BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001L08

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB66936.1|  hypothetical protein B456_010G166800                  75.9    3e-13   Gossypium raimondii
gb|KJB66935.1|  hypothetical protein B456_010G166800                  75.5    4e-13   Gossypium raimondii
ref|XP_011096567.1|  PREDICTED: cullin-4-like                         72.8    4e-12   Sesamum indicum [beniseed]
ref|XP_006361548.1|  PREDICTED: cullin-4-like                         70.1    3e-11   Solanum tuberosum [potatoes]
ref|XP_007025064.1|  Cullin-4B isoform 1                              67.8    2e-10   
gb|KHG11994.1|  Cullin-4 -like protein                                66.6    3e-10   Gossypium arboreum [tree cotton]
ref|XP_007025065.1|  Cullin-4B isoform 2                              67.0    3e-10   
ref|XP_009360892.1|  PREDICTED: cullin-4                              64.7    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_009759464.1|  PREDICTED: cullin-4                              64.3    3e-09   Nicotiana sylvestris
ref|NP_001234356.1|  cullin 4                                         64.3    3e-09   
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg              63.5    5e-09   Erythranthe guttata [common monkey flower]
ref|XP_009599227.1|  PREDICTED: cullin-4                              63.5    5e-09   Nicotiana tomentosiformis
ref|XP_011085242.1|  PREDICTED: cullin-4                              63.5    5e-09   
gb|KHG10035.1|  Cullin-4 -like protein                                62.4    1e-08   Gossypium arboreum [tree cotton]
gb|KJB69828.1|  hypothetical protein B456_011G044900                  62.4    1e-08   Gossypium raimondii
gb|KJB69827.1|  hypothetical protein B456_011G044900                  62.0    2e-08   Gossypium raimondii
gb|KHG21020.1|  Cullin-4 -like protein                                60.5    4e-08   Gossypium arboreum [tree cotton]
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg           60.1    6e-08   Prunus persica
ref|XP_010110959.1|  hypothetical protein L484_021653                 59.7    9e-08   
ref|XP_006449703.1|  hypothetical protein CICLE_v10014310mg           59.3    1e-07   
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2              59.3    1e-07   
ref|XP_008225565.1|  PREDICTED: cullin-4                              59.3    1e-07   Prunus mume [ume]
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                 59.3    1e-07   Citrus sinensis [apfelsine]
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg           58.9    1e-07   Citrus clementina [clementine]
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1              58.9    2e-07   Citrus sinensis [apfelsine]
gb|KDO78192.1|  hypothetical protein CISIN_1g003648mg                 58.9    2e-07   Citrus sinensis [apfelsine]
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                 58.9    2e-07   Citrus sinensis [apfelsine]
gb|KJB68319.1|  hypothetical protein B456_010G238300                  57.8    4e-07   Gossypium raimondii
ref|XP_011013417.1|  PREDICTED: cullin-4-like                         57.4    5e-07   Populus euphratica
gb|KJB68315.1|  hypothetical protein B456_010G238300                  57.0    6e-07   Gossypium raimondii
gb|KJB68318.1|  hypothetical protein B456_010G238300                  57.4    6e-07   Gossypium raimondii
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g           56.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006377605.1|  hypothetical protein POPTR_0011s08280g           56.2    1e-06   
ref|XP_008349190.1|  PREDICTED: cullin-4-like                         54.3    4e-06   
ref|XP_008371761.1|  PREDICTED: cullin-4                              53.1    1e-05   
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1              53.1    2e-05   Populus euphratica
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g           52.8    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011011309.1|  PREDICTED: cullin-4-like isoform X2              52.0    3e-05   Populus euphratica
ref|XP_004162809.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like    51.2    5e-05   
ref|XP_004149667.1|  PREDICTED: cullin-4-like                         51.2    5e-05   Cucumis sativus [cucumbers]
gb|AAL27655.2|  putative cullin protein                               49.3    2e-04   Olea europaea
gb|KDP37982.1|  hypothetical protein JCGZ_04625                       49.3    2e-04   Jatropha curcas
ref|XP_008444359.1|  PREDICTED: cullin-4                              48.9    3e-04   Cucumis melo [Oriental melon]
ref|XP_010056896.1|  PREDICTED: cullin-4                              47.4    0.001   Eucalyptus grandis [rose gum]



>gb|KJB66936.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=788

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 60/99 (61%), Gaps = 10/99 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  237  PDVDE---DPSSASMEDLDSPGASATRAATANLSRKKGT  344
             D +    DPSS  + D DS  A A   A ANLSRKK T
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKAT  92



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 60/99 (61%), Gaps = 10/99 (10%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  237  PDVDE---DPSSASMEDLDSPGASATRAATANLSRKKGT  344
             D +    DPSS  + D DS  A A   A ANLSRKK T
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKAT  92



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 59/121 (49%), Gaps = 30/121 (25%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGD--------------GAPPLHRPPPMKKAKSQAVACSLDTNK  209
            S PN  ++P +S SA  G               G       P MKKAKSQAVACSLD NK
Sbjct  2    SQPNTSTTPATSASAVPGKRSSSPRSSTTPTATGVGAASVVPAMKKAKSQAVACSLDGNK  61

Query  210  NGQH----HVHF------YPDVDEDPSSASMEDLDSPGASATRAA------TANLSRKKG  341
            NGQ     HVHF       P +++DPS  +ME   S  A   R +      TANLSRKK 
Sbjct  62   NGQQQITPHVHFAEPPVHSPMMEDDPSDVAMEASPSSTAFGRRVSASGGGVTANLSRKKA  121

Query  342  T  344
            T
Sbjct  122  T  122



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/103 (51%), Positives = 61/103 (59%), Gaps = 10/103 (10%)
 Frame = +3

Query  57   MSQPTSNPNKR-----SSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH  221
            MSQPT+NP KR      S  SS + T G           MKKAKSQA+ CS+D NKNGQH
Sbjct  1    MSQPTTNPKKRFIPTNPSSSSSSTPTTGGTGGRTPAYSSMKKAKSQALPCSID-NKNGQH  59

Query  222  HVHFYPDVDEDPS--SASMEDLDSPGASATRAATANLSRKKGT  344
             VHF  D+D DPS  S+ MED +   +S     TANLSRKK T
Sbjct  60   -VHFSSDID-DPSGNSSMMEDSNIDASSVAGGVTANLSRKKAT  100



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  317
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  318  ANLSRKKGT  344
            ANLSRKK T
Sbjct  87   ANLSRKKAT  95



>gb|KHG11994.1| Cullin-4 -like protein [Gossypium arboreum]
Length=571

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 58/99 (59%), Gaps = 12/99 (12%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  236
            MS P   P KRS      +ATA   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRSI----TNATASSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  52

Query  237  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKGT  344
             D   V  DPSS  + D DS  A A   A ANLSRKK T
Sbjct  53   QDDNNVLFDPSSMPLHD-DSKSADACAPAAANLSRKKAT  90



>ref|XP_007025065.1| Cullin-4B isoform 2, partial [Theobroma cacao]
 gb|EOY27687.1| Cullin-4B isoform 2, partial [Theobroma cacao]
Length=653

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  317
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  318  ANLSRKKGT  344
            ANLSRKK T
Sbjct  87   ANLSRKKAT  95



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 57/101 (56%), Gaps = 11/101 (11%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY-----  236
            S+PNKRSS  +    ++     P    PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPNKRSSAINHSGTSSSSSLNPSSAGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  237  ----PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKG  341
                PD D   DPSS S+++   P   + R   ANLSRKK 
Sbjct  65   PSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKA  105



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 60/111 (54%), Gaps = 29/111 (26%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  206
            MSQPT+NP KRSS +          S+ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSFFISTNPSSSTPSTGSGDVGSGGPAYSL---MKKAKSQAV-------  50

Query  207  KNGQHHVHFYPDVDEDPS--SASMED--LDSPG-ASATRAATANLSRKKGT  344
             NGQ HVHF  D  EDPS  SA MED  +D+P  AS     TANLSRKK T
Sbjct  51   -NGQ-HVHF--DNLEDPSGNSAMMEDSNMDAPSRASVGGGVTANLSRKKAT  97



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSAS--MEDLDSPGASATRAATANLSR  332
            MKKAKSQA+ CS+D+ KNGQH VHF  D+D DPS  S  MED +   +S     TANLSR
Sbjct  1    MKKAKSQALPCSIDS-KNGQH-VHFSSDID-DPSGNSPMMEDCNIDSSSVAGGVTANLSR  57

Query  333  KKGT  344
            KK T
Sbjct  58   KKAT  61



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 66/122 (54%), Gaps = 29/122 (24%)
 Frame = +3

Query  57   MSQPT----SNPNKRSS---PYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNG  215
            MSQ T    +NPNKRSS   P ++    A   A P+   P +KKAKSQ V+CSLD N NG
Sbjct  1    MSQRTNSSSTNPNKRSSSTNPNANTPIAAAAAASPIF--PALKKAKSQGVSCSLDGNMNG  58

Query  216  QH------HVHF------YPDVDEDPSSASMEDLDSP-------GASATRAATANLSRKK  338
            Q       HVHF       P +++DP+ A + D  SP       GA++    T+NLSRKK
Sbjct  59   QQQQQPTPHVHFAETPALSPMIEDDPNDAVL-DASSPSSAFGRVGATSCGGITSNLSRKK  117

Query  339  GT  344
             T
Sbjct  118  AT  119



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 53/111 (48%), Positives = 59/111 (53%), Gaps = 29/111 (26%)
 Frame = +3

Query  57   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  206
            MSQPT+NP KRSS +          ++ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSIFISTNTSSSTPTTGSGNVGSGTPAYSL---MKKAKSQAV-------  50

Query  207  KNGQHHVHFYPDVDEDPSSAS--MED--LDSPG-ASATRAATANLSRKKGT  344
             NGQ HVHF  D  EDPSS S  MED  +D+P   S     TANLSRKK T
Sbjct  51   -NGQ-HVHF--DNLEDPSSNSSMMEDSNMDAPSRVSVGGGVTANLSRKKAT  97



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 18/79 (23%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQH----HVHF------YPDVDEDPSSASMEDLDSPG-----  293
            MKKAKSQAVACSLD NKNGQ     HVHF       P +++DP+  ++E   SP      
Sbjct  43   MKKAKSQAVACSLDGNKNGQQQIAPHVHFAEPPAHSPMIEDDPNDVALET-SSPSNAFGR  101

Query  294  --ASATRAATANLSRKKGT  344
              A++    TANLSRKK T
Sbjct  102  GLAASAGGVTANLSRKKAT  120



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H    MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS        A
Sbjct  23   HFQQSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMALDDDSKSDDGRAPA  82

Query  315  TANLSRKKGT  344
             ANLSRKK T
Sbjct  83   AANLSRKKAT  92



>gb|KJB69828.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=786

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  315  TANLSRKKGT  344
             ANLSRKK T
Sbjct  88   AANLSRKKAT  97



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query  144  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  314
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  315  TANLSRKKGT  344
             ANLSRKK T
Sbjct  88   AANLSRKKAT  97



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKSQAVA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSQAVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KGT  344
            K T
Sbjct  60   KAT  62



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 13/102 (13%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY-----  236
            S+P KRSS  ++ ++++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTSSSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  237  ----PDVDE--DPSSASM-EDLDSPGASATRAATANLSRKKG  341
                PD D   DPS+ ++ EDL S   S +RA  ANLSRKK 
Sbjct  65   PSQDPDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKA  105



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 6/65 (9%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PPMKK KSQA+ACSLD NKNG HH +    DV  DPS A  ED        +  A ANLS
Sbjct  35   PPMKKTKSQAMACSLDPNKNGLHHNNQDNNDVVFDPSMALDED-----PKPSDGAAANLS  89

Query  330  RKKGT  344
            RKK T
Sbjct  90   RKKAT  94



>ref|XP_006449703.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62943.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  1    MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  56

Query  336  KG  341
            K 
Sbjct  57   KA  58



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 60/102 (59%), Gaps = 13/102 (13%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  239
            S+P KRSS  ++ + ++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTISSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  240  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKG  341
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKK 
Sbjct  65   PSQDSDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKA  105



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>gb|KDO78192.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=739

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  159  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  22   MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  77

Query  336  KG  341
            K 
Sbjct  78   KA  79



>gb|KJB68319.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=759

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KGT  344
            K T
Sbjct  60   KAT  62



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANL  326
            PPMKKAK QA  ACS LD NKNG+HH     DV  DPSS S++D           A ANL
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGRHHSD---DVVFDPSSMSLDDDPKLVDYRPPPAAANL  81

Query  327  SRKKGTL  347
            SRKK TL
Sbjct  82   SRKKATL  88



>gb|KJB68315.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=703

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KGT  344
            K T
Sbjct  60   KAT  62



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  335
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  336  KGT  344
            K T
Sbjct  60   KAT  62



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANL  326
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D           A ANL
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDDDPKLVDYRPPPAAANL  81

Query  327  SRKKGTL  347
            SRKK TL
Sbjct  82   SRKKATL  88



>ref|XP_006377605.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55402.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=741

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANL  326
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D           A ANL
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDDDPKLVDYRPPPAAANL  81

Query  327  SRKKGTL  347
            SRKK TL
Sbjct  82   SRKKATL  88



>ref|XP_008349190.1| PREDICTED: cullin-4-like [Malus domestica]
Length=579

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 58/104 (56%), Gaps = 14/104 (13%)
 Frame = +3

Query  72   SNPNKRSSPYSSCSATAGDGAPPLHRP---PPMKKAKSQAVACSLDTNKNGQHHVHFY--  236
            S+PNKRSS  +    ++   +  L+     PPMKKAKSQAVA SLD +KNG HH H +  
Sbjct  5    SHPNKRSSAINHSGTSSSSSSSSLNPSSAGPPMKKAKSQAVAGSLDXSKNGLHHHHHHHP  64

Query  237  -------PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKG  341
                   PD D   DPSS S+++   P   + R   ANLSRKK 
Sbjct  65   HTHPSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKA  108



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 45/73 (62%), Gaps = 10/73 (14%)
 Frame = +3

Query  153  PPMKKAKSQAVACSLDTNKNGQHHVHFY--------PDVDE--DPSSASMEDLDSPGASA  302
            PPMKKAKSQAVACSLD +KNG HH H +        PD D   DPSS S++D   P   +
Sbjct  36   PPMKKAKSQAVACSLDPSKNGLHHHHHHPHTHPTQDPDNDXVFDPSSMSLDDDLRPDDPS  95

Query  303  TRAATANLSRKKG  341
             R   ANLSRKK 
Sbjct  96   PRGVAANLSRKKA  108



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  330  RKKGT  344
            RKK T
Sbjct  80   RKKAT  84



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  28   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  84

Query  330  RKKGT  344
            RKK T
Sbjct  85   RKKAT  89



>ref|XP_011011309.1| PREDICTED: cullin-4-like isoform X2 [Populus euphratica]
Length=655

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = +3

Query  156  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  329
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  330  RKKGT  344
            RKK T
Sbjct  80   RKKAT  84



>ref|XP_004162809.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cucumis sativus]
Length=833

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQ----PLDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  321  NLSRKKGT  344
            NLSRKK T
Sbjct  102  NLSRKKAT  109



>ref|XP_004149667.1| PREDICTED: cullin-4-like [Cucumis sativus]
Length=833

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQ----PLDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  321  NLSRKKGT  344
            NLSRKK T
Sbjct  102  NLSRKKAT  109



>gb|AAL27655.2| putative cullin protein [Olea europaea]
Length=816

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 17/88 (19%)
 Frame = +3

Query  120  AGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH---HVHFYPD-----VDEDPSSASME  275
            A DGA      P MKKAKSQA+A SLD NKNGQ    HVHF P      +DED +   ++
Sbjct  7    ADDGASI---SPRMKKAKSQALAYSLD-NKNGQQSVPHVHFDPSANSSMIDEDSNDVVLD  62

Query  276  DLDSPGA-----SATRAATANLSRKKGT  344
               S  +           TANL+RKK T
Sbjct  63   ASASSNSFGRVVGGGGGVTANLARKKAT  90



>gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 9/72 (13%)
 Frame = +3

Query  153  PPMKKAKSQAV-ACS---LDTNKNGQHHVHFYP----DVDEDPSSASMEDLDSPGASATR  308
            PPMKKAKSQAV ACS     +NKNG HH +       D+  DPSS +++D D      + 
Sbjct  27   PPMKKAKSQAVSACSPLEPTSNKNGLHHFNSATAPENDIVFDPSSMTLDD-DPKLDDRSP  85

Query  309  AATANLSRKKGT  344
               ANLSRKK T
Sbjct  86   PPAANLSRKKAT  97



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASM--EDLDSPGAS----ATRAATA  320
            MKK KSQ     LD NKNG HH   + D D DPSS  +  EDL  P  S    A+R+   
Sbjct  45   MKKTKSQ----PLDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSSLIGASRSVAT  97

Query  321  NLSRKKGT  344
            NLSRKK T
Sbjct  98   NLSRKKAT  105



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 15/77 (19%)
 Frame = +3

Query  159  MKKAKSQAVACSLDTNKNGQHHVHFYP--------------DVDEDPSSASMED-LDSPG  293
            MKKAKSQAVA SLD+    ++ +H +P              DV  DP++ S+ED + S  
Sbjct  38   MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  97

Query  294  ASATRAATANLSRKKGT  344
              A  +  ANLSRKK T
Sbjct  98   MVAGHSVAANLSRKKAT  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552569507840