolase                203   6e-60   
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                203   6e-60   
ref|WP_027763965.1|  adenosylhomocysteinase                             203   6e-60   
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                203   6e-60   
ref|WP_043479471.1|  S-adenosyl-L-homocysteine hydrolase                203   6e-60   
ref|XP_002788757.1|  conserved hypothetical protein                     203   7e-60   
ref|WP_031481867.1|  adenosylhomocysteinase                             203   7e-60   
ref|WP_030029718.1|  adenosylhomocysteinase                             203   7e-60   
ref|WP_027357796.1|  adenosylhomocysteinase                             203   8e-60   
ref|WP_014177043.1|  S-adenosyl-L-homocysteine hydrolase                203   8e-60   
ref|WP_030245490.1|  hypothetical protein                               203   8e-60   
ref|WP_030264019.1|  hypothetical protein                               203   8e-60   
ref|WP_026553821.1|  S-adenosyl-L-homocysteine hydrolase                203   8e-60   
gb|AJD20014.1|  S-adenosyl-L-homocysteine hy-drolase                    203   9e-60   
ref|WP_015774474.1|  S-adenosyl-L-homocysteine hydrolase                202   9e-60   
ref|WP_005048285.1|  S-adenosyl-L-homocysteine hydrolase                203   9e-60   
ref|WP_007576611.1|  S-adenosyl-L-homocysteine hydrolase                203   9e-60   
ref|WP_016472770.1|  MULTISPECIES: adenosylhomocysteinase               203   9e-60   
ref|WP_030694652.1|  adenosylhomocysteinase                             200   1e-59   
ref|WP_036334263.1|  S-adenosyl-L-homocysteine hydrolase                203   1e-59   
ref|WP_020000884.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    202   1e-59   
ref|WP_028576653.1|  adenosylhomocysteinase                             202   1e-59   
ref|WP_005465635.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|XP_010024042.1|  PREDICTED: adenosylhomocysteinase-like             201   1e-59   
ref|WP_022872290.1|  S-adenosyl-L-homocysteine hydrolase                203   1e-59   
ref|WP_033354750.1|  hypothetical protein                               202   1e-59   
gb|EKD50556.1|  hypothetical protein ACD_62C00503G0001                  199   1e-59   
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|WP_044574415.1|  adenosylhomocysteinase                             202   1e-59   
ref|WP_008019385.1|  S-adenosyl-L-homocysteine hydrolase, NAD bin...    199   1e-59   
ref|WP_028573810.1|  adenosylhomocysteinase                             202   1e-59   
gb|EFD51688.1|  adenosylhomocysteinase                                  203   1e-59   
ref|WP_043108500.1|  adenosylhomocysteinase                             202   1e-59   
ref|WP_019356875.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    202   1e-59   
ref|WP_024886447.1|  adenosylhomocysteinase                             202   1e-59   
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|WP_026367128.1|  adenosylhomocysteinase                             202   1e-59   
ref|WP_017203244.1|  S-adenosyl-L-homocysteine hydrolase                202   1e-59   
ref|WP_013493330.1|  S-adenosyl-L-homocysteine hydrolase                202   2e-59   
ref|WP_037954273.1|  adenosylhomocysteinase                             202   2e-59   
ref|WP_006474824.1|  S-adenosyl-L-homocysteine hydrolase                202   2e-59   
ref|WP_042410976.1|  hypothetical protein                               202   2e-59   



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   282 bits (721),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  109  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  168

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  169  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  228

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  229  TEIDPICALQALMEGLQVL  247



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  142  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  201

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  202  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  261

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  262  TEIDPICALQALMEGLQVL  280



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY RMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYRRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY RMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYRRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/139 (98%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKY RMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYRRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKSDPKKYRKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DP+KYT+MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIRDGLKTDPEKYTKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKSDPKRYRKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARV+V
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVVV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>gb|ABG22475.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
Length=392

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  136  NAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  195

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  196  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  255

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  256  TEIDPICALQALMEGLQVL  274



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKKYHKMKERLVGVSEETTTGVKRLYQMQVNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPKKYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPKKYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  136  NAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  195

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  196  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  255

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  256  TEIDPICALQALMEGLQVL  274



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTII+DGLKADPKKY +M++RLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIKDGLKADPKKYRKMRDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTII+DGL A+PKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIKDGLTANPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGF95113.1| adenosylhomocysteinase, partial [Prunus persica]
Length=279

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  37   NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  96

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  97   DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  156

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  157  TEIDPICALQALMEGLQVL  175



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGYQVL  309



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGYQVL  309



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK+DP KYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKSDPTKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  201  NAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  260

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  261  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  320

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  321  TEIDPICALQALMEGLQVL  339



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK D KKYTRMK RLVGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDRKKYTRMKNRLVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  102  NPEFKIVLTIIRDGLKTDAHKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  161

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  162  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  221

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  222  TEIDPICALQALMEGIQIL  240



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGYQVL  309



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDG MRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGFMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPTKYAKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_009350351.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=250

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  71   NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  130

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSK DNLYGCRHSLPDGLMRATDVMIAGKV+VVCGY DVGKGCAAALKQAG+RV+V
Sbjct  131  DSVTKSKLDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYRDVGKGCAAALKQAGSRVVV  190

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  191  TEIDPICALQALMEGLQVL  209



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DS TKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSATKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  94   NAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  153

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIV
Sbjct  154  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIV  213

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  214  TEIDPICALQALMEGLQVL  232



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP KYT+MKER+VGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPTKYTKMKERIVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVFGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIRDGLKTDPQRYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKR YQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRSYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADP KY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPMKYHKMKDRLVGVSEETTTGVKRLYQMQAAGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y  MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHEMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGA VIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGASVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYYKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIRDGLKTDPQRYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ  GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQIDGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIA KVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIASKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLKADP KY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKADPMKYHKMKDRLVGVSEETTTGVKRLYQMQAAGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQ L
Sbjct  291  TEIDPICALQALMEGLQDL  309



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQI+LTIIRDGLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIILTIIRDGLKTDPKRYHKMKDRIVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  171  NPEFKIVLTIIRDGLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQ+L
Sbjct  291  TEIDPICALQALMEGLQIL  309



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  171  NPEFKIVLTIIRDGLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  291  TEIDPICALQALMEGIQIL  309



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   266 bits (679),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  13   NAEFQIVLGIIKEGLQTDPKKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  72

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARV+V
Sbjct  73   DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVVV  132

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  133  TEIDPICALQAAMEGLQVL  151



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGL++DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLRSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  136  NPEFKIVLTIIRDGLKTDASKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  195

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  196  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  255

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  256  TEIDPICALQALMEGIQIL  274



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DS TKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSATKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEET TGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETATGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  260  NAEFQIVLTIIRDGLKTDPKRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  319

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIV
Sbjct  320  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIV  379

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  380  TEIDPICALQALMEGFQVL  398



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV CGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVACGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K+AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKRAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINV+
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVS  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL IIRDGLK DPKKY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NAEFQIVLGIIRDGLKVDPKKYRKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL IIRDGLK DPKKY RMK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NAEFQIVLGIIRDGLKVDPKKYRRMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL IIRDGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NPEFQIVLAIIRDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ +L
Sbjct  291  TEIDPICALQALMEGIPLL  309



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  171  NPEFKIVLTIIRDGLKTDASKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  291  TEIDPICALQALMEGIQIL  309



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  171  NPEFKIVLTIIRDGLKTDAHKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  291  TEIDPICALQALMEGIQIL  309



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQAL EGLQVL
Sbjct  291  TEIDPICALQALTEGLQVL  309



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRDGLK DPKKY RMKERLVGVSEETTTGVKRLYQMQ SG+LLFPAINVN
Sbjct  171  NAEFQIVLGLIRDGLKVDPKKYRRMKERLVGVSEETTTGVKRLYQMQASGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRD LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLGLIRDSLKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQV  5
            TEIDPICALQALMEGLQV
Sbjct  291  TEIDPICALQALMEGLQV  308



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  193  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVN  252

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  253  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  312

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  313  TEIDPICALQALMEGLQVL  331



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  50   NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  109

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  110  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  169

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  170  TEIDPICALQALMEGLQVL  188



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLF AINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFLAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VL +IRDGLK DPK+YT+MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  253  NAEFQLVLGLIRDGLKTDPKRYTKMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  312

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK+ VVCGYGDVGKGCAAALKQAGARV+V
Sbjct  313  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKIGVVCGYGDVGKGCAAALKQAGARVVV  372

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  373  TEIDPICALQALMEGFQVL  391



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAE QIVLTIIRDGLK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEMQIVLTIIRDGLKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQV  5
            TEIDPICALQALMEGLQV
Sbjct  291  TEIDPICALQALMEGLQV  308



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKEDPKKYHKMKERLVGVSEETTTGVKRLYQMQLNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY ++KERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKVKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFD+LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDSLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPKKY +M++RLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  247  NAEFQIVLTIIRDGLKTDPKKYRKMRDRLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  306

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIV
Sbjct  307  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVLGYGDVGKGCAAAMKQAGARVIV  366

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  367  TEIDPICALQALMEGLQVL  385



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTL FPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLPFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+IIRDGLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NAEFQIVLSIIRDGLKTDPKRYHKMKDRIVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  136  NAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  195

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  196  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  255

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  256  TEIDPICALQATMEGLQVL  274



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N +FQIVLTIIRDGLK DP++Y ++K+RLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NPDFQIVLTIIRDGLKTDPQRYHKIKDRLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ S TLLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASSTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DS TKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCG+GDVGKGCAAA+KQAGARVIV
Sbjct  231  DSATKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGHGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRD +K DPKKY RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQIVLGLIRDSIKVDPKKYRRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   268 bits (686),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAE QIVLTIIRDGLK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEMQIVLTIIRDGLKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQATGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  126  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  185

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  186  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  245

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  246  TEIDPICALQALMEGLQVL  264



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+V
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+ P KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSGPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+V
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTT VKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTVVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLT+I+DGLK DPKKY +M+ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTLIKDGLKTDPKKYHKMQERLVGVSEETTTGVKRLYQMQSAGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQV  5
            TEIDPICALQALMEG+ V
Sbjct  291  TEIDPICALQALMEGIPV  308



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTII+DGLK+DP +Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIKDGLKSDPTRYRKMKQRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  233  NAEFQIVLTIIRDGLKTDPKRYAKMKERLVGVSEETTTGVKRLYQMQLNGTLLFPAINVN  292

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIV
Sbjct  293  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIV  352

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  353  TEIDPICALQALMEGFQVL  371



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+II++GLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVN
Sbjct  171  NAEFQIVLSIIKEGLKTDPKRYRKMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DPK+Y +MK RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKTDPKRYHKMKGRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQV  5
            TEIDPICALQALMEG+ V
Sbjct  291  TEIDPICALQALMEGIPV  308



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N+EFQIVL +IRD LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NSEFQIVLGLIRDSLKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ V+
Sbjct  291  TEIDPICALQALMEGIPVI  309



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIR GLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRGGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGAR+IV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARMIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  153  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  212

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  213  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  272

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  273  TEIDPICALQALMEGLQVL  291



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYG RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGRRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DP++Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKTDPQRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  165  NVEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  224

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  225  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  284

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  285  TEIDPICALQATMEGLQVL  303



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLL PAINVN
Sbjct  171  NVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLLPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGL RATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLTRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYRKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTIIRDGLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQLVLTIIRDGLKTDPKRYRKMKDRLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VV GYGDVGKGCA ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVAGYGDVGKGCAVALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N+E QIV TIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NSELQIVFTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N+E QIV TIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NSELQIVFTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N+E QIV TIIRDGLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NSELQIVFTIIRDGLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   266 bits (680),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTIIRDGLK+DP KY +MKERLVG S  TTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NAEFKIVLTIIRDGLKSDPSKYRKMKERLVGGSAGTTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+II++GLK+DPKKY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLSIIKEGLKSDPKKYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+IIR+GLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLSIIREGLKTDPQRYRKMKQRLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  274  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVN  333

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  334  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  393

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  394  TEIDPICALQALMEGLQVL  412



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTII  GLK DPK+Y +M ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLTIITHGLKTDPKRYHKMVERLVGVSEETTTGVKRLYQMQINGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLAIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EF+IVLTIIRDGLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN
Sbjct  438  NPEFKIVLTIIRDGLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  497

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  498  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  557

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+Q+L
Sbjct  558  TEIDPICALQALMEGIQIL  576



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+IIRDGLK+DP KY +MK+RLVGVSEETTTGVKRLYQMQ++GTLLFPAINVN
Sbjct  171  NAEFQIVLSIIRDGLKSDPMKYHKMKDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRD LK +PKKY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NAEFQIVLGLIRDSLKVNPKKYHKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVLTIIRDGLK DP KY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NAEFQIVLTIIRDGLKVDPTKYRKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAFVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            +EIDPICALQ   +GLQVL
Sbjct  291  SEIDPICALQPQWKGLQVL  309



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II++GL  DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLAIIKEGLPVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLAIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+QVL
Sbjct  291  TEIDPICALQALMEGIQVL  309



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTII+DGLK+DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIKDGLKSDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQEAGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTII+DGLK+DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIKDGLKSDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL+II++GL  DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQIVLSIIKEGLSTDPLKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTII++ LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTII++ LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II++GL+ DPKKY +MK RLVGVSEETTTGVKRLYQMQESG LLFPAINVN
Sbjct  171  NPEFQIVLSIIKEGLQVDPKKYHKMKGRLVGVSEETTTGVKRLYQMQESGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA+MEGLQVL
Sbjct  291  TEIDPICALQAMMEGLQVL  309



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTII++ LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQ+VLTII++ LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRD L  DPKKY RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NAEFQIVLGLIRDSLSVDPKKYRRMKERLVGVSEETTTGVKRLYQMQYSGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVG GCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGLGCAAALKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL IIRDGLK DPKKY +MK RLVGVSEETTTGVKRLYQMQ +GTLLF AINVN
Sbjct  171  NAEFQIVLGIIRDGLKVDPKKYHKMKGRLVGVSEETTTGVKRLYQMQANGTLLFSAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKSAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVL+II++GLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NAEFKIVLSIIKEGLKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVL+II++GLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  174  NAEFKIVLSIIKEGLKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVN  233

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIV
Sbjct  234  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIV  293

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  294  TEIDPICALQATMEGLQVL  312



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II+DGLKADPKKY +MK+RLVGVSEETTTGVKRLYQM  +GTLLF AINVN
Sbjct  171  NPEFQIVLGIIKDGLKADPKKYHKMKDRLVGVSEETTTGVKRLYQMHANGTLLFSAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL +IRD LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ SG LL PAINVN
Sbjct  171  NAEFQIVLGLIRDSLKVDPKKYHKMKERLVGVSEETTTGVKRLYQMQASGALLIPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVI+
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVII  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ V+
Sbjct  291  TEIDPICALQALMEGIPVI  309



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTII++ LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVN
Sbjct  171  NPEFQIVLQIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGFQVL  309



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL+II+DGL+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVN
Sbjct  171  NPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCR SLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRPSLPDGLMRATDVMIAGKVAVIWGYGDVGKGCAAAMKTAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGLQVL
Sbjct  291  TEIDPICALQALMEGLQVL  309



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II+DGL  DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NPEFQIVLQIIKDGLPVDPKKYHKMKERLVGVSEETTTGVKRLYQMQVNGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG Q+L
Sbjct  291  TEIDPICALQALMEGFQIL  309



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTII++ LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIKESLKTDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL II+DGL+ DPKKY +M+ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NPEFQIVLQIIKDGLQVDPKKYRKMRERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG Q+L
Sbjct  291  TEIDPICALQALMEGFQIL  309



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VLTII++ LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLTIIKESLKTDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQA MEGLQVL
Sbjct  291  TEIDPICALQATMEGLQVL  309



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL +IRD +K +P KY RMKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVN
Sbjct  171  NVEFQIVLGLIRDSIKVNPSKYRRMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQV  5
            TEIDPICALQALMEG+ V
Sbjct  291  TEIDPICALQALMEGIPV  308



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEFQIVL II++GL  DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLF AINVN
Sbjct  171  NAEFQIVLGIIKEGLSVDPCKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFAAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGA+VIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGAQVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG+ VL
Sbjct  291  TEIDPICALQALMEGIPVL  309



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +IRD LK DPK+Y +MK RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NPEFQLVLGLIRDSLKVDPKRYHKMKTRLVGVSEETTTGVKRLYQMQATGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG Q+L
Sbjct  291  TEIDPICALQALMEGFQIL  309



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  136  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  195

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIV
Sbjct  196  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIV  255

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  256  TEIDPICALQALMEGLPVL  274



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL +I++ LK DP +Y RMK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVN
Sbjct  171  NVEFQIVLALIKESLKVDPLRYHRMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQIVL +I++ LK DP +Y RMK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVN
Sbjct  171  NVEFQIVLALIKESLKVDPLRYHRMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  173  NVEFQLVLGLIKESLKVDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  232

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIV
Sbjct  233  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIV  292

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG Q+L
Sbjct  293  TEIDPICALQALMEGFQIL  311



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I+D +K DP +Y +MK+RLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NLEFQMVLGLIKDSIKVDPLRYHKMKDRLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVN
Sbjct  171  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL II++ LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVN
Sbjct  171  NVEFQLVLGIIKESLKVDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA + GYGDVGKGCAAA+KQAGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAFIAGYGDVGKGCAAAMKQAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            +EIDPICALQA MEGLQVL
Sbjct  291  SEIDPICALQATMEGLQVL  309



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPA NVN
Sbjct  171  NLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPATNVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEGL VL
Sbjct  291  TEIDPICALQALMEGLPVL  309



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  418  NAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVN  239
            NAEF+IVLTI+RDG+K +P+KY +M ERLVGVSEETTTGVKRLYQM ++G+LLFPAINVN
Sbjct  171  NAEFKIVLTILRDGMKENPQKYHKMAERLVGVSEETTTGVKRLYQMMDNGSLLFPAINVN  230

Query  238  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIV  59
            DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIV
Sbjct  231  DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIV  290

Query  58   TEIDPICALQALMEGLQVL  2
            TEIDPICALQALMEG QVL
Sbjct  291  TEIDPICALQALMEGYQVL  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700