BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001L13

Length=405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            178   1e-50   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            176   1e-49   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            172   2e-48   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       169   3e-47   Solanum tuberosum [potatoes]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            167   2e-46   Sesamum indicum [beniseed]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                165   9e-46   Erythranthe guttata [common monkey flower]
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         159   9e-46   Tarenaya hassleriana [spider flower]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             162   2e-45   
emb|CDP02851.1|  unnamed protein product                                163   5e-45   Coffea canephora [robusta coffee]
emb|CBI36578.3|  unnamed protein product                                163   5e-45   Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            164   5e-45   Vitis vinifera
ref|XP_002528403.1|  serine carboxypeptidase, putative                  162   2e-44   Ricinus communis
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             162   2e-44   Citrus clementina [clementine]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             162   3e-44   Citrus clementina [clementine]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            161   4e-44   Vitis vinifera
emb|CAN75200.1|  hypothetical protein VITISV_014887                     161   5e-44   Vitis vinifera
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  157   6e-44   Citrus sinensis [apfelsine]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    159   1e-43   Phoenix dactylifera
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            159   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    159   2e-43   Phoenix dactylifera
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         159   2e-43   Jatropha curcas
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    158   4e-43   Citrus sinensis [apfelsine]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          158   6e-43   Amborella trichopoda
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       158   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       157   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            157   8e-43   Pyrus x bretschneideri [bai li]
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    157   2e-42   Theobroma cacao [chocolate]
gb|KJB76660.1|  hypothetical protein B456_012G098600                    155   3e-42   Gossypium raimondii
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            155   5e-42   Prunus mume [ume]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             155   5e-42   Prunus persica
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            155   6e-42   
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            155   6e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         155   7e-42   Tarenaya hassleriana [spider flower]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             155   7e-42   
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         155   7e-42   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            154   1e-41   Fragaria vesca subsp. vesca
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             151   1e-41   
gb|KJB76659.1|  hypothetical protein B456_012G098600                    154   1e-41   Gossypium raimondii
gb|AFK34623.1|  unknown                                                 147   1e-41   Lotus japonicus
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            154   2e-41   Elaeis guineensis
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         154   2e-41   Gossypium arboreum [tree cotton]
gb|EPS71160.1|  hypothetical protein M569_03591                         153   3e-41   Genlisea aurea
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         148   7e-41   Jatropha curcas
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    151   8e-41   Populus euphratica
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    150   3e-40   Populus euphratica
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            149   8e-40   Cucumis melo [Oriental melon]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    149   1e-39   Arabis alpina [alpine rockcress]
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    148   2e-39   
gb|KHN02055.1|  Serine carboxypeptidase II-2                            148   3e-39   Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       148   3e-39   Glycine max [soybeans]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       148   4e-39   Cucumis sativus [cucumbers]
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    147   5e-39   Cucumis sativus [cucumbers]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             147   8e-39   Capsella rubella
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       145   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            145   2e-38   Eucalyptus grandis [rose gum]
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            144   4e-38   Brachypodium distachyon [annual false brome]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             143   1e-37   
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         143   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         143   2e-37   Brassica rapa
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         143   2e-37   Camelina sativa [gold-of-pleasure]
emb|CDX68696.1|  BnaC01g07570D                                          143   2e-37   
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             142   3e-37   Phaseolus vulgaris [French bean]
emb|CDY23258.1|  BnaA08g12880D                                          142   3e-37   Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          142   4e-37   Brassica napus [oilseed rape]
emb|CDY28217.1|  BnaA01g06320D                                          142   4e-37   Brassica napus [oilseed rape]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         142   4e-37   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          142   4e-37   Brassica napus [oilseed rape]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         142   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         141   6e-37   Brassica rapa
ref|NP_567854.1|  serine carboxypeptidase-like 29                       141   9e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDP11023.1|  unnamed protein product                                141   1e-36   Coffea canephora [robusta coffee]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                140   1e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72270.1|  BnaC07g42920D                                          142   1e-36   
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         140   1e-36   
emb|CDY28216.1|  BnaA01g06330D                                          139   5e-36   Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             139   6e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    139   6e-36   
gb|AEX12786.1|  hypothetical protein 2_8315_02                          131   7e-36   Pinus radiata
gb|AEX12772.1|  hypothetical protein 2_8315_02                          131   7e-36   Pinus taeda
gb|AEX12770.1|  hypothetical protein 2_8315_02                          131   7e-36   Pinus taeda
gb|ABK24285.1|  unknown                                                 137   1e-35   Picea sitchensis
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       137   2e-35   Oryza brachyantha
dbj|BAJ99024.1|  predicted protein                                      137   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      137   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX68695.1|  BnaC01g07580D                                          135   7e-35   
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    135   1e-34   
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          135   1e-34   Zea mays [maize]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    135   1e-34   Medicago truncatula
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       135   2e-34   Cicer arietinum [garbanzo]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       134   2e-34   Medicago truncatula
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               133   4e-34   Medicago truncatula
emb|CDY32091.1|  BnaC04g44750D                                          132   9e-34   Brassica napus [oilseed rape]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    132   1e-33   Gossypium raimondii
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       132   1e-33   Medicago truncatula
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       132   1e-33   Setaria italica
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         132   1e-33   Brassica rapa
emb|CDY40438.1|  BnaA04g20790D                                          132   2e-33   Brassica napus [oilseed rape]
ref|NP_001057009.1|  Os06g0186400                                       132   2e-33   
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         132   2e-33   Glycine soja [wild soybean]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    132   2e-33   Glycine max [soybeans]
ref|XP_003596536.1|  Serine carboxypeptidase                            132   3e-33   
gb|AES66787.2|  serine carboxypeptidase-like protein                    131   3e-33   Medicago truncatula
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         131   3e-33   Gossypium arboreum [tree cotton]
gb|KJB78940.1|  hypothetical protein B456_013G026200                    130   4e-33   Gossypium raimondii
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    130   4e-33   Glycine max [soybeans]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         130   5e-33   Sesamum indicum [beniseed]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    130   5e-33   Hordeum vulgare [barley]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             130   5e-33   Phaseolus vulgaris [French bean]
gb|KJB78942.1|  hypothetical protein B456_013G026200                    130   7e-33   Gossypium raimondii
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         130   7e-33   Nelumbo nucifera [Indian lotus]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    129   1e-32   Gossypium raimondii
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    128   3e-32   Solanum tuberosum [potatoes]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         128   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             128   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         127   5e-32   Solanum lycopersicum
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         127   5e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               122   5e-32   Erythranthe guttata [common monkey flower]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         127   5e-32   Pyrus x bretschneideri [bai li]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         127   6e-32   Glycine soja [wild soybean]
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         127   6e-32   Jatropha curcas
gb|KJB76566.1|  hypothetical protein B456_012G094900                    127   7e-32   Gossypium raimondii
ref|NP_181121.1|  serine carboxypeptidase-like 26                       127   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         127   8e-32   Populus euphratica
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    127   8e-32   Glycine max [soybeans]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         127   9e-32   Fragaria vesca subsp. vesca
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               127   1e-31   Medicago truncatula
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    127   1e-31   Arabis alpina [alpine rockcress]
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               127   1e-31   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             126   1e-31   Eutrema salsugineum [saltwater cress]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    127   1e-31   Gossypium raimondii
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    126   1e-31   Nelumbo nucifera [Indian lotus]
emb|CDO99730.1|  unnamed protein product                                126   1e-31   Coffea canephora [robusta coffee]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    126   2e-31   Arabis alpina [alpine rockcress]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    126   2e-31   Cucumis sativus [cucumbers]
ref|XP_002534550.1|  serine carboxypeptidase, putative                  125   2e-31   
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         126   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             125   2e-31   
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    125   3e-31   Nelumbo nucifera [Indian lotus]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    124   3e-31   Gossypium raimondii
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               125   3e-31   Medicago truncatula
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          125   3e-31   Amborella trichopoda
gb|AES62200.2|  serine carboxypeptidase-like protein                    125   3e-31   Medicago truncatula
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             125   3e-31   Capsella rubella
gb|KJB76565.1|  hypothetical protein B456_012G094900                    124   4e-31   Gossypium raimondii
gb|AFK43035.1|  unknown                                                 125   4e-31   Medicago truncatula
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         125   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    125   5e-31   Fragaria vesca subsp. vesca
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    125   5e-31   Fragaria vesca subsp. vesca
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         125   5e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    124   6e-31   
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    124   6e-31   Brassica rapa
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          124   6e-31   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         124   7e-31   Nicotiana sylvestris
emb|CDY35977.1|  BnaA05g29730D                                          124   7e-31   Brassica napus [oilseed rape]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    124   7e-31   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         124   7e-31   Cucumis melo [Oriental melon]
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   124   8e-31   Citrus sinensis [apfelsine]
emb|CDY28004.1|  BnaC05g44060D                                          124   8e-31   Brassica napus [oilseed rape]
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             124   8e-31   Citrus clementina [clementine]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         124   8e-31   Eucalyptus grandis [rose gum]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         124   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    124   1e-30   Cicer arietinum [garbanzo]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          124   1e-30   Arabidopsis lyrata subsp. petraea
gb|KJB76563.1|  hypothetical protein B456_012G094900                    124   1e-30   Gossypium raimondii
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         124   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         124   1e-30   Camelina sativa [gold-of-pleasure]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    124   1e-30   Gossypium raimondii
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             124   1e-30   
gb|AFK37459.1|  unknown                                                 124   1e-30   Lotus japonicus
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         124   1e-30   Nicotiana tomentosiformis
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         124   1e-30   Malus domestica [apple tree]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         123   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   Prunus mume [ume]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   Populus euphratica
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          124   2e-30   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             123   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   Vitis vinifera
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   Populus euphratica
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   Pyrus x bretschneideri [bai li]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     123   2e-30   Eucalyptus grandis [rose gum]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         123   2e-30   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   123   2e-30   Citrus sinensis [apfelsine]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             123   3e-30   Citrus clementina [clementine]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         122   3e-30   Camelina sativa [gold-of-pleasure]
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  121   3e-30   Citrus sinensis [apfelsine]
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         122   5e-30   Eucalyptus grandis [rose gum]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              122   5e-30   Fragaria vesca subsp. vesca
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                121   5e-30   Erythranthe guttata [common monkey flower]
emb|CBI31484.3|  unnamed protein product                                122   6e-30   Vitis vinifera
emb|CBI21207.3|  unnamed protein product                                122   6e-30   Vitis vinifera
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         122   7e-30   Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         122   7e-30   Vitis vinifera
ref|NP_187456.1|  serine carboxypeptidase-like 27                       122   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         122   7e-30   Populus euphratica
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    122   7e-30   Morus notabilis
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         121   8e-30   Brassica rapa
gb|KJB77373.1|  hypothetical protein B456_012G134700                    121   8e-30   Gossypium raimondii
gb|KJB77374.1|  hypothetical protein B456_012G134700                    121   8e-30   Gossypium raimondii
gb|KJB79850.1|  hypothetical protein B456_013G069700                    121   9e-30   Gossypium raimondii
gb|KJB77375.1|  hypothetical protein B456_012G134700                    122   9e-30   Gossypium raimondii
emb|CDY40439.1|  BnaA04g20780D                                          121   1e-29   Brassica napus [oilseed rape]
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    120   1e-29   Citrus sinensis [apfelsine]
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             120   1e-29   Citrus clementina [clementine]
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         120   1e-29   Fragaria vesca subsp. vesca
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         120   1e-29   Nicotiana sylvestris
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         120   2e-29   Nelumbo nucifera [Indian lotus]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     120   2e-29   Vitis vinifera
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         120   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         120   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         120   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         120   3e-29   Camelina sativa [gold-of-pleasure]
gb|KJB07560.1|  hypothetical protein B456_001G032600                    119   4e-29   Gossypium raimondii
dbj|BAK05698.1|  predicted protein                                      119   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS66906.1|  hypothetical protein M569_07869                         119   5e-29   Genlisea aurea
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         119   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43258.1|  BnaC05g48510D                                          119   5e-29   Brassica napus [oilseed rape]
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    119   6e-29   Solanum tuberosum [potatoes]
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    119   6e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    119   6e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         119   7e-29   Brassica rapa
ref|NP_181120.2|  serine carboxypeptidase-like 28                       119   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    119   8e-29   Arabis alpina [alpine rockcress]
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         119   8e-29   Solanum lycopersicum
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       119   8e-29   Phoenix dactylifera
gb|ABR16028.1|  unknown                                                 119   8e-29   Picea sitchensis
gb|KJB07562.1|  hypothetical protein B456_001G032600                    118   1e-28   Gossypium raimondii
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             118   1e-28   Capsella rubella
gb|KJB07564.1|  hypothetical protein B456_001G032600                    118   1e-28   Gossypium raimondii
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         118   1e-28   Nelumbo nucifera [Indian lotus]
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         118   1e-28   Jatropha curcas
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             118   1e-28   
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             118   1e-28   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         118   1e-28   Vitis vinifera
gb|KEH32355.1|  serine carboxypeptidase-like protein                    118   1e-28   Medicago truncatula
emb|CBI29056.3|  unnamed protein product                                118   1e-28   Vitis vinifera
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             118   2e-28   Phaseolus vulgaris [French bean]
gb|KJB76570.1|  hypothetical protein B456_012G095000                    118   2e-28   Gossypium raimondii
gb|KJB76572.1|  hypothetical protein B456_012G095000                    117   2e-28   Gossypium raimondii
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             117   2e-28   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         117   2e-28   Populus trichocarpa [western balsam poplar]
gb|KJB76571.1|  hypothetical protein B456_012G095000                    117   2e-28   Gossypium raimondii
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             117   2e-28   
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    117   2e-28   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         117   2e-28   Nicotiana tomentosiformis
gb|KHN35601.1|  Serine carboxypeptidase II-3                            117   2e-28   Glycine soja [wild soybean]
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    117   2e-28   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       118   3e-28   Glycine max [soybeans]
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    117   3e-28   
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    117   3e-28   Phoenix dactylifera
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    117   3e-28   
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         117   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       117   3e-28   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         117   3e-28   
emb|CBI18754.3|  unnamed protein product                                117   3e-28   Vitis vinifera
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         117   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         117   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             117   3e-28   Phaseolus vulgaris [French bean]
emb|CAN82217.1|  hypothetical protein VITISV_020424                     117   3e-28   Vitis vinifera
emb|CDO99728.1|  unnamed protein product                                117   3e-28   Coffea canephora [robusta coffee]
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         117   3e-28   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         117   3e-28   Populus euphratica
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    117   4e-28   Musa acuminata [banana]
emb|CAN75418.1|  hypothetical protein VITISV_014880                     117   4e-28   Vitis vinifera
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          117   4e-28   
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             116   4e-28   Arabidopsis lyrata subsp. lyrata
gb|ACU18095.1|  unknown                                                 114   4e-28   Glycine max [soybeans]
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             116   5e-28   
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         117   5e-28   Camelina sativa [gold-of-pleasure]
emb|CDP10248.1|  unnamed protein product                                116   5e-28   Coffea canephora [robusta coffee]
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    116   5e-28   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                116   5e-28   Gossypium arboreum [tree cotton]
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         116   5e-28   Jatropha curcas
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 116   5e-28   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    116   6e-28   Medicago truncatula
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         116   6e-28   Nicotiana sylvestris
gb|EMS58878.1|  Serine carboxypeptidase-like 34                         116   6e-28   Triticum urartu
gb|ABR16596.1|  unknown                                                 117   6e-28   Picea sitchensis
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             116   6e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010656628.1|  PREDICTED: uncharacterized protein LOC104880710    112   7e-28   Vitis vinifera
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         116   7e-28   
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         113   7e-28   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         116   7e-28   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         116   7e-28   
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          112   8e-28   
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             116   8e-28   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   116   8e-28   
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         116   8e-28   
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         115   8e-28   
ref|XP_008801741.1|  PREDICTED: serine carboxypeptidase-like 33 i...    115   8e-28   
ref|XP_010914643.1|  PREDICTED: serine carboxypeptidase-like 33         115   8e-28   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         116   9e-28   
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         115   9e-28   
ref|XP_008801742.1|  PREDICTED: serine carboxypeptidase-like 33 i...    115   9e-28   
gb|ABR16997.1|  unknown                                                 116   9e-28   
gb|KJB07559.1|  hypothetical protein B456_001G032600                    116   9e-28   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             115   9e-28   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    115   1e-27   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    115   1e-27   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          115   1e-27   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         115   1e-27   
emb|CDY39011.1|  BnaC01g34750D                                          115   1e-27   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              115   1e-27   
gb|EPS67442.1|  hypothetical protein M569_07330                         115   1e-27   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         115   1e-27   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             115   1e-27   
gb|AAM15112.1|  putative serine carboxypeptidase II                     115   1e-27   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          115   1e-27   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             115   1e-27   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         115   2e-27   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    115   2e-27   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          115   2e-27   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       115   2e-27   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            115   2e-27   
ref|XP_010501423.1|  PREDICTED: serine carboxypeptidase-like 31         116   2e-27   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         115   2e-27   
gb|KHN03262.1|  Serine carboxypeptidase-like 33                         115   2e-27   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  115   2e-27   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    115   2e-27   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         114   2e-27   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    115   2e-27   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          115   2e-27   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    114   2e-27   
ref|XP_006297573.1|  hypothetical protein CARUB_v10013596mg             114   2e-27   
emb|CBI36577.3|  unnamed protein product                                114   2e-27   
emb|CAN79972.1|  hypothetical protein VITISV_010072                     114   2e-27   
ref|NP_001151874.1|  LOC100285510 precursor                             114   3e-27   
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             114   3e-27   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    114   3e-27   
gb|EMT32671.1|  Serine carboxypeptidase-like 34                         114   3e-27   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       114   3e-27   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            114   3e-27   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         114   3e-27   
ref|XP_010473313.1|  PREDICTED: serine carboxypeptidase-like 32         114   3e-27   
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         114   3e-27   
ref|NP_001152245.1|  lysosomal protective protein precursor             114   3e-27   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       114   3e-27   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    114   3e-27   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    114   3e-27   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       114   3e-27   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    114   4e-27   
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    114   4e-27   
ref|NP_001044713.1|  Os01g0833500                                       114   4e-27   
gb|EAY76388.1|  hypothetical protein OsI_04319                          114   4e-27   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    114   4e-27   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       114   4e-27   
ref|XP_006301500.1|  hypothetical protein CARUB_v10021926mg             114   4e-27   
ref|XP_003543072.1|  PREDICTED: serine carboxypeptidase-like 31-l...    114   5e-27   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    114   5e-27   
tpg|DAA46115.1|  TPA: hypothetical protein ZEAMMB73_496779              114   5e-27   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         114   5e-27   
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             114   5e-27   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         114   5e-27   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    114   5e-27   
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             114   5e-27   
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    113   5e-27   
emb|CDO99599.1|  unnamed protein product                                114   5e-27   
ref|XP_002886559.1|  serine carboxypeptidase S10 family protein         114   5e-27   
ref|XP_010533892.1|  PREDICTED: serine carboxypeptidase-like 31 i...    114   5e-27   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              114   5e-27   
dbj|BAO04184.1|  hypothetical protein                                   113   6e-27   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             114   6e-27   
ref|XP_003543073.1|  PREDICTED: serine carboxypeptidase-like 31-l...    113   6e-27   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         113   6e-27   
gb|KHN42831.1|  Serine carboxypeptidase 24                              113   6e-27   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    113   6e-27   
ref|XP_006847849.1|  hypothetical protein AMTR_s00029p00064790          114   6e-27   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    113   6e-27   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          114   6e-27   
ref|XP_011010904.1|  PREDICTED: serine carboxypeptidase-like 33         113   7e-27   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         113   7e-27   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    113   7e-27   
ref|XP_003593500.1|  Serine carboxypeptidase-like protein               113   7e-27   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    113   7e-27   
dbj|BAK04916.1|  predicted protein                                      114   7e-27   
ref|XP_009104389.1|  PREDICTED: serine carboxypeptidase-like 32         113   7e-27   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    113   7e-27   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    113   8e-27   
ref|XP_004986851.1|  PREDICTED: serine carboxypeptidase-like 34-like    113   8e-27   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     112   8e-27   
ref|XP_002885191.1|  hypothetical protein ARALYDRAFT_479190             113   9e-27   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    113   9e-27   
ref|XP_008383787.1|  PREDICTED: serine carboxypeptidase-like 31         113   9e-27   
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    112   1e-26   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         113   1e-26   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             113   1e-26   
ref|XP_010234952.1|  PREDICTED: serine carboxypeptidase-like 34         113   1e-26   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         113   1e-26   
ref|XP_006301480.1|  hypothetical protein CARUB_v10021903mg             113   1e-26   
gb|KHN05457.1|  Serine carboxypeptidase-like 35                         113   1e-26   
ref|XP_003540633.1|  PREDICTED: serine carboxypeptidase-like 35-like    113   1e-26   
ref|XP_010671807.1|  PREDICTED: serine carboxypeptidase-like 33         113   1e-26   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    113   1e-26   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         112   1e-26   
gb|AAB71481.1|  similar to serine carboxypeptidases                     112   1e-26   
ref|NP_176308.2|  serine carboxypeptidase-like 32                       112   1e-26   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     112   1e-26   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         113   1e-26   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         112   1e-26   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       112   1e-26   
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          112   1e-26   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         112   1e-26   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    112   1e-26   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         113   1e-26   
ref|XP_010649492.1|  PREDICTED: serine carboxypeptidase-like 33 i...    112   1e-26   
ref|XP_008663967.1|  PREDICTED: serine carboxypeptidase-like 34         112   1e-26   
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    112   1e-26   
ref|XP_007212080.1|  hypothetical protein PRUPE_ppa005035mg             112   1e-26   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         112   1e-26   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    112   1e-26   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    112   2e-26   
gb|KJB69468.1|  hypothetical protein B456_011G025000                    112   2e-26   
ref|XP_002280311.1|  PREDICTED: serine carboxypeptidase-like 33 i...    112   2e-26   
gb|AFW56972.1|  hypothetical protein ZEAMMB73_293605                    113   2e-26   
ref|XP_002892617.1|  hypothetical protein ARALYDRAFT_471242             112   2e-26   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    112   2e-26   
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         112   2e-26   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       112   2e-26   
ref|XP_007154418.1|  hypothetical protein PHAVU_003G118000g             112   2e-26   
ref|NP_001159178.1|  hypothetical protein precursor                     112   2e-26   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    112   2e-26   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    112   2e-26   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         112   2e-26   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         112   2e-26   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              112   2e-26   
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             112   2e-26   
ref|XP_003529505.1|  PREDICTED: serine carboxypeptidase-like 33-l...    112   2e-26   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             112   2e-26   
gb|KJB75609.1|  hypothetical protein B456_012G048700                    111   2e-26   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         112   2e-26   
ref|NP_001047514.1|  Os02g0634700                                       112   2e-26   
gb|KHN02864.1|  Serine carboxypeptidase-like 33                         112   2e-26   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       112   2e-26   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                112   2e-26   
gb|AAM65698.1|  putative serine carboxypeptidase II                     112   2e-26   
gb|EAY79381.1|  hypothetical protein OsI_34509                          112   2e-26   
ref|XP_011100722.1|  PREDICTED: serine carboxypeptidase-like 33         112   2e-26   
gb|ABB47943.2|  Serine carboxypeptidase family protein                  112   2e-26   
gb|EEC73659.1|  hypothetical protein OsI_08191                          112   3e-26   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             111   3e-26   
ref|XP_010270860.1|  PREDICTED: serine carboxypeptidase-like 33         112   3e-26   
gb|AES71591.2|  serine carboxypeptidase-like protein                    112   3e-26   
gb|AAG46107.1|AC073166_5  putative serine carboxypeptidase              112   3e-26   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       112   3e-26   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          112   3e-26   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       111   3e-26   
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          111   3e-26   
gb|KDP20921.1|  hypothetical protein JCGZ_21392                         111   3e-26   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    111   3e-26   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         111   3e-26   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             111   3e-26   
ref|NP_188343.1|  protein serine carboxypeptidase-like 33               111   3e-26   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             111   3e-26   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         111   3e-26   
ref|XP_009393156.1|  PREDICTED: serine carboxypeptidase-like 33         111   3e-26   
gb|EMT20722.1|  Serine carboxypeptidase II-3                            112   3e-26   
ref|XP_002876371.1|  predicted protein                                  112   3e-26   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               111   4e-26   
gb|AAQ63884.1|  putative serine carboxypeptidase                        111   4e-26   
ref|XP_002521402.1|  serine carboxypeptidase, putative                  111   4e-26   
ref|XP_008658700.1|  PREDICTED: lysosomal protective protein isof...    111   4e-26   
dbj|BAA94996.1|  serine carboxypeptidase II-like protein                111   4e-26   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         111   4e-26   
ref|XP_010107053.1|  Serine carboxypeptidase-like 31                    111   4e-26   
ref|XP_002317229.2|  serine carboxypeptidase S10 family protein         111   4e-26   
ref|XP_010931783.1|  PREDICTED: serine carboxypeptidase-like 33 i...    111   4e-26   
ref|XP_010931784.1|  PREDICTED: serine carboxypeptidase-like 33 i...    110   4e-26   
ref|XP_009114428.1|  PREDICTED: serine carboxypeptidase-like 33         111   5e-26   
emb|CDY35007.1|  BnaA01g27270D                                          111   5e-26   
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       111   5e-26   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  112   5e-26   
emb|CDY68103.1|  BnaCnng57600D                                          107   5e-26   
ref|XP_009398853.1|  PREDICTED: serine carboxypeptidase-like 35         111   5e-26   
ref|XP_008658699.1|  PREDICTED: lysosomal protective protein isof...    111   5e-26   
ref|XP_008812782.1|  PREDICTED: serine carboxypeptidase-like 34         111   5e-26   
ref|XP_006303174.1|  hypothetical protein CARUB_v10008980mg             111   5e-26   
gb|KFK40732.1|  hypothetical protein AALP_AA2G034000                    110   6e-26   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    111   6e-26   
gb|EMS68142.1|  Serine carboxypeptidase-like 40                         112   6e-26   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         110   6e-26   
ref|XP_002467770.1|  hypothetical protein SORBIDRAFT_01g033770          111   7e-26   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     110   7e-26   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       110   7e-26   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         110   7e-26   
ref|XP_006417391.1|  hypothetical protein EUTSA_v10007471mg             110   7e-26   
gb|KJB77360.1|  hypothetical protein B456_012G133800                    110   7e-26   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          110   8e-26   
ref|XP_006650145.1|  PREDICTED: serine carboxypeptidase II-3-like       110   8e-26   
gb|KJB75608.1|  hypothetical protein B456_012G048700                    110   8e-26   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         110   8e-26   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       110   8e-26   
gb|AAB65475.1|  Serine carboxypeptidase isolog; 30227-33069             110   8e-26   
gb|KJB77359.1|  hypothetical protein B456_012G133800                    109   8e-26   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              110   9e-26   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         110   9e-26   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         110   9e-26   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       110   9e-26   
ref|NP_172575.2|  serine carboxypeptidase-like 31                       110   9e-26   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             110   9e-26   
emb|CDP02317.1|  unnamed protein product                                110   9e-26   
ref|NP_001184957.1|  serine carboxypeptidase-like 31                    110   9e-26   



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 2/120 (2%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +ES RALFYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +ES RALFYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  258  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNP
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNP  115



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  258  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNP
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNP  115



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  215
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  216  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            TVN+ESGRALFYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  396  WNP  404
             NP
Sbjct  121  LNP  123



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 8/126 (6%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  206
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  207  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  386
            GY TVN+ESGRALFYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  387  TLYWNP  404
            ++Y NP
Sbjct  121  SIYLNP  126



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   159 bits (401),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NP
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNP  120



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  122



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 8/124 (6%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  212
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  213  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  392
            VTVN+E+GR LFYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK L
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHL  118

Query  393  YWNP  404
            Y NP
Sbjct  119  YLNP  122



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NP
Sbjct  62   YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNP  120



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NP
Sbjct  102  YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNP  160



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +3

Query  87   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  266
            L +  S+     +  V QQ LD VL+LPG  FN+SFAHYSGYVTVNQESGR LFYWF EA
Sbjct  25   LYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGYVTVNQESGRNLFYWFMEA  84

Query  267  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTLY NP
Sbjct  85   VEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTLYLNP  130



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  122



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  122



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NP
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNP  119



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NP
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNP  119



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  157



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  258  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NP
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNP  122



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEAVEDPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GCSSIA+G AEE+GPFH++ DGKTLY N
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLN  135



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  258  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NP
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNP  122



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALFYWF EAVEDP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSI FG AEE+GPFH+  DGKTLY NP
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNP  128



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  122



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 12/119 (10%)
 Frame = +3

Query  72   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            E+GRALFYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP
Sbjct  63   EAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNP  121



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 90/112 (80%), Gaps = 4/112 (4%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            YWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NP
Sbjct  73   YWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNP  124



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  299
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALFYWFFEAVEDP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  300  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NP
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNP  122



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  72   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            YWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NP
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNP  123



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 5/105 (5%)
 Frame = +3

Query  90   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV  269
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  270  EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNP  126



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  260
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  261  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NP
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNP  126



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +3

Query  51   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  215
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  216  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  396  WNP  404
             NP
Sbjct  121  LNP  123



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +3

Query  51   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  215
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  216  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  396  WNP  404
             NP
Sbjct  121  LNP  123



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSS-----VDQQKLDAVLDLPGLGFNVSFAHYSGYV  215
            M+   W   L VL++  ++  G   S+     + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  216  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
             VN++SGRALFYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  396  WNP  404
             NP
Sbjct  121  LNP  123



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  87   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  266
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  267  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNP  127



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 3/111 (3%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NP
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNP  124



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NP
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NP
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRALFYWF EA EDP+SKPLVLWLNGGP
Sbjct  32   QQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRALFYWFVEAAEDPTSKPLVLWLNGGP  91

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G+AEEVGPFH++ DGKTLY NP
Sbjct  92   GCSSIAYGMAEEVGPFHIQADGKTLYLNP  120



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALFYW  EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDPQSKPLLLWLNG  97

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NP
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  260
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  261  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NP
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNP  126



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +3

Query  75   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  246  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NP
Sbjct  69   FYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNP  121



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  117  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  296
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALFYWFFEAVEDP SKPLV
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLV  84

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NP
Sbjct  85   LWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNP  120



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  260
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  261  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NP
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNP  126



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA EDPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            PGCSSIA+GLAEEVGPFH+EKDGKTLY N
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLN  94



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 86/116 (74%), Gaps = 9/116 (8%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            CL F++ L      G G     S  + QQ+LD VL LPG  F+VSFAHYSGYVTVN+ESG
Sbjct  21   CLFFLINLYV----GTGVAFSLSDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESG  76

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            RA FYWF EAVEDP SKPLVLWLNG PGCSSI +G AEEVG F+++ DGKTLY NP
Sbjct  77   RAFFYWFMEAVEDPESKPLVLWLNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNP  132



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NP
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NP
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIAFG AEE+GPFH+  DGK++Y NP
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNP  120



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  231  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             GRALFYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLN  116



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G AEE+GPFH+  DGK++Y NP
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKSVYLNP  120



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  59   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  118



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  73   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  132



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  106  QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  165

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G AEE+GPFH+  DGK +Y NP
Sbjct  166  GCSSIAYGEAEEIGPFHINADGKPVYLNP  194



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G AEE+GPFH+  DGK +Y NP
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNP  120



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALF
Sbjct  11   NALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALF  68

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YWFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  69   YWFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  119



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G+AEE+GPFH+  D  +LY NP
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNP  123



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G+AEE+GPFH+  D  +LY NP
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNP  123



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  51   MSALSWGCLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  221
            MS  S   +L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFAHY+GYVTV
Sbjct  1    MSGASRCAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTV  60

Query  222  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ++E G ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ N
Sbjct  61   SEERGAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMN  120

Query  402  P  404
            P
Sbjct  121  P  121



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  12   NALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVTTNEKLGRALF  68

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  69   YWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLN  119



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  13   NALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALF  69

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  70   YWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLN  120



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            A +  C ++ +++   +   +   S   Q  D V +LPG  FNV+FAHYSG+VT N++ G
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ--DKVWNLPGQNFNVNFAHYSGFVTTNEKMG  73

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  74   RALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  128



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            + Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW FEAVED  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  119



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            + Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW FEA EDP+SKPLVLWLNG
Sbjct  63   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPASKPLVLWLNG  122

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  123  GPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  152



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LFYWF EA+EDP SKPLVLWLNGGP
Sbjct  32   QQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLFYWFIEALEDPHSKPLVLWLNGGP  91

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIAFG +EE+GPFH+  DGKTL+ NP
Sbjct  92   GCSSIAFGQSEEIGPFHINPDGKTLHPNP  120



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFYWFFEA +D +SKPLVLWLNG
Sbjct  29   LSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFYWFFEATDDAASKPLVLWLNG  88

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  89   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  118



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C + V LLA +       + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  67

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  68   WFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  117



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
            M+     C ++ +L    +   +  + + Q++ D V  LPG  FNV+FAHYSG+VT N++
Sbjct  1    MAKTRRSCFVYAILAIAHLCNCE--AILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEK  58

Query  231  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             GRALFYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  115



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  231  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  116



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  231  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  116



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ +  LAT+     G S   Q++ D V  LPG  F+VSFAHYSG+VT N++ GRALF
Sbjct  31   NALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALF  87

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  88   YWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  138



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +3

Query  51   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  221
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  222  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  12   NALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N
Sbjct  69   YWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLN  119



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A FYWF E+ EDPSSKPL LW
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDPSSKPLALW  106

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGP CSSIAFG AEE+GPF    DGK++Y NP
Sbjct  107  LNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNP  140



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +3

Query  69   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
              L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  12   NALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N
Sbjct  69   YWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLN  119



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  231  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             GRALFYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLN  116



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C + V LLA +      ++ + Q++ D V  LPG  FNV F HYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALFY  67

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  68   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLN  117



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  305
            S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW  EA EDP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            NGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            + Q+  D V  LPG  FNV FAHYSG+VT N++ GRALFYW FEA ED  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GPGCSS+AFG AEE+GPFH++ DGKTLY N
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLN  120



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 76/108 (70%), Gaps = 19/108 (18%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG--  311
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALFYWFFEA EDP+SKP+VLWLNG  
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  312  -----------------GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
                             GPGCSSIA+G AEE+GPFH++ D KTLY NP
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNP  145



>gb|AEX12786.1| hypothetical protein 2_8315_02, partial [Pinus radiata]
Length=128

 Score =   131 bits (329),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSS+A+G AEE+GPFH+  DGK+LY NP
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNP  106



>gb|AEX12772.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12773.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12774.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12777.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12778.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12780.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12781.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12784.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   131 bits (329),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSS+A+G AEE+GPFH+  DGK+LY NP
Sbjct  77   PGCSSVAYGEAEELGPFHINADGKSLYLNP  106



>gb|AEX12770.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12771.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12775.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12776.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12779.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12782.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12783.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12785.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   131 bits (329),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSS+A+G AEE+GPFH+  DGK+LY NP
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNP  106



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            LL V L +T+    + S+  D   +Q  D +  LPG   NV+FA YSGY+TV+  +GRAL
Sbjct  18   LLLVALQSTATSTWEESNERDWRNEQAKDRITQLPGQPSNVNFAQYSGYITVDNNAGRAL  77

Query  246  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NP
Sbjct  78   FYWLIEATENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHINADGKSLYLNP  130



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  108  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSK  287
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALFYWFFEA EDP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  288  PLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NP
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNP  131



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIAFG+ EEVGPFHV  DGK ++ NP
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNP  116



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIAFG+ EEVGPFHV  DGK ++ NP
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNP  116



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDG----GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  218
            M+     C ++VL  A ++ G        + + +++ D V  LPG  FNV+FA YSG+VT
Sbjct  1    MAKTRGSCFVYVLF-AIAVLGIAHFCNCEAVLSEKEQDKVSKLPGQNFNVNFAQYSGFVT  59

Query  219  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
             N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY 
Sbjct  60   TNEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYL  119

Query  399  N  401
            N
Sbjct  120  N  120



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSSIAFGL EEVGPFHV  DGK ++ NP
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNP  121



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSSIAFGL EEVGPFHV  DGK ++ NP
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNP  121



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 4/122 (3%)
 Frame = +3

Query  51   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  221
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  222  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  399  NP  404
            NP
Sbjct  121  NP  122



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 8/127 (6%)
 Frame = +3

Query  48   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  206
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  207  GYVTVNQESGRALFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  383
            GY+TVN+++GR LFYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG
Sbjct  70   GYITVNEDTGRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDG  129

Query  384  KTLYWNP  404
             TLY NP
Sbjct  130  NTLYLNP  136



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   134 bits (338),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 4/122 (3%)
 Frame = +3

Query  51   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  221
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  222  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  399  NP  404
            NP
Sbjct  121  NP  122



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   133 bits (335),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  311
            QQ+ D +   LPG  FN+SF HYSGY+TVN+++GR LFYWF +A   DP+SKPL+LWLNG
Sbjct  33   QQEHDRIDRPLPGQNFNISFEHYSGYITVNEDAGRNLFYWFIQADHVDPTSKPLLLWLNG  92

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G AEE+GPFH+  DGK L++NP
Sbjct  93   GPGCSSIAYGEAEEIGPFHINSDGKNLHFNP  123



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSS+AFG AEE+GPF +  DGKTLY NP
Sbjct  78   LNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNP  111



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   132 bits (332),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  255  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            F E+  +  P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNP  116



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   132 bits (333),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  311
            QQ+ D +   LPG  FN+SF HYSGY+TVN+++GR LFYWF +A   DP+S PL+LWLNG
Sbjct  33   QQEQDRIDRPLPGQNFNISFEHYSGYITVNEDAGRNLFYWFIQADHVDPTSMPLLLWLNG  92

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIAFG AEE+GPFH+  D KTLY NP
Sbjct  93   GPGCSSIAFGEAEEIGPFHINSDSKTLYLNP  123



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSSIA+GL EEVGPFHV  DGK ++ NP
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNP  121



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  111



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  111



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D V  +PG  F+V FA Y+GYV V++E G +LFYWFFEA +DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSIA+G+AEEVGPFHV  DG+ ++ NP
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNP  131



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  252  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NP
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNP  115



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  252  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NP
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNP  115



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  311
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G AEE+GPFH+  DG TL+ NP
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNP  124



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   131 bits (329),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  311
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSIA+G AEE+GPFH+  DG TL+ NP
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNP  124



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  255  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NP
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNP  116



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  255  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNP  116



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  258  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NP
Sbjct  68   VEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNP  118



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   130 bits (328),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALFY
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALFY  68

Query  252  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            W  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  69   WLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNP  121



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  VLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIA  335
            V  +PG  F+ SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGPGCSSIA
Sbjct  1    VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIA  60

Query  336  FGLAEEVGPFHVEKDGKTLYWNP  404
            FG+ EEVGPFHV  DGK ++ NP
Sbjct  61   FGVGEEVGPFHVNADGKGVHMNP  83



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   130 bits (327),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  81   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALFYW 
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  258  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NP
Sbjct  68   VEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNP  118



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  255  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNP  116



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  296
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ NP
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNP  118



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  255  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNP  116



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  255  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  65   LIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNP  116



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  299
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  300  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NP
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNP  117



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPL  293
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALFYW  E  A  DP S+PL
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPL  78

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLH  112



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  65   LIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNP  116



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   127 bits (320),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            S+++  Q  D +  LPG   N +FA YSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NP
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNP  113



>gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe 
guttata]
Length=183

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = +3

Query  69   GCLLFVLLL----ATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            G L+F L L    ATSI          QQ LD +  LPG   +V F+ YSGY+ VN+   
Sbjct  3    GQLIFALFLLPIIATSIS--TTPPYPKQQALDKITKLPGQPSSVKFSQYSGYIKVNENPI  60

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  392
            RALFYWF EA + P SKPLVLWLNGGPGCSSIA+G +EEVGPF V  DG+TL
Sbjct  61   RALFYWFIEATKKPESKPLVLWLNGGPGCSSIAYGASEEVGPFRVGADGRTL  112



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 85/119 (71%), Gaps = 10/119 (8%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S  ++ C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  234  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  115



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  7    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  66

Query  258  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NP
Sbjct  67   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNP  117



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++NP
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNP  116



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   127 bits (319),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  293
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   E+P SKPL
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPL  77

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  78   VLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNP  114



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  299
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  300  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NP
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNP  117



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  258  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NP
Sbjct  68   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNP  118



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  118



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  240  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLN  116



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  117  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKP  290
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALFYW  E+     P S+P
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRP  82

Query  291  LVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            LVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY
Sbjct  83   LVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLY  117



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  240  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLN  116



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  293
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   + P SKPL
Sbjct  17   ASCCRDEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQHPESKPL  76

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY NP
Sbjct  77   VLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHNP  113



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   126 bits (317),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLN  111



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
             L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALF
Sbjct  7    TLFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALF  66

Query  249  YWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            YWF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++NP
Sbjct  67   YWFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNP  120



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLV
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLV  77

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  78   LWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  113



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYW  63

Query  255  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NP
Sbjct  64   LTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNP  115



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
             L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALFY
Sbjct  15   ALSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFY  73

Query  252  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            W  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NP
Sbjct  74   WLIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNP  126



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALFYW  EA     P S+PLV
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALFYWLTEAPASRRPESRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL++NP
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNP  118



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   125 bits (315),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +3

Query  75   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  246  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  72   FYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  126



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLN  111



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            +S      VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGR
Sbjct  1    MSHSIFCVVLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGR  60

Query  240  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ALFYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NP
Sbjct  61   ALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNP  117



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALFY  251
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALFY
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALFY  69

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            W  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NP
Sbjct  70   WLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNP  120



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  240  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLN  116



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLN  308
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLWLN  81

Query  309  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  113



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  240  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLN  116



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  296
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALFYW  E+  +  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NP
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNP  116



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  118



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  118



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  234  GRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNP  117



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G  EEVGPF V  DGKTLY
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLY  115



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G  EEVGPF V  DGKTLY
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLY  115



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  299
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  81

Query  300  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N
Sbjct  82   WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLN  115



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNP  116



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEEVGPF V  DGKTL+
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLH  115



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   124 bits (311),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  296
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NP
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNP  119



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPL  293
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NP
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNP  117



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  255  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NP
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNP  123



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEEVGPF V  DGKTL+
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLH  115



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  255  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NP
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNP  123



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   124 bits (312),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  311
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  157

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSS+A+GLAEE+GPF +  DGKTLY NP
Sbjct  158  GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNP  188



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   124 bits (311),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  305
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALFYW  EAV D + KPLVLWL
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALFYWLTEAVTDAAKKPLVLWL  80

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            NGGPGCSS+A+G +EE+GPF +++ G +LY N
Sbjct  81   NGGPGCSSVAYGASEEIGPFRIDRTGSSLYLN  112



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  296
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NP
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNP  119



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +3

Query  129  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  302
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNP  112



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  293
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  19   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPDSKPL  78

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  79   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  115



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  293
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  20   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPL  79

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  80   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  116



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +3

Query  129  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  302
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNP  112



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            + M   + G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN
Sbjct  1    MSMVFQTKGLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVN  59

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +E GRALFYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N
Sbjct  60   EEHGRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLN  118



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLNG  311
            +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW  E+    +P  +PL+LWLNG
Sbjct  26   EQLRDKITYLPGQPANVQFNQYSGYVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNG  85

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSS+A+G AEE+GPFH++ DGKTLY NP
Sbjct  86   GPGCSSVAYGAAEEIGPFHIDSDGKTLYLNP  116



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S  ++ C+L + L       G   +S+  Q  D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL-------GGCFASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  234  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY NP
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYLNP  115



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWLN  308
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPLVLWLN  81

Query  309  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNP  113



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S  ++ C+L +         G   +S+  Q  D + +LPG   NV FA +SGYVTVN+++
Sbjct  5    SPFAFLCILLLFF-------GACFASIQDQVRDRITNLPGQP-NVGFAQFSGYVTVNKKA  56

Query  234  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  57   GRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNP  115



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = +3

Query  75   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  246  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  72   FYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  126



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  299
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  144

Query  300  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N
Sbjct  145  WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLN  178



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 6/124 (5%)
 Frame = +3

Query  51   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  218
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  219  VNQESGRALFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  392
            V+   GRALFYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  393  YWNP  404
            + NP
Sbjct  121  HLNP  124



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLV
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLV  80

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ NP
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFINP  116



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 6/124 (5%)
 Frame = +3

Query  51   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  218
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  219  VNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  392
            V+   GRALFYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  393  YWNP  404
            + NP
Sbjct  121  HLNP  124



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  234  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  115



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  311
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  37   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  96

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSS+A+GLAEE+GPF +  DGKTLY NP
Sbjct  97   GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNP  127



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = +3

Query  54   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  234  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NP
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNP  115



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNP  116



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  296
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NP
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNP  116



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
              E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  65   LVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLH  113



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            + +GRALFYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NP
Sbjct  71   EHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNP  130



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLWLNG  311
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALFYW  E      P+SKPLVLWLNG
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLIEVPRHLRPASKPLVLWLNG  92

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSS+A+G +EEVGPF V  +GKTLY NP
Sbjct  93   GPGCSSVAYGASEEVGPFRVRPNGKTLYLNP  123



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   122 bits (306),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  66   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            +  L+F+L L T+      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRAL
Sbjct  17   YSILVFMLSLTTTTI--NVAATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRAL  73

Query  246  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            FYWF EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N
Sbjct  74   FYWFTEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLN  125



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +3

Query  63   SWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  242
            S  C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRA
Sbjct  7    SISCSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRA  65

Query  243  LFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LFYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  66   LFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSN  120



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  21   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  77

Query  231  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  78   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  137



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   122 bits (305),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  6    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  64

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  65   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  122



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  230
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  10   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  66

Query  231  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  67   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  126



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +3

Query  60   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  227
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  8    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  66

Query  228  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  67   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  124



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALFYW  E+    DP S+PLV
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLV  82

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            LWLNGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLH  115



>ref|XP_011022036.1| PREDICTED: serine carboxypeptidase-like 34 [Populus euphratica]
Length=486

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D V+ LPG    V+F  Y+GYVTVN+  GRALFYWFFEA+E+P  KPL+LWLNGGP
Sbjct  42   RQEADRVIRLPGQP-KVTFKQYAGYVTVNESHGRALFYWFFEAIENPEEKPLLLWLNGGP  100

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GCSSI +G AEE+GPF  ++ G+ L +NP
Sbjct  101  GCSSIGYGEAEELGPFFPKRGGQELQFNP  129



>ref|XP_010112534.1| Serine carboxypeptidase-like 34 [Morus notabilis]
 gb|EXC33987.1| Serine carboxypeptidase-like 34 [Morus notabilis]
Length=491

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D V+ LPG   +V F H++GYVTVN+  GRA FYWFFEAV+ P  KPLVLWLNGGP
Sbjct  39   EQEADRVVGLPGQPSSVKFKHFAGYVTVNETHGRAFFYWFFEAVDKPQDKPLVLWLNGGP  98

Query  318  GCSSIAFGLAEEVGPFHVEKDGK-TLYWNP  404
            GCSSI FG AEE+GPF  +  GK  L +NP
Sbjct  99   GCSSIGFGAAEELGPFFPQNGGKPKLKFNP  128



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  246  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NP
Sbjct  76   FYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNP  128



>gb|KJB77373.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=483

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  206
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  207  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  386
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  387  TLYWNP  404
            TL  NP
Sbjct  120  TLKLNP  125



>gb|KJB77374.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=452

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  206
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  207  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  386
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  387  TLYWNP  404
            TL  NP
Sbjct  120  TLKLNP  125



>gb|KJB79850.1| hypothetical protein B456_013G069700 [Gossypium raimondii]
Length=491

 Score =   121 bits (304),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  311
            +D+Q+ D V  LPG    V F  Y+GYVTVN++ GRALFYWFFEA  +P  +PL+LWLNG
Sbjct  44   LDRQEADRVTKLPGQP-TVGFKQYAGYVTVNEKHGRALFYWFFEATSEPQKRPLLLWLNG  102

Query  312  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GPGCSSI +G AEE+GPF  +KD +TL  NP
Sbjct  103  GPGCSSIGYGQAEELGPFFPKKDQQTLKLNP  133



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +3

Query  45   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  206
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  207  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  386
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  387  TLYWNP  404
            TL  NP
Sbjct  120  TLKLNP  125



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  245
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  246  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NP
Sbjct  76   FYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNP  128



>ref|XP_006467848.1| PREDICTED: serine carboxypeptidase-like 31-like [Citrus sinensis]
Length=478

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            + +GRALFYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NP
Sbjct  71   EHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNP  130



>ref|XP_006449285.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
 gb|ESR62525.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
Length=478

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  224
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  225  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            + +GRALFYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NP
Sbjct  71   EHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNP  130



>ref|XP_004304228.1| PREDICTED: serine carboxypeptidase-like 25 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            ++ VLLL   I    GS + ++++ D ++ LPG    V+F  +SGYVTVN   GRALFYW
Sbjct  17   MVSVLLLGLFISASNGSVN-EEEEADRIVSLPGQP-KVTFQQFSGYVTVNHRVGRALFYW  74

Query  255  FFEA-VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EA V+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LYWN
Sbjct  75   LTEAAVKDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTATGLYWN  124



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            LL +L L  +I+    +S   +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW
Sbjct  16   LLIILSLTITINN-VAASLTKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYW  73

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N
Sbjct  74   LTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLN  122



>ref|XP_010273635.1| PREDICTED: serine carboxypeptidase 24-like [Nelumbo nucifera]
Length=458

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            ++F+ L+  +ID  K      +Q+LD +  LPG    V F  YSGYVTV+   GRALFYW
Sbjct  11   IIFISLVGITIDAAK------EQELDRIWALPGQP-QVEFLQYSGYVTVDPVRGRALFYW  63

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EA  +P  KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N
Sbjct  64   LTEATAEPEKKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLN  112



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +3

Query  141  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNGG  314
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLVLWLNGG
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLVLWLNGG  82

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            PGCSS+A+G AEE+GPF +  DGKTL+ NP
Sbjct  83   PGCSSVAYGAAEEIGPFRIRPDGKTLFINP  112



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  296
            S+    Q  D + +LPG   NV F  YSGYVT+NQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTSDKITELPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  297  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLN  111



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = +3

Query  66   WGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GR
Sbjct  10   YQCMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGR  69

Query  240  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N
Sbjct  70   ALFYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFN  123



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLH  115



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLH  115



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   119 bits (298),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLN  141



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = +3

Query  69   GCLLFV--LLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  233
            GC L +  LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  234  GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNP
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNP  133



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +3

Query  129  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLW  302
            SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALFYW  EA  D  P S+PL+LW
Sbjct  20   SVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALFYWLTEASVDSVPDSRPLLLW  79

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LNGGPGCSSIA+G AEE+GPF +  +GKTLY N
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLN  112



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   119 bits (298),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query  126  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  305
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALFYW  EA       PLVLWL
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLVEAPPSAQPAPLVLWL  98

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            NGGPGCSSIA+G +EE+GPF ++ DGKTLY NP
Sbjct  99   NGGPGCSSIAYGASEELGPFRIDSDGKTLYLNP  131



>emb|CDY43258.1| BnaC05g48510D [Brassica napus]
Length=473

 Score =   119 bits (298),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  240  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +LFYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N
Sbjct  65   SLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRIRKGGSGLYLN  118



>ref|XP_006338367.1| PREDICTED: serine carboxypeptidase-like 25-like [Solanum tuberosum]
Length=464

 Score =   119 bits (298),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            D++  D ++ LPG    VSF  YSGYVTVNQ +GRALFYW  EA+++P SKPLV+WLNGG
Sbjct  28   DEEDADRIISLPGQP-KVSFHQYSGYVTVNQFAGRALFYWLTEAIDEPLSKPLVIWLNGG  86

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            PGCSS+A+G +EE+GPF + K    LY N
Sbjct  87   PGCSSVAYGASEEIGPFRINKTASGLYVN  115



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LNGGPGCSS+A+G +EE+GPF + + G  LY N
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYIN  113



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  123  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  302
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  303  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            LNGGPGCSS+A+G +EE+GPF + + G  LY N
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYIN  113



>ref|XP_009147382.1| PREDICTED: serine carboxypeptidase-like 25 [Brassica rapa]
 emb|CDY37553.1| BnaA05g34180D [Brassica napus]
Length=473

 Score =   119 bits (297),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  240  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +LFYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N
Sbjct  65   SLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRISKGGSGLYLN  118



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFY
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFY  69

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLN  119



>gb|KFK37671.1| hypothetical protein AALP_AA3G013500 [Arabis alpina]
Length=470

 Score =   119 bits (297),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C++F   LA      +G S + + + D +  LPG   NV+F  +SGYVTV++ SGR+LFY
Sbjct  6    CVVFTTFLAILAMTSQGRSLIREAEADRITSLPGQP-NVTFEQFSGYVTVDKLSGRSLFY  64

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            W  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N
Sbjct  65   WLTEAPNVPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRITKGGSGLYLN  114



>ref|XP_004232164.1| PREDICTED: serine carboxypeptidase-like 25 [Solanum lycopersicum]
Length=464

 Score =   119 bits (297),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +3

Query  135  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  314
            D++  D ++ LPG    VSF  YSGYVTVNQ +GRALFYW  EA+++P +KPLV+WLNGG
Sbjct  28   DEEDADRIISLPGQP-KVSFHQYSGYVTVNQFAGRALFYWLTEAIDEPLTKPLVIWLNGG  86

Query  315  PGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            PGCSS+A+G +EE+GPF + K    LY N
Sbjct  87   PGCSSVAYGASEEIGPFRINKTASGLYLN  115



>ref|XP_008800209.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=498

 Score =   119 bits (297),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  96   ATSIDGGKGSSSVDQQKL---DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  266
            AT++     S +  QQ L   D ++ LPG    V F  Y GYVTV+ E+GRALFY+F EA
Sbjct  59   ATTLFSDLSSKTYPQQGLKESDKIIKLPGQPEGVDFDQYGGYVTVDMEAGRALFYYFAEA  118

Query  267  VE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
               DPSS+PLVLWLNGGPGCSS+ +G  EE+GPF V  DGKTL+ NP
Sbjct  119  ASADPSSRPLVLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNP  165



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  251
            C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  GRALFY
Sbjct  19   CIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHGRALFY  74

Query  252  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            WFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N
Sbjct  75   WFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLN  124



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   118 bits (296),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLN  141



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   118 bits (296),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = +3

Query  66   WGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  239
            + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GR
Sbjct  8    YQCVFLVCMVIALLDQVSSSDDGDKVQKMKDKIISLPGQPPNLNFSQFSGYVTVDSTAGR  67

Query  240  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            ALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  N
Sbjct  68   ALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRLN  121



>gb|KJB07564.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   118 bits (296),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  57   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  236
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  237  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLN  141



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 76/109 (70%), Gaps = 3/109 (3%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALFYW
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALFYW  73

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N
Sbjct  74   LTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLN  122



>gb|KDP20920.1| hypothetical protein JCGZ_21391 [Jatropha curcas]
Length=481

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = +3

Query  105  IDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSS  284
            +DG K   S++   L  V +LPG   +V F HY+GYVTVN+++GRALFYWF+EA   P  
Sbjct  32   LDGQKQFHSLENDHL--VTNLPGQP-DVDFRHYAGYVTVNEKNGRALFYWFYEATTHPDE  88

Query  285  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NP
Sbjct  89   KPLVLWLNGGPGCSSVGYGATQEIGPFLVDDDGRGLKYNP  128



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  88

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  89   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLH  118



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  119



>ref|XP_010655923.1| PREDICTED: serine carboxypeptidase-like 34 [Vitis vinifera]
Length=504

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  102  SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPS  281
            S+DG      + +QK D V  LPG    V F  Y+GYVTVN+  GRALFYWFFEA ++P 
Sbjct  44   SVDGHLSHEILARQKADRVKKLPGQP-EVGFRQYAGYVTVNESHGRALFYWFFEATQNPH  102

Query  282  SKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             KPL+LWLNGGPGCSSI FG  EE+GPF   +DGK L +NP
Sbjct  103  QKPLLLWLNGGPGCSSIGFGATEELGPFFPRRDGK-LKFNP  142



>gb|KEH32355.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=484

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +3

Query  51   MSALSWGCLLFVLLLATSIDG---GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  221
            M+      L F+LL  ++           +V+  + D ++DLPG   N S +H+SGY+ V
Sbjct  1    MNVFLVQILCFILLTTSTTISLFIKASEINVESYETDRIIDLPGQPSNPSISHFSGYINV  60

Query  222  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            N+E GRALFYWFFEA   PS+KPL+LWLNGGPGCSSI +G   E+GP  V ++G+ L +N
Sbjct  61   NEEHGRALFYWFFEAQSQPSNKPLLLWLNGGPGCSSIGYGAVVEIGPLLVNQNGEGLKFN  120

Query  402  P  404
            P
Sbjct  121  P  121



>emb|CBI29056.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  102  SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPS  281
            S+DG      + +QK D V  LPG    V F  Y+GYVTVN+  GRALFYWFFEA ++P 
Sbjct  21   SVDGHLSHEILARQKADRVKKLPGQP-EVGFRQYAGYVTVNESHGRALFYWFFEATQNPH  79

Query  282  SKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             KPL+LWLNGGPGCSSI FG  EE+GPF   +DGK L +NP
Sbjct  80   QKPLLLWLNGGPGCSSIGFGATEELGPFFPRRDGK-LKFNP  119



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  141  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPG  320
            Q+ D ++ LPG  + V+F  YSGYVTV+ E+GRALFY+F E+  +PS+KPLVLWLNGGPG
Sbjct  69   QQADKIVALPGQSYGVNFDQYSGYVTVDPEAGRALFYYFVESPYNPSTKPLVLWLNGGPG  128

Query  321  CSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            CSS+ +G  EE+GPF +  DGKTLY N
Sbjct  129  CSSLGYGAFEELGPFRINSDGKTLYRN  155



>gb|KJB76570.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=465

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NP
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNP  126



>gb|KJB76572.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=441

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NP
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNP  126



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  132  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  305
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  86

Query  306  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  395
            NGGPGCSS+A+G AEE+GPF V  DGKTL+
Sbjct  87   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLH  116



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  119



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  255  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NP
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNP  126



>ref|XP_006373364.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51161.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=488

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  75   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  254
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  255  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  119



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  293
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALFYW  +A     P+SKPL
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLIKAPFKSQPASKPL  81

Query  294  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            VLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NP
Sbjct  82   VLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNP  118



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW  EA   P  KPLVLWLNGGP
Sbjct  36   EQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNGGP  94

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GCSS+A+G +EE+GPF + K G +LY N
Sbjct  95   GCSSVAYGASEEIGPFRINKTGSSLYLN  122



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            Q++ D ++ LPG  + V+F  YSGYVTV+ E+GRALFY+F E+  +PS+KPLVLWLNGGP
Sbjct  69   QKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGP  128

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GCSS+ +G  EE+GPF +  DGKTLY N
Sbjct  129  GCSSLGYGAFEELGPFRINSDGKTLYRN  156



>ref|XP_007035881.1| Serine carboxypeptidase-like 33 [Theobroma cacao]
 gb|EOY06807.1| Serine carboxypeptidase-like 33 [Theobroma cacao]
Length=468

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  78   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  257
             F+  L T I G    + +  Q+ D V++LPG   + S + +SGY+TVNQE GRALFYWF
Sbjct  19   FFLGFLITHIKGS--GAYLTAQESDRVINLPGQPPSPSISQFSGYITVNQEHGRALFYWF  76

Query  258  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            FEA   PS KPL+LWLNGGPGCSSIA+G A E+GP  V K+G  L++N
Sbjct  77   FEAQSQPSEKPLLLWLNGGPGCSSIAYGAASELGPLRVGKNGGDLHFN  124



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            Q++ D ++ LPG  + V+F  YSGYVTV+ E+GRALFY+F E+  +PS+KPLVLWLNGGP
Sbjct  123  QKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGP  182

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GCSS+ +G  EE+GPF +  DGKTLY N
Sbjct  183  GCSSLGYGAFEELGPFRINSDGKTLYRN  210



>ref|XP_008806724.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Phoenix 
dactylifera]
Length=473

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSS-SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
             +LF L L  SI   +      D+Q+ D V +LPG   + S +H+SGY+TVN+E+GRALF
Sbjct  12   TILFFLSLIKSIKSLQEEELYQDEQESDRVYNLPGQPKSPSLSHFSGYITVNRENGRALF  71

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YWFFEA  +PS +PL+LWLNGGPGCSSI +G A E+GP  V++ G  L +N
Sbjct  72   YWFFEAQTEPSKRPLLLWLNGGPGCSSIGYGAAVELGPLRVKRHGTGLEFN  122



>ref|XP_008806723.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Phoenix 
dactylifera]
Length=475

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +3

Query  72   CLLFVLLLATSIDGGKGSS-SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  248
             +LF L L  SI   +      D+Q+ D V +LPG   + S +H+SGY+TVN+E+GRALF
Sbjct  12   TILFFLSLIKSIKSLQEEELYQDEQESDRVYNLPGQPKSPSLSHFSGYITVNRENGRALF  71

Query  249  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            YWFFEA  +PS +PL+LWLNGGPGCSSI +G A E+GP  V++ G  L +N
Sbjct  72   YWFFEAQTEPSKRPLLLWLNGGPGCSSIGYGAAVELGPLRVKRHGTGLEFN  122



>ref|XP_008677402.1| PREDICTED: lysosomal protective protein isoform X1 [Zea mays]
 gb|ACF88069.1| unknown [Zea mays]
 gb|AFW63102.1| lysosomal protective protein [Zea mays]
Length=485

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  138  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  317
            QQ  D V  LPG    V FA Y+GYVTVN+  GRALFYWFFEA   P  KPLVLWLNGGP
Sbjct  32   QQAADRVAGLPGQP-PVGFAQYAGYVTVNETHGRALFYWFFEATASPDKKPLVLWLNGGP  90

Query  318  GCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            GCSSI +G AEE+GPF V+K    L WN
Sbjct  91   GCSSIGYGEAEELGPFLVQKGKPELRWN  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568922768400