BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001H20

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774884.1|  PREDICTED: uncharacterized protein LOC104224864    108   6e-26   Nicotiana sylvestris
ref|XP_009592008.1|  PREDICTED: uncharacterized protein LOC104088938    108   9e-26   Nicotiana tomentosiformis
ref|XP_006347543.1|  PREDICTED: uncharacterized protein LOC102597734    104   1e-24   Solanum tuberosum [potatoes]
ref|XP_009361233.1|  PREDICTED: mitochondrial import inner membra...    104   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_007218831.1|  hypothetical protein PRUPE_ppa010176mg             104   2e-24   Prunus persica
ref|XP_008234610.1|  PREDICTED: uncharacterized protein LOC103333537    104   2e-24   Prunus mume [ume]
ref|XP_009351884.1|  PREDICTED: mitochondrial import inner membra...    103   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_008376859.1|  PREDICTED: uncharacterized protein LOC103439979    102   7e-24   Malus domestica [apple tree]
ref|XP_008381679.1|  PREDICTED: uncharacterized protein LOC103444516    102   1e-23   Malus domestica [apple tree]
ref|XP_004235047.1|  PREDICTED: uncharacterized protein LOC101257149    102   1e-23   Solanum lycopersicum
ref|XP_010110465.1|  hypothetical protein L484_001864                 99.0    6e-23   
ref|XP_003523301.1|  PREDICTED: uncharacterized protein LOC100775460    100   8e-23   Glycine max [soybeans]
gb|KCW46677.1|  hypothetical protein EUGRSUZ_K00480                   99.0    2e-22   Eucalyptus grandis [rose gum]
ref|XP_010035340.1|  PREDICTED: mitochondrial import inner membra...  99.0    2e-22   Eucalyptus grandis [rose gum]
ref|XP_003526780.1|  PREDICTED: uncharacterized protein LOC100813121  98.6    3e-22   Glycine max [soybeans]
ref|XP_002317852.1|  mitochondrial import inner membrane transloc...  97.8    5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007136378.1|  hypothetical protein PHAVU_009G040400g           97.8    6e-22   Phaseolus vulgaris [French bean]
gb|AGV54806.1|  hypothetical protein                                  96.7    1e-21   Phaseolus vulgaris [French bean]
emb|CAN60468.1|  hypothetical protein VITISV_030224                   92.4    6e-21   Vitis vinifera
gb|KGN49828.1|  hypothetical protein Csa_5G139080                     93.2    2e-20   Cucumis sativus [cucumbers]
ref|XP_004502789.1|  PREDICTED: uncharacterized protein LOC101495679  93.6    2e-20   Cicer arietinum [garbanzo]
ref|XP_004145954.1|  PREDICTED: uncharacterized protein LOC101208652  93.2    3e-20   Cucumis sativus [cucumbers]
gb|KDP24771.1|  hypothetical protein JCGZ_25171                       92.8    3e-20   Jatropha curcas
ref|XP_004160398.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  92.8    3e-20   
ref|XP_002267996.1|  PREDICTED: mitochondrial import inner membra...  91.7    8e-20   Vitis vinifera
ref|XP_002519617.1|  protein translocase, putative                    91.7    9e-20   Ricinus communis
ref|XP_008437651.1|  PREDICTED: uncharacterized protein LOC103482996  90.9    2e-19   Cucumis melo [Oriental melon]
ref|XP_010045371.1|  PREDICTED: uncharacterized protein LOC104434104  89.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_011005386.1|  PREDICTED: uncharacterized protein LOC105111656  89.0    1e-18   Populus euphratica
gb|KJB52400.1|  hypothetical protein B456_008G262900                  88.2    2e-18   Gossypium raimondii
ref|XP_010541518.1|  PREDICTED: uncharacterized protein LOC104814958  88.2    2e-18   Tarenaya hassleriana [spider flower]
gb|KJB52401.1|  hypothetical protein B456_008G262900                  87.8    2e-18   Gossypium raimondii
ref|XP_002321938.1|  mitochondrial import inner membrane transloc...  87.8    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010276440.1|  PREDICTED: uncharacterized protein LOC104611181  87.4    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_007039252.1|  Mitochondrial import inner membrane transloc...  87.4    4e-18   
ref|XP_011084593.1|  PREDICTED: uncharacterized protein LOC105166...  87.0    5e-18   Sesamum indicum [beniseed]
ref|XP_011084594.1|  PREDICTED: uncharacterized protein LOC105166...  86.7    6e-18   Sesamum indicum [beniseed]
ref|XP_010519579.1|  PREDICTED: uncharacterized protein LOC104798993  86.7    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_011003323.1|  PREDICTED: uncharacterized protein LOC105110098  86.3    7e-18   Populus euphratica
gb|KJB37430.1|  hypothetical protein B456_006G203900                  84.3    1e-17   Gossypium raimondii
gb|KHG08602.1|  Mitochondrial import inner membrane translocase s...  85.5    1e-17   Gossypium arboreum [tree cotton]
gb|KJB37432.1|  hypothetical protein B456_006G203900                  84.3    2e-17   Gossypium raimondii
gb|KJB37431.1|  hypothetical protein B456_006G203900                  84.0    4e-17   Gossypium raimondii
ref|XP_011075839.1|  PREDICTED: mitochondrial import inner membra...  84.3    4e-17   Sesamum indicum [beniseed]
ref|XP_006394720.1|  hypothetical protein EUTSA_v10004788mg           84.0    5e-17   Eutrema salsugineum [saltwater cress]
gb|KJB37429.1|  hypothetical protein B456_006G203900                  84.0    6e-17   Gossypium raimondii
ref|XP_010421304.1|  PREDICTED: uncharacterized protein LOC104706780  83.6    7e-17   Camelina sativa [gold-of-pleasure]
ref|NP_197853.1|  mitochondrial import inner membrane translocase...  83.6    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454784.1|  PREDICTED: uncharacterized protein LOC104736487  83.6    8e-17   Camelina sativa [gold-of-pleasure]
gb|AAM65866.1|  unknown                                               83.2    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286543.1|  hypothetical protein CARUB_v10001771mg           82.4    2e-16   Capsella rubella
ref|XP_010909429.1|  PREDICTED: uncharacterized protein LOC105035540  80.5    2e-16   
gb|EYU19717.1|  hypothetical protein MIMGU_mgv1a011771mg              80.5    7e-16   Erythranthe guttata [common monkey flower]
gb|EYU19715.1|  hypothetical protein MIMGU_mgv1a011771mg              80.5    8e-16   Erythranthe guttata [common monkey flower]
emb|CDX80460.1|  BnaC07g29840D                                        80.5    9e-16   
ref|XP_010515307.1|  PREDICTED: uncharacterized protein LOC104791180  80.5    9e-16   Camelina sativa [gold-of-pleasure]
gb|EYU19716.1|  hypothetical protein MIMGU_mgv1a011771mg              80.5    9e-16   Erythranthe guttata [common monkey flower]
ref|XP_010910427.1|  PREDICTED: uncharacterized protein LOC105036351  80.5    9e-16   Elaeis guineensis
gb|KFK27737.1|  hypothetical protein AALP_AA8G422900                  79.7    2e-15   Arabis alpina [alpine rockcress]
ref|XP_003602441.1|  SAM domain family protein                        78.2    2e-15   
ref|XP_006291697.1|  hypothetical protein CARUB_v10017861mg           79.0    3e-15   
ref|NP_190525.1|  mitochondrial import inner membrane translocase...  78.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150989.1|  PREDICTED: uncharacterized protein LOC103874331  78.2    6e-15   Brassica rapa
dbj|BAM64851.1|  hypothetical protein                                 78.2    6e-15   Beta vulgaris [beet]
ref|XP_003602440.1|  SAM domain family protein                        77.8    9e-15   Medicago truncatula
ref|XP_002875975.1|  mitochondrial import inner membrane transloc...  77.0    1e-14   
ref|XP_010503618.1|  PREDICTED: uncharacterized protein LOC104780778  77.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008788093.1|  PREDICTED: uncharacterized protein LOC103705...  75.9    3e-14   Phoenix dactylifera
ref|XP_010671269.1|  PREDICTED: uncharacterized protein LOC104888105  76.3    3e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO44881.1|  hypothetical protein CISIN_1g024983mg                 76.3    3e-14   Citrus sinensis [apfelsine]
gb|KDO44886.1|  hypothetical protein CISIN_1g024983mg                 75.5    4e-14   Citrus sinensis [apfelsine]
ref|XP_006493476.1|  PREDICTED: uncharacterized protein LOC102629263  75.9    4e-14   Citrus sinensis [apfelsine]
ref|XP_006441309.1|  hypothetical protein CICLE_v10021773mg           75.9    4e-14   Citrus clementina [clementine]
gb|KDO44885.1|  hypothetical protein CISIN_1g024983mg                 75.1    4e-14   Citrus sinensis [apfelsine]
gb|KDO44882.1|  hypothetical protein CISIN_1g024983mg                 75.9    4e-14   Citrus sinensis [apfelsine]
gb|KDO44884.1|  hypothetical protein CISIN_1g024983mg                 75.1    5e-14   Citrus sinensis [apfelsine]
gb|KDO44883.1|  hypothetical protein CISIN_1g024983mg                 75.5    5e-14   Citrus sinensis [apfelsine]
ref|XP_006441307.1|  hypothetical protein CICLE_v10021773mg           75.5    5e-14   
ref|XP_006441308.1|  hypothetical protein CICLE_v10021773mg           75.5    5e-14   Citrus clementina [clementine]
ref|XP_010426471.1|  PREDICTED: uncharacterized protein LOC104711470  75.5    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006844757.1|  hypothetical protein AMTR_s00016p00256760        75.1    7e-14   
ref|XP_009149730.1|  PREDICTED: uncharacterized protein LOC103873049  75.1    8e-14   Brassica rapa
emb|CDY08145.1|  BnaA06g15810D                                        74.7    9e-14   Brassica napus [oilseed rape]
emb|CDY05941.1|  BnaC08g21180D                                        74.7    1e-13   
ref|XP_008788092.1|  PREDICTED: uncharacterized protein LOC103705...  74.7    1e-13   Phoenix dactylifera
gb|KFK34395.1|  hypothetical protein AALP_AA5G139700                  73.2    3e-13   Arabis alpina [alpine rockcress]
gb|KHG07931.1|  Uncharacterized protein F383_34960                    72.8    5e-13   Gossypium arboreum [tree cotton]
gb|EYU45348.1|  hypothetical protein MIMGU_mgv1a012092mg              72.4    6e-13   Erythranthe guttata [common monkey flower]
ref|XP_006404129.1|  hypothetical protein EUTSA_v10010930mg           70.1    4e-12   Eutrema salsugineum [saltwater cress]
gb|EPS71171.1|  hypothetical protein M569_03588                       68.6    1e-11   Genlisea aurea
ref|XP_010942297.1|  PREDICTED: uncharacterized protein LOC105060333  68.6    2e-11   
ref|XP_008811010.1|  PREDICTED: uncharacterized protein LOC103722...  67.0    5e-11   
ref|XP_008811009.1|  PREDICTED: uncharacterized protein LOC103722...  66.6    7e-11   Phoenix dactylifera
ref|XP_003579669.1|  PREDICTED: uncharacterized protein LOC100827945  66.2    1e-10   Brachypodium distachyon [annual false brome]
dbj|BAJ88716.1|  predicted protein                                    65.5    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001766937.1|  predicted protein                                65.1    2e-10   
gb|EMT03006.1|  hypothetical protein F775_30606                       65.5    2e-10   
ref|XP_009404579.1|  PREDICTED: uncharacterized protein LOC103987863  64.3    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87822.1|  predicted protein                                    63.2    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009421320.1|  PREDICTED: uncharacterized protein LOC104000893  62.8    2e-09   
emb|CDY69408.1|  BnaAnng30370D                                        62.4    2e-09   Brassica napus [oilseed rape]
ref|XP_004307936.1|  PREDICTED: uncharacterized protein LOC101296523  62.4    3e-09   Fragaria vesca subsp. vesca
ref|NP_001146865.1|  SAM domain family protein                        62.4    3e-09   Zea mays [maize]
ref|XP_009413503.1|  PREDICTED: uncharacterized protein LOC103994789  61.2    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004952617.1|  PREDICTED: uncharacterized protein LOC101769...  61.2    8e-09   Setaria italica
ref|XP_004952616.1|  PREDICTED: uncharacterized protein LOC101769...  61.2    9e-09   
gb|KJB39517.1|  hypothetical protein B456_007G017700                  60.8    1e-08   Gossypium raimondii
ref|XP_001766099.1|  predicted protein                                59.3    2e-08   
emb|CDM80696.1|  unnamed protein product                              59.3    4e-08   Triticum aestivum [Canadian hard winter wheat]
gb|KJB39516.1|  hypothetical protein B456_007G017700                  58.9    5e-08   Gossypium raimondii
ref|XP_002453918.1|  hypothetical protein SORBIDRAFT_04g021420        58.5    7e-08   Sorghum bicolor [broomcorn]
gb|ACG31629.1|  hypothetical protein                                  57.4    2e-07   Zea mays [maize]
ref|NP_001132412.1|  uncharacterized protein LOC100193860             57.0    2e-07   Zea mays [maize]
gb|AFW71638.1|  hypothetical protein ZEAMMB73_527455                  57.4    2e-07   
gb|AFW71637.1|  hypothetical protein ZEAMMB73_527455                  55.1    3e-07   
gb|AGT17334.1|  SAM domain family protein                             56.6    4e-07   Saccharum hybrid cultivar R570
gb|AGT16087.1|  hypothetical protein SHCRBa_224_E06_F_230             56.2    5e-07   Saccharum hybrid cultivar R570
gb|AGT17006.1|  SAM domain family protein                             56.2    5e-07   Saccharum hybrid cultivar R570
gb|AGT16912.1|  SAM domain family protein                             54.7    2e-06   Saccharum hybrid cultivar R570
ref|XP_004975523.1|  PREDICTED: uncharacterized protein LOC101781...  54.3    3e-06   Setaria italica
ref|XP_004975522.1|  PREDICTED: uncharacterized protein LOC101781...  54.3    3e-06   
ref|XP_003575054.1|  PREDICTED: uncharacterized protein LOC100840753  53.5    5e-06   Brachypodium distachyon [annual false brome]
gb|EEC77226.1|  hypothetical protein OsI_15770                        52.4    1e-05   Oryza sativa Indica Group [Indian rice]
emb|CAE05370.1|  OJ000315_02.15                                       52.4    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052708.1|  Os04g0405100                                     52.8    1e-05   
emb|CAH66528.1|  H0502B11.8                                           52.0    2e-05   Oryza sativa [red rice]
gb|EEE60938.1|  hypothetical protein OsJ_14687                        50.1    7e-05   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37984.1|  TPA: SAM domain protein                              48.5    3e-04   
gb|ACF84635.1|  unknown                                               48.1    3e-04   Zea mays [maize]



>ref|XP_009774884.1| PREDICTED: uncharacterized protein LOC104224864 [Nicotiana sylvestris]
Length=260

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQLP---SQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            MGEGKQG+M V++P   SQNPI Q Q K+ EL  G K WL+KQSLPVEAA VTA S  QG
Sbjct  1    MGEGKQGVMVVEMPNSSSQNPITQLQNKFKELEIGFKGWLAKQSLPVEAAVVTATSGLQG  60

Query  255  GVIGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
              IG  +G L+ D+    PTPPP ANL+P AMA+F QAQAL
Sbjct  61   AAIGGFMGTLTQDVSSSLPTPPPAANLNPQAMASFQQAQAL  101



>ref|XP_009592008.1| PREDICTED: uncharacterized protein LOC104088938 [Nicotiana tomentosiformis]
Length=261

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = +3

Query  84   MGEGKQGIMAVQLP----SQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQ  251
            MGEGKQG+M V++P    SQNPI Q Q K+ EL  G K WL+KQSLPVEAA VTA S  Q
Sbjct  1    MGEGKQGVMVVEMPNSSSSQNPIAQLQNKFKELEIGFKGWLAKQSLPVEAAVVTATSGLQ  60

Query  252  GGVIGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            G  IG  +G L+ D+    PTPPP ANL+P AMA+F QAQAL
Sbjct  61   GAAIGGFMGTLTQDVSSSLPTPPPAANLNPQAMASFQQAQAL  102



>ref|XP_006347543.1| PREDICTED: uncharacterized protein LOC102597734 [Solanum tuberosum]
Length=260

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS---QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            MGEGKQG M V++P+   QNPI Q Q K+ EL  G K WLSKQS+PVEAA VTA S  QG
Sbjct  1    MGEGKQGAMVVEMPNSSNQNPIAQLQNKFKELEIGFKGWLSKQSIPVEAAVVTATSGLQG  60

Query  255  GVIGAILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
              IG  +G L+ D+    PTPP GANL+P AMA+F QAQAL
Sbjct  61   AAIGGFMGTLTQDVSSSMPTPPAGANLNPQAMASFQQAQAL  101



>ref|XP_009361233.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Pyrus x bretschneideri]
Length=258

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GKQG M  ++ P QNPIE+FQA++ EL +GVK WL+KQSLPVEAA VT  S AQG  
Sbjct  1    MEQGKQGAMVEKMVPPQNPIEEFQARFKELQAGVKGWLAKQSLPVEAAVVTLTSGAQGAA  60

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA +G L+ D+    PTPPP A L+P  MA+FNQAQAL
Sbjct  61   IGAFMGTLTNDVSSSLPTPPPQAGLNPQVMASFNQAQAL  99



>ref|XP_007218831.1| hypothetical protein PRUPE_ppa010176mg [Prunus persica]
 gb|EMJ20030.1| hypothetical protein PRUPE_ppa010176mg [Prunus persica]
Length=260

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG+M +   +QNPIEQ QA++ EL SG K WL+KQSLPVEAA VT  S AQG  I
Sbjct  1    MQQGKQGVMVIPQQNQNPIEQLQARFKELESGFKGWLAKQSLPVEAAVVTLTSGAQGAAI  60

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            GA +G L+ D+    PTPPP A L+P AMA+F QAQAL
Sbjct  61   GAFMGTLTNDVSSSLPTPPPQAGLNPQAMASFKQAQAL  98



>ref|XP_008234610.1| PREDICTED: uncharacterized protein LOC103333537 [Prunus mume]
Length=260

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG+M +   +QNPIEQ QA++ EL SG K WL+KQSLPVEAA VT  S AQG  I
Sbjct  1    MQQGKQGVMVIPQQNQNPIEQLQARFKELESGFKGWLAKQSLPVEAAVVTLTSGAQGAAI  60

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            GA +G L+ D+    PTPPP A L+P AMA+F QAQAL
Sbjct  61   GAFMGTLTNDVSSSLPTPPPQAGLNPQAMASFKQAQAL  98



>ref|XP_009351884.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Pyrus x bretschneideri]
Length=258

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GKQG+M  ++ P QNPIEQ QA++ EL +G + WL+KQSLPVEAA VT  S AQG  
Sbjct  1    MEQGKQGVMVAKMVPPQNPIEQLQARFKELEAGFRGWLAKQSLPVEAAVVTLTSGAQGAA  60

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA +G L+ D+    PTPPP A+L+P AMA+F QAQAL
Sbjct  61   IGAFMGTLTNDVSSSLPTPPPQASLNPQAMASFKQAQAL  99



>ref|XP_008376859.1| PREDICTED: uncharacterized protein LOC103439979 [Malus domestica]
Length=258

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GKQG M  ++ P QNPIE+FQA++ EL +GV+ WL+KQSLPVEAA VT  S AQG  
Sbjct  1    MEQGKQGAMVEKMVPPQNPIEEFQARFKELQAGVRGWLAKQSLPVEAAVVTLTSGAQGAA  60

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA +G L+ D+    PTPPP A L+P AMA+F QAQAL
Sbjct  61   IGAFMGTLTNDVSSSLPTPPPQAGLNPQAMASFKQAQAL  99



>ref|XP_008381679.1| PREDICTED: uncharacterized protein LOC103444516 [Malus domestica]
Length=261

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GKQG+M  ++ P QNPIEQ QA++ EL +G + WL+KQSLPVEAA VT  S AQG  
Sbjct  1    MEQGKQGVMVAKMVPPQNPIEQLQARFKELEAGFRGWLAKQSLPVEAAVVTLTSGAQGAA  60

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA +G L+ D+    PTPPP A L+P AMA+F QAQAL
Sbjct  61   IGAFMGTLTNDVSSSLPTPPPQAGLNPQAMASFKQAQAL  99



>ref|XP_004235047.1| PREDICTED: uncharacterized protein LOC101257149 [Solanum lycopersicum]
Length=260

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 70/101 (69%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS---QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            MGEGKQG M V++P+   QNPI Q Q K+ EL  G K WLSKQS+PVEAA VTA S  QG
Sbjct  1    MGEGKQGAMVVEMPNSSNQNPIVQLQNKFKELEIGFKGWLSKQSIPVEAAVVTATSGLQG  60

Query  255  GVIGAILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
              IG  +G L+ D+    P PP GANL+P AMA+F QAQAL
Sbjct  61   AAIGGFMGTLTQDVSSSMPIPPAGANLNPQAMASFQQAQAL  101



>ref|XP_010110465.1| hypothetical protein L484_001864 [Morus notabilis]
 gb|EXC26463.1| hypothetical protein L484_001864 [Morus notabilis]
Length=194

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 74/100 (74%), Gaps = 5/100 (5%)
 Frame = +3

Query  84   MGEGKQGIMAVQ-LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GKQGI+  + LP+QNPIEQFQAKY EL +G KAWL KQ L VEAA VT  SAAQG  
Sbjct  1    MEQGKQGIVVAKWLPNQNPIEQFQAKYKELENGFKAWLEKQPLAVEAAVVTVTSAAQGAG  60

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            IG+++G L+ D+    PTPP  ANL P AMA+F QAQAL+
Sbjct  61   IGSLMGTLTKDVSSSIPTPPQ-ANLTPQAMASFQQAQALS  99



>ref|XP_003523301.1| PREDICTED: uncharacterized protein LOC100775460 [Glycine max]
Length=260

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +3

Query  93   GKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAI  272
            GKQGIM V   SQNPIEQ QA++ EL +G + WLSKQSLPVEAA VT  SAAQG  IGA 
Sbjct  5    GKQGIM-VTSQSQNPIEQIQARFKELETGFRLWLSKQSLPVEAAVVTTTSAAQGAAIGAF  63

Query  273  LGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            +G L+ D     PTPPP A+L+P AMA+  QAQAL
Sbjct  64   MGTLTADASSTFPTPPPNASLNPQAMASLKQAQAL  98



>gb|KCW46677.1| hypothetical protein EUGRSUZ_K00480 [Eucalyptus grandis]
Length=252

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GK+GI+  +L P  NPIEQ Q+++ E+ +G K WLSKQSLPVEAA VTA  A QG  
Sbjct  1    MEQGKRGIVVSKLLPPNNPIEQLQSRFKEIEAGFKDWLSKQSLPVEAAVVTATGATQGAA  60

Query  261  IGAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQALT  371
            IGAI+G L+ D+  +  PPPGANL+P AMA+  QAQAL+
Sbjct  61   IGAIMGTLTNDVSASLGPPPGANLNPQAMASLKQAQALS  99



>ref|XP_010035340.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Eucalyptus grandis]
 gb|KCW46676.1| hypothetical protein EUGRSUZ_K00480 [Eucalyptus grandis]
Length=258

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +3

Query  84   MGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +GK+GI+  +L P  NPIEQ Q+++ E+ +G K WLSKQSLPVEAA VTA  A QG  
Sbjct  1    MEQGKRGIVVSKLLPPNNPIEQLQSRFKEIEAGFKDWLSKQSLPVEAAVVTATGATQGAA  60

Query  261  IGAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQALT  371
            IGAI+G L+ D+  +  PPPGANL+P AMA+  QAQAL+
Sbjct  61   IGAIMGTLTNDVSASLGPPPGANLNPQAMASLKQAQALS  99



>ref|XP_003526780.1| PREDICTED: uncharacterized protein LOC100813121 [Glycine max]
Length=260

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +3

Query  93   GKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAI  272
            GKQGIM V   SQNPIEQ QA++ +L +G + WLSKQSLPVEAA VT  SAAQG  IGA 
Sbjct  5    GKQGIM-VASQSQNPIEQIQARFKDLETGFRLWLSKQSLPVEAAVVTTTSAAQGAAIGAF  63

Query  273  LGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            +G L+ D     PTPPP A+L+P AMA+  QAQAL
Sbjct  64   MGTLTADASSTFPTPPPNASLNPQAMASLKQAQAL  98



>ref|XP_002317852.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEE96072.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=262

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +3

Query  90   EGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            +GKQG+   +L P+Q+PI+  Q K+ EL  G K+WLSKQSLPVEAA VTA    QG  IG
Sbjct  5    QGKQGVTVAKLFPNQDPIKLVQFKFKELEDGFKSWLSKQSLPVEAAVVTATGGVQGAAIG  64

Query  267  AILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
            AI+G L+PD+    PTPPP A+L+P AMA+  QAQAL
Sbjct  65   AIMGTLTPDISSSMPTPPPQASLNPQAMASLKQAQAL  101



>ref|XP_007136378.1| hypothetical protein PHAVU_009G040400g [Phaseolus vulgaris]
 gb|ESW08372.1| hypothetical protein PHAVU_009G040400g [Phaseolus vulgaris]
Length=259

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQGIM V   +QNP+ QFQA++ EL SG K WLSKQSL VEAA VT  SAAQG  I
Sbjct  1    MEQGKQGIM-VASETQNPLHQFQARFKELESGFKLWLSKQSLAVEAAVVTTTSAAQGAAI  59

Query  264  GAILGNLS---PDLQPTPPPGANLDPNAMATFNQAQAL  368
            GA +G ++   P   PTPPP A+L+P AMA+  QAQAL
Sbjct  60   GAFMGTITADAPSAFPTPPPNASLNPQAMASLKQAQAL  97



>gb|AGV54806.1| hypothetical protein [Phaseolus vulgaris]
Length=259

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQGIM V   +QNP+ QFQA++ EL +G K WLSKQSL VEAA VT  SAAQG  I
Sbjct  1    MEQGKQGIM-VASETQNPLHQFQARFKELETGFKLWLSKQSLAVEAAVVTTTSAAQGAAI  59

Query  264  GAILGNLS---PDLQPTPPPGANLDPNAMATFNQAQAL  368
            GA +G ++   P   PTPPP A+L+P AMA+  QAQAL
Sbjct  60   GAFMGTITADAPSAFPTPPPNASLNPQAMASLKQAQAL  97



>emb|CAN60468.1| hypothetical protein VITISV_030224 [Vitis vinifera]
Length=131

 Score = 92.4 bits (228),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M EGKQG+M   + +QNPI Q QA++ +L +G +AWL+KQSLPVEAA VTA SAAQG  I
Sbjct  1    MDEGKQGVM---VAAQNPIAQLQARFKDLENGFRAWLAKQSLPVEAAVVTATSAAQGAAI  57

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            GA +G L+ D     PTPP  ANL P AMA+F QAQAL
Sbjct  58   GAFMGTLTNDATSAIPTPPQ-ANLSPQAMASFKQAQAL  94



>gb|KGN49828.1| hypothetical protein Csa_5G139080 [Cucumis sativus]
Length=228

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG++    P QNP+EQ QA++ EL +G + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MEQGKQGVVVKLPPHQNPVEQIQARFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAI  60

Query  264  GAILGNLSPDLQPT-PPPGANLDPNAMATFNQAQAL  368
            G  +G L+ D+  + P P A L+P AMA+F QAQAL
Sbjct  61   GGFMGTLTNDVSSSLPTPQAGLNPQAMASFKQAQAL  96



>ref|XP_004502789.1| PREDICTED: uncharacterized protein LOC101495679 [Cicer arietinum]
Length=263

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQ-LPSQ--NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            M +GKQG+M ++ LP Q  NPI+Q QA+Y  L +G K WLSKQS+ VEAA VT  SAAQG
Sbjct  1    MEQGKQGVMVLKGLPPQLQNPIDQIQARYKHLENGFKLWLSKQSIAVEAAVVTTTSAAQG  60

Query  255  GVIGAILGNLS---PDLQPTPPPGANLDPNAMATFNQAQAL  368
            G IGAI+G L+   P   P PPP A L+P AMA+  QAQAL
Sbjct  61   GAIGAIMGTLTADAPSAFPIPPPNAALNPQAMASLQQAQAL  101



>ref|XP_004145954.1| PREDICTED: uncharacterized protein LOC101208652 [Cucumis sativus]
Length=253

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG++    P QNP+EQ QA++ EL +G + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MEQGKQGVVVKLPPHQNPVEQIQARFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAI  60

Query  264  GAILGNLSPDLQPT-PPPGANLDPNAMATFNQAQAL  368
            G  +G L+ D+  + P P A L+P AMA+F QAQAL
Sbjct  61   GGFMGTLTNDVSSSLPTPQAGLNPQAMASFKQAQAL  96



>gb|KDP24771.1| hypothetical protein JCGZ_25171 [Jatropha curcas]
Length=258

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQ IM   +P+QNP++Q + KY E  +G K+WLSKQSLPVEAA VTA SA QG  I
Sbjct  1    MEQGKQAIM---VPNQNPLKQLELKYKEFETGFKSWLSKQSLPVEAAVVTATSAIQGAAI  57

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            G  +G L+ D+    PTPP  ANLDP AMA+  QAQAL+
Sbjct  58   GGFMGTLTNDVSSSFPTPPQ-ANLDPQAMASLKQAQALS  95



>ref|XP_004160398.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208652 
[Cucumis sativus]
Length=253

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG++    P QNP+EQ QA++ EL +G + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MEQGKQGVVVKLPPHQNPVEQIQARFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAI  60

Query  264  GAILGNLSPDLQPT-PPPGANLDPNAMATFNQAQAL  368
            G  +G L+ D+  + P P A L+P AMA+F QAQAL
Sbjct  61   GGFMGTLTNDVSSSLPTPQAGLNPQAMASFKQAQAL  96



>ref|XP_002267996.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Vitis vinifera]
Length=254

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M EGKQG+M   + +QNPI Q QA++ +L +G +AWL+KQSLPVEAA VTA SAAQG  I
Sbjct  1    MDEGKQGVM---VAAQNPIAQLQARFKDLENGFRAWLAKQSLPVEAAVVTATSAAQGAAI  57

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            GA +G L+ D     PTPP  ANL P AMA+F QAQAL
Sbjct  58   GAFMGTLTNDATSAIPTPPQ-ANLSPQAMASFKQAQAL  94



>ref|XP_002519617.1| protein translocase, putative [Ricinus communis]
 gb|EEF42762.1| protein translocase, putative [Ricinus communis]
Length=261

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = +3

Query  114  VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD  293
            V +  +NPI+Q QAK  EL +G K+WLSKQSL VEAA VTA SA QG  IGAI+G L+PD
Sbjct  12   VVMGKENPIQQLQAKMKELENGFKSWLSKQSLAVEAAVVTATSATQGAAIGAIMGTLAPD  71

Query  294  LQ---PTPPPGANLDPNAMATFNQAQALT  371
            +    PTPPP A L+P AMA+  QAQAL+
Sbjct  72   ISSSLPTPPPDAALNPQAMASIKQAQALS  100



>ref|XP_008437651.1| PREDICTED: uncharacterized protein LOC103482996 [Cucumis melo]
Length=253

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M +GKQG++    P QNP+EQ QA++ EL +G + WL+KQSLPVEAA VTA SAAQG  I
Sbjct  1    MEQGKQGVVVKLTPPQNPLEQIQARFKELENGFRTWLAKQSLPVEAAVVTATSAAQGAAI  60

Query  264  GAILGNLSPDLQPT-PPPGANLDPNAMATFNQAQAL  368
            G  +G L+ D+  + P P A L+P AMA+F QAQAL
Sbjct  61   GGFMGTLTNDVSSSLPTPQAGLNPQAMASFKQAQAL  96



>ref|XP_010045371.1| PREDICTED: uncharacterized protein LOC104434104 [Eucalyptus grandis]
 gb|KCW88600.1| hypothetical protein EUGRSUZ_A00976 [Eucalyptus grandis]
Length=259

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +3

Query  90   EGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            EGK G+M V    P QNPIEQ QA++ E+ +G KAWLS+Q L VEAA VTA S  QG  I
Sbjct  4    EGK-GVMTVSKLAPQQNPIEQLQARFKEVEAGFKAWLSRQPLAVEAAVVTATSGLQGAAI  62

Query  264  GAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQAL  368
            GA +G L+ D+  +  PPP ANL+P AMA+  QAQAL
Sbjct  63   GAFMGTLTGDVSSSIAPPPQANLNPEAMASLKQAQAL  99



>ref|XP_011005386.1| PREDICTED: uncharacterized protein LOC105111656 [Populus euphratica]
Length=313

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 7/100 (7%)
 Frame = +3

Query  90   EGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaa---saaQGG  257
            +GKQG+M  +L P+Q+PI+  Q K+ EL  G K+WLSKQSLPVEAA VTA       QG 
Sbjct  53   QGKQGVMVAKLFPNQDPIKFAQFKFKELEDGFKSWLSKQSLPVEAAVVTATGGGQGVQGA  112

Query  258  VIGAILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
             IGA++G L+PD+    PTPPP A+L+P AMA+  QAQAL
Sbjct  113  AIGAVMGTLTPDISSSMPTPPPQASLNPQAMASLKQAQAL  152



>gb|KJB52400.1| hypothetical protein B456_008G262900 [Gossypium raimondii]
Length=258

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M  GK+  M V +P QNP+EQ QAK+ E+ +  + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MERGKEQGMVV-MPQQNPLEQLQAKFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAI  59

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            GA +G L+ D+    PTPP  A+LDP AMA+  QAQAL+
Sbjct  60   GAFMGTLTNDVSSSLPTPPQ-ASLDPQAMASLKQAQALS  97



>ref|XP_010541518.1| PREDICTED: uncharacterized protein LOC104814958 [Tarenaya hassleriana]
Length=262

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ SG K+WLSKQSLPVEAA V+A S  QG  IG ++G LSP++   P
Sbjct  27   QNPIQQFQVKFKEVESGFKSWLSKQSLPVEAAIVSAMSGVQGAFIGGLMGTLSPEM---P  83

Query  309  PPGANLDPNAMATFNQAQALT  371
             PG  LDP AMA+F QAQAL 
Sbjct  84   QPG--LDPQAMASFKQAQALV  102



>gb|KJB52401.1| hypothetical protein B456_008G262900 [Gossypium raimondii]
Length=255

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M  GK+  M V +P QNP+EQ QAK+ E+ +  + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MERGKEQGMVV-MPQQNPLEQLQAKFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAI  59

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            GA +G L+ D+    PTPP  A+LDP AMA+  QAQAL+
Sbjct  60   GAFMGTLTNDVSSSLPTPPQ-ASLDPQAMASLKQAQALS  97



>ref|XP_002321938.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEF06065.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=260

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +3

Query  90   EGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            +GKQG++  +L P+Q+P++  Q KY EL  G K+WLSKQSL VEAA VTA S  QG  IG
Sbjct  4    QGKQGVIVSKLLPNQDPVKFVQFKYKELEDGFKSWLSKQSLLVEAAVVTATSGVQGAAIG  63

Query  267  AILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
            AI+G ++PD+    PTPP  A L+P AMA+  QAQAL
Sbjct  64   AIMGTITPDISSSMPTPPQAA-LNPQAMASLKQAQAL  99



>ref|XP_010276440.1| PREDICTED: uncharacterized protein LOC104611181 [Nelumbo nucifera]
Length=256

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = +3

Query  90   EGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            +G+QG++ V   +P QNPI Q QA++ +L  G ++WLSKQSLPVEAA VTA SA QG  I
Sbjct  2    DGRQGVVEVSKGMPPQNPIVQLQARFRDLEVGFRSWLSKQSLPVEAAVVTATSAVQGAAI  61

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            GA +G L+ D+    PTPP  A L+P AMA+  QAQAL+
Sbjct  62   GAFMGTLTNDISSSFPTPPQ-APLNPQAMASLKQAQALS  99



>ref|XP_007039252.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Theobroma cacao]
 gb|EOY23753.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Theobroma cacao]
Length=309

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 74/105 (70%), Gaps = 3/105 (3%)
 Frame = +3

Query  66   FTSDSQMGEGK-QGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaa  239
            + +  +M  GK QG+M  +L P QNP+EQ QAK+ E+ +G + WL+KQS+PVEAA VT  
Sbjct  44   YKNSDEMERGKEQGLMVPRLMPQQNPLEQLQAKFKEVENGFRTWLAKQSMPVEAAVVTGT  103

Query  240  saaQGGVIGAILGNLSPDLQPT-PPPGANLDPNAMATFNQAQALT  371
            SAAQG  IGA +G L+ D+  + P P ++L+P AMA+  QAQAL+
Sbjct  104  SAAQGAAIGAFMGTLTNDISSSLPTPQSSLNPQAMASLQQAQALS  148



>ref|XP_011084593.1| PREDICTED: uncharacterized protein LOC105166805 isoform X1 [Sesamum 
indicum]
Length=271

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 68/108 (63%), Gaps = 13/108 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MGE KQGIM V++P           QNPI   QAK  E+ +  K WL+KQSLPVEAA VT
Sbjct  1    MGESKQGIMVVEIPGKAGGLMGQVEQNPIAVVQAKLKEVETRFKGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPDLQP--TPPPGA-NLDPNAMATFNQAQAL  368
            A S AQG  IG  +G L+ D     TPPP A NL+P+AMA+  QAQAL
Sbjct  61   ATSGAQGAAIGGFMGTLTGDASSLVTPPPNAVNLNPDAMASLKQAQAL  108



>ref|XP_011084594.1| PREDICTED: uncharacterized protein LOC105166805 isoform X2 [Sesamum 
indicum]
Length=270

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 68/108 (63%), Gaps = 13/108 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MGE KQGIM V++P           QNPI   QAK  E+ +  K WL+KQSLPVEAA VT
Sbjct  1    MGESKQGIMVVEIPGKAGGLMGQVEQNPIAVVQAKLKEVETRFKGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPDLQP--TPPPGA-NLDPNAMATFNQAQAL  368
            A S AQG  IG  +G L+ D     TPPP A NL+P+AMA+  QAQAL
Sbjct  61   ATSGAQGAAIGGFMGTLTGDASSLVTPPPNAVNLNPDAMASLKQAQAL  108



>ref|XP_010519579.1| PREDICTED: uncharacterized protein LOC104798993 [Tarenaya hassleriana]
Length=261

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ EL SG K+WLSKQSLPVEAA V+A S  QG  IG ++G LSP++    
Sbjct  26   QNPIQQFQVKFKELESGFKSWLSKQSLPVEAAIVSAMSGVQGAFIGGLMGTLSPEM----  81

Query  309  PPGANLDPNAMATFNQAQALT  371
             P + LDP A A+F QAQAL 
Sbjct  82   -PQSGLDPQATASFKQAQALV  101



>ref|XP_011003323.1| PREDICTED: uncharacterized protein LOC105110098 [Populus euphratica]
Length=260

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +3

Query  90   EGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            +GKQG++  +L P+Q+P++  Q KY EL  G K+WLSKQSL VEAA VTA S  QG  IG
Sbjct  4    QGKQGVIVSKLLPNQDPVKFVQFKYKELEDGFKSWLSKQSLLVEAAVVTATSGVQGAAIG  63

Query  267  AILGNLSPDL---QPTPPPGANLDPNAMATFNQAQAL  368
            AI+G ++PD+    PTPP  A L+P AMA+  QAQAL
Sbjct  64   AIMGTITPDISSSMPTPPQ-APLNPQAMASLKQAQAL  99



>gb|KJB37430.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=162

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +3

Query  87   GEGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            G  +QG++ V   +  QNP+EQ QAK+ E+  G KAWL KQS+PVEAA VTA  A QG  
Sbjct  3    GGKEQGMLVVTGLMAHQNPLEQLQAKFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAA  62

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            IGA++G L+ D+    PTPP  A+L+  AMA+  QAQAL+
Sbjct  63   IGALMGTLTKDVSSSFPTPPQ-ASLNHQAMASLKQAQALS  101



>gb|KHG08602.1| Mitochondrial import inner membrane translocase subunit Tim17 
-like protein [Gossypium arboreum]
Length=246

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M  GK+  M V +P QNP+EQ QAK+ E+ +  + WL+KQSLPVEAA VT  SAAQG  I
Sbjct  1    MERGKEQGMVV-MPQQNPLEQLQAKFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAI  59

Query  264  GAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            GA +G L+ D+    PTPP  A+LD  AMA+  QAQAL+
Sbjct  60   GAFMGTLTNDVSSSLPTPPQ-ASLDAQAMASLKQAQALS  97



>gb|KJB37432.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=187

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +3

Query  87   GEGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            G  +QG++ V   +  QNP+EQ QAK+ E+  G KAWL KQS+PVEAA VTA  A QG  
Sbjct  3    GGKEQGMLVVTGLMAHQNPLEQLQAKFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAA  62

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            IGA++G L+ D+    PTPP  A+L+  AMA+  QAQAL+
Sbjct  63   IGALMGTLTKDVSSSFPTPPQ-ASLNHQAMASLKQAQALS  101



>gb|KJB37431.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=238

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +3

Query  87   GEGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            G  +QG++ V   +  QNP+EQ QAK+ E+  G KAWL KQS+PVEAA VTA  A QG  
Sbjct  3    GGKEQGMLVVTGLMAHQNPLEQLQAKFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAA  62

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            IGA++G L+ D+    PTPP  A+L+  AMA+  QAQAL+
Sbjct  63   IGALMGTLTKDVSSSFPTPPQ-ASLNHQAMASLKQAQALS  101



>ref|XP_011075839.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22 [Sesamum indicum]
Length=270

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 66/108 (61%), Gaps = 13/108 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MGE KQG+M V++P           QNP+   QAK  E+    + WL+KQSLPVEAA VT
Sbjct  1    MGETKQGVMVVEIPKEAGGFMGQSQQNPVALVQAKLKEVEIRFRGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPD---LQPTPPPGANLDPNAMATFNQAQAL  368
              SAAQG  IGA +G L+ D   L   PP  AN++P AMA+  QAQAL
Sbjct  61   TTSAAQGAAIGAFMGTLTGDASSLLTPPPSAANINPEAMASLKQAQAL  108



>ref|XP_006394720.1| hypothetical protein EUTSA_v10004788mg [Eutrema salsugineum]
 gb|ESQ32006.1| hypothetical protein EUTSA_v10004788mg [Eutrema salsugineum]
Length=261

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +3

Query  75   DSQMGEGK-QGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQ  251
            D + G+G+   +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVEAA VTA    Q
Sbjct  7    DKKRGDGETMAVMSLMKDQQNPIQQFQVKFKEVETGFKSWLSKQKLPVEAAVVTAMGGVQ  66

Query  252  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALT  371
            G  IG ++G LSP++     P + +DP AMA+  Q QAL 
Sbjct  67   GAFIGGLMGTLSPEM-----PQSGMDPQAMASLKQTQALV  101



>gb|KJB37429.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=255

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +3

Query  87   GEGKQGIMAVQ--LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            G  +QG++ V   +  QNP+EQ QAK+ E+  G KAWL KQS+PVEAA VTA  A QG  
Sbjct  3    GGKEQGMLVVTGLMAHQNPLEQLQAKFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAA  62

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQALT  371
            IGA++G L+ D+    PTPP  A+L+  AMA+  QAQAL+
Sbjct  63   IGALMGTLTKDVSSSFPTPPQ-ASLNHQAMASLKQAQALS  101



>ref|XP_010421304.1| PREDICTED: uncharacterized protein LOC104706780 [Camelina sativa]
Length=258

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI+QFQ K+ E+ +GVK+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  15   VMSLMKDQQNPIQQFQVKFKEIETGVKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  74

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++    P    +DP AMA+  Q QAL 
Sbjct  75   SPEM----PQAGGVDPQAMASLKQTQALV  99



>ref|NP_197853.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
 dbj|BAB11217.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL50076.1| AT5g24650/K18P6_19 [Arabidopsis thaliana]
 gb|AAM98312.1| At5g24650/K18P6_19 [Arabidopsis thaliana]
 gb|ABD64056.1| At5g24650 [Arabidopsis thaliana]
 gb|AED93344.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=259

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  16   VMSLMKDQQNPIQQFQVKFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  75

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++     P A +DP AMA+  Q QAL 
Sbjct  76   SPEM-----PQAGIDPQAMASLKQTQALV  99



>ref|XP_010454784.1| PREDICTED: uncharacterized protein LOC104736487 [Camelina sativa]
Length=258

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI+QFQ K+ E+ +GVK+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  15   VMSLMKDQQNPIQQFQVKFKEVETGVKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  74

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++    P    +DP AMA+  Q QAL 
Sbjct  75   SPEM----PQAGGVDPQAMASLKQTQALV  99



>gb|AAM65866.1| unknown [Arabidopsis thaliana]
Length=246

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  3    VMSLMKDQQNPIQQFQVKFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  62

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++     P A +DP AMA+  Q QAL 
Sbjct  63   SPEM-----PQAGIDPQAMASLKQTQALV  86



>ref|XP_006286543.1| hypothetical protein CARUB_v10001771mg [Capsella rubella]
 gb|EOA19441.1| hypothetical protein CARUB_v10001771mg [Capsella rubella]
Length=257

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  15   VMSLMKDQQNPIQQFQIKFKEVETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  74

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++     P A +DP AMA+  Q QAL 
Sbjct  75   SPEM-----PQAGVDPQAMASLKQTQALV  98



>ref|XP_010909429.1| PREDICTED: uncharacterized protein LOC105035540 [Elaeis guineensis]
Length=136

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M E +  ++    P  NPIEQ Q ++ EL +G + WL+KQ L VEAA VTA SAAQG  I
Sbjct  1    MKEMQGAVVPPTSPPANPIEQLQVRFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAI  60

Query  264  GAILGNLSPDLQ---PTPPP-GANLDPNAMATFNQAQAL  368
            G +LG L+PD     PTPPP  A LDP A+A+F QAQA 
Sbjct  61   GGLLGTLTPDAASTFPTPPPQAAGLDPQALASFKQAQAF  99



>gb|EYU19717.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=237

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MG+GKQG   V++P           QNPI   QAK+ E+    K WL+KQSLPVEAA VT
Sbjct  1    MGDGKQGGTMVEIPKFAGGLMGQSEQNPIAVVQAKFKEVEHKFKGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPDLQP--TPPP-GANLDPNAMATFNQAQALT  371
            A SAAQG  IGA +G L+ D     TPPP  A L+P AMA+  QAQA T
Sbjct  61   ATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGLNPEAMASLKQAQAFT  109



>gb|EYU19715.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=271

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MG+GKQG   V++P           QNPI   QAK+ E+    K WL+KQSLPVEAA VT
Sbjct  1    MGDGKQGGTMVEIPKFAGGLMGQSEQNPIAVVQAKFKEVEHKFKGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPDLQP--TPPP-GANLDPNAMATFNQAQALT  371
            A SAAQG  IGA +G L+ D     TPPP  A L+P AMA+  QAQA T
Sbjct  61   ATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGLNPEAMASLKQAQAFT  109



>emb|CDX80460.1| BnaC07g29840D [Brassica napus]
Length=260

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = +3

Query  108  MAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLS  287
            MAV    QNPI+QFQ K+ E  +G K+WLSKQ LPVEAA VTA    QG  IG ++G LS
Sbjct  18   MAVMSLQQNPIQQFQVKFKEAETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLS  77

Query  288  PDLQPTPPPGANLDPNAMATFNQAQALT  371
            P++     P   +DP AMA+  Q QAL 
Sbjct  78   PEM-----PQTGVDPQAMASLQQTQALV  100



>ref|XP_010515307.1| PREDICTED: uncharacterized protein LOC104791180 [Camelina sativa]
Length=267

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  34   QNPIQQFQVKFKEVETGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  89

Query  309  PPGANLDPNAMATFNQAQALT  371
            P    +DP A+A+  QAQAL 
Sbjct  90   PQAGGVDPQAIASMKQAQALV  110



>gb|EYU19716.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=270

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS----------QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvt  233
            MG+GKQG   V++P           QNPI   QAK+ E+    K WL+KQSLPVEAA VT
Sbjct  1    MGDGKQGGTMVEIPKFAGGLMGQSEQNPIAVVQAKFKEVEHKFKGWLAKQSLPVEAAVVT  60

Query  234  aasaaQGGVIGAILGNLSPDLQP--TPPP-GANLDPNAMATFNQAQALT  371
            A SAAQG  IGA +G L+ D     TPPP  A L+P AMA+  QAQA T
Sbjct  61   ATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGLNPEAMASLKQAQAFT  109



>ref|XP_010910427.1| PREDICTED: uncharacterized protein LOC105036351 [Elaeis guineensis]
Length=258

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = +3

Query  123  PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ-  299
            P  NPIEQ Q ++ EL +G + WL+KQ L VEAA VTA SAAQG  IG +LG L+PD   
Sbjct  14   PPANPIEQLQVRFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAIGGLLGTLTPDAAS  73

Query  300  --PTPPP-GANLDPNAMATFNQAQAL  368
              PTPPP  A LDP A+A+F QAQA 
Sbjct  74   TFPTPPPQAAGLDPQALASFKQAQAF  99



>gb|KFK27737.1| hypothetical protein AALP_AA8G422900 [Arabis alpina]
Length=261

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +3

Query  75   DSQMGEGK-QGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQ  251
            + + G+G+   +M+     +NPI+QF+ K+ E+ +G K+WLSKQ+LPVEA+ V A    Q
Sbjct  7    EKKHGDGETMAVMSFMKDQENPIQQFKVKFKEVETGFKSWLSKQTLPVEASVVAAMGGVQ  66

Query  252  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALT  371
            G  IG ++G LSP++     P + +DP AMA+  Q QAL 
Sbjct  67   GAFIGGLMGTLSPEM-----PQSGIDPQAMASLKQTQALV  101



>ref|XP_003602441.1| SAM domain family protein [Medicago truncatula]
Length=138

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQ-LPSQ--NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            M +GKQG M ++ LP Q  NPI+Q Q +Y  L +G K WLSKQS+ VEAA VT   AAQG
Sbjct  1    MEQGKQGAMVLKGLPQQLQNPIDQIQTRYKHLENGFKLWLSKQSIAVEAAVVTTTGAAQG  60

Query  255  GVIGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
              IGA LG L+ D     PTPPP A+L+P AMA+  QAQAL
Sbjct  61   AAIGAFLGTLTGDASSAFPTPPPNASLNPQAMASLQQAQAL  101



>ref|XP_006291697.1| hypothetical protein CARUB_v10017861mg [Capsella rubella]
 gb|EOA24595.1| hypothetical protein CARUB_v10017861mg [Capsella rubella]
Length=261

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  30   QNPIQQFQVKFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  85

Query  309  PPGANLDPNAMATFNQAQALT  371
             P A +DP A+A+  QAQAL 
Sbjct  86   -PQAGVDPQAIASMKQAQALV  105



>ref|NP_190525.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
 gb|AAK25901.1|AF360191_1 unknown protein [Arabidopsis thaliana]
 emb|CAB62460.1| putative protein [Arabidopsis thaliana]
 gb|AAM62775.1| unknown [Arabidopsis thaliana]
 gb|AAN71950.1| unknown protein [Arabidopsis thaliana]
 gb|ABD64055.1| At3g49560 [Arabidopsis thaliana]
 gb|AEE78557.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=261

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  29   QNPIQQFQVKFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  84

Query  309  PPGANLDPNAMATFNQAQALT  371
             P A +DP A+A+  QAQAL 
Sbjct  85   -PQAGVDPQAIASMKQAQALV  104



>ref|XP_009150989.1| PREDICTED: uncharacterized protein LOC103874331 [Brassica rapa]
Length=263

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI QFQ K+ E   G K+WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  20   VMSLMKDQQNPIHQFQVKFKEAEIGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  79

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++     P   +DP AMA+  Q QAL 
Sbjct  80   SPEM-----PQTGVDPQAMASLQQTQALV  103



>dbj|BAM64851.1| hypothetical protein [Beta vulgaris]
Length=256

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 8/104 (8%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS-----QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaa  248
            MGEGKQG++  + P      QNPI Q Q+K  E+   VK+WLSKQSLPVEA  VTA  A 
Sbjct  1    MGEGKQGLIVAESPKGIIIQQNPITQIQSKIKEVEIKVKSWLSKQSLPVEAVVVTAGGAT  60

Query  249  QGGVIGAILGNLSPD---LQPTPPPGANLDPNAMATFNQAQALT  371
            QG +IGA++G L+ D     P PPP   LDP  +A+  QAQAL+
Sbjct  61   QGALIGALMGTLTQDMSSTMPMPPPTPGLDPKTLASMQQAQALS  104



>ref|XP_003602440.1| SAM domain family protein [Medicago truncatula]
 gb|AES72691.1| protein translocase, putative [Medicago truncatula]
Length=263

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  84   MGEGKQGIMAVQ-LPSQ--NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            M +GKQG M ++ LP Q  NPI+Q Q +Y  L +G K WLSKQS+ VEAA VT   AAQG
Sbjct  1    MEQGKQGAMVLKGLPQQLQNPIDQIQTRYKHLENGFKLWLSKQSIAVEAAVVTTTGAAQG  60

Query  255  GVIGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
              IGA LG L+ D     PTPPP A+L+P AMA+  QAQAL
Sbjct  61   AAIGAFLGTLTGDASSAFPTPPPNASLNPQAMASLQQAQAL  101



>ref|XP_002875975.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52234.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QF  K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  28   QNPIQQFHVKFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  83

Query  309  PPGANLDPNAMATFNQAQALT  371
             P A +DP A+A+  QAQAL 
Sbjct  84   -PQAGVDPQAIASLKQAQALV  103



>ref|XP_010503618.1| PREDICTED: uncharacterized protein LOC104780778 [Camelina sativa]
Length=265

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  32   QNPIQQFQVKFKEVETGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  87

Query  309  PPGANLDPNAMATFNQAQALT  371
            P    +D  A+A+  QAQAL 
Sbjct  88   PQAGGVDLQAIASMKQAQALV  108



>ref|XP_008788093.1| PREDICTED: uncharacterized protein LOC103705955 isoform X2 [Phoenix 
dactylifera]
Length=210

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M E +  ++    P  NPIE  Q ++ EL +G + WL+KQ L VEAA VTA SAAQG  I
Sbjct  1    MKENQGAVVPPTSPPANPIEHLQVRFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAI  60

Query  264  GAILGNLSPDLQ---PTPPP-GANLDPNAMATFNQAQAL  368
            G +LG L+PD     PTPPP  A LD  A+ +F QAQA 
Sbjct  61   GGLLGTLTPDAASTFPTPPPQAAGLDAQALTSFKQAQAF  99



>ref|XP_010671269.1| PREDICTED: uncharacterized protein LOC104888105 [Beta vulgaris 
subsp. vulgaris]
Length=265

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 8/104 (8%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPS-----QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaa  248
            MGEGKQG++  + P      QNPI Q Q+K  E+   VK+WLSKQSLPVEA  VTA  A 
Sbjct  1    MGEGKQGLIVGESPKGIIIQQNPITQIQSKIKEVEIKVKSWLSKQSLPVEAVVVTAGGAT  60

Query  249  QGGVIGAILGNLSPD---LQPTPPPGANLDPNAMATFNQAQALT  371
            QG +IGA++G L+ D     P PPP   LDP  +A+  QAQAL+
Sbjct  61   QGALIGALMGTLTQDMSSTMPMPPPTPGLDPKTLASMQQAQALS  104



>gb|KDO44881.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=259

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>gb|KDO44886.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=203

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>ref|XP_006493476.1| PREDICTED: uncharacterized protein LOC102629263 [Citrus sinensis]
 gb|KDO44880.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=259

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>ref|XP_006441309.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54549.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=259

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>gb|KDO44885.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=180

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>gb|KDO44882.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=254

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>gb|KDO44884.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=183

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>gb|KDO44883.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=256

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>ref|XP_006441307.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54547.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=256

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>ref|XP_006441308.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54548.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=258

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +3

Query  84   MGEGKQGIMA-VQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGV  260
            M +G + +M+ VQLP Q  I+  Q K  EL +G K+WL+KQ LPVEAA VTA +A  G  
Sbjct  1    MEKGNEKVMSLVQLP-QKAIKDVQFKLKELENGYKSWLAKQPLPVEAAIVTATTAINGAA  59

Query  261  IGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQAL  368
            IGA LG ++ DL    PTPPP ++L+P+A+A F Q QA+
Sbjct  60   IGAFLGVMTQDLTSSLPTPPPQSSLNPDAVAPFQQVQAV  98



>ref|XP_010426471.1| PREDICTED: uncharacterized protein LOC104711470 [Camelina sativa]
Length=267

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+QFQ K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    
Sbjct  33   QNPIQQFQVKFKEVETGFKTWLSKQSIPVEAAVVSIMSGVQGAFIGGLMGTLSPEM----  88

Query  309  PPGANLDPNAMA-TFNQAQALT  371
            P    +DP A+A +  QAQAL 
Sbjct  89   PQAGGVDPQAIAPSMKQAQALV  110



>ref|XP_006844757.1| hypothetical protein AMTR_s00016p00256760 [Amborella trichopoda]
 gb|ERN06432.1| hypothetical protein AMTR_s00016p00256760 [Amborella trichopoda]
Length=251

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +3

Query  120  LPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ  299
            +P   PI Q Q K  EL  G K WLSKQSLPVEAA VT  SAAQG  IGA +G L+ D  
Sbjct  8    IPPPGPIAQVQTKLKELELGFKTWLSKQSLPVEAAIVTVTSAAQGAAIGAFMGTLTADAT  67

Query  300  PTPP--PGANLDPNAMATFNQAQALT  371
             + P  P A L+P AMA+  QAQALT
Sbjct  68   SSLPTAPQAGLNPQAMASLKQAQALT  93



>ref|XP_009149730.1| PREDICTED: uncharacterized protein LOC103873049 [Brassica rapa]
Length=257

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+Q Q K+ E+  G+K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T 
Sbjct  26   QNPIQQVQVKFKEVEVGLKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-  84

Query  309  PPGANLDPNAMATFNQAQALT  371
                  DP AMA+  QAQAL 
Sbjct  85   ------DPQAMASMKQAQALV  99



>emb|CDY08145.1| BnaA06g15810D [Brassica napus]
Length=263

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+Q Q K+ E+  G+K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T 
Sbjct  26   QNPIQQVQVKFKEVEVGLKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-  84

Query  309  PPGANLDPNAMATFNQAQALT  371
                  DP AMA+  QAQAL 
Sbjct  85   ------DPQAMASMKQAQALV  99



>emb|CDY05941.1| BnaC08g21180D [Brassica napus]
Length=266

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPI+Q Q K+ E+  G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T 
Sbjct  29   QNPIQQLQVKFKEVEVGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-  87

Query  309  PPGANLDPNAMATFNQAQALT  371
                  DP AMA+  QAQAL 
Sbjct  88   ------DPQAMASMKQAQALV  102



>ref|XP_008788092.1| PREDICTED: uncharacterized protein LOC103705955 isoform X1 [Phoenix 
dactylifera]
Length=258

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = +3

Query  84   MGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVI  263
            M E +  ++    P  NPIE  Q ++ EL +G + WL+KQ L VEAA VTA SAAQG  I
Sbjct  1    MKENQGAVVPPTSPPANPIEHLQVRFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAI  60

Query  264  GAILGNLSPDLQ---PTPPP-GANLDPNAMATFNQAQAL  368
            G +LG L+PD     PTPPP  A LD  A+ +F QAQA 
Sbjct  61   GGLLGTLTPDAASTFPTPPPQAAGLDAQALTSFKQAQAF  99



>gb|KFK34395.1| hypothetical protein AALP_AA5G139700 [Arabis alpina]
Length=257

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 8/81 (10%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNPIEQ Q K+ ++ SG K WLSKQSLPVEAA V+  S  QG +IG ++G LSP++    
Sbjct  27   QNPIEQLQVKFKKVESGFKTWLSKQSLPVEAAVVSTMSGVQGALIGGLMGTLSPEM----  82

Query  309  PPGANLDPNAMATFNQAQALT  371
             P + +DP AM    QAQAL 
Sbjct  83   -PQSGVDPQAM---KQAQALV  99



>gb|KHG07931.1| Uncharacterized protein F383_34960 [Gossypium arboreum]
Length=251

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 10/101 (10%)
 Frame = +3

Query  90   EGKQGIMAVQLPS-----QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQG  254
            E KQG M   +PS     QNP++Q QAK+ E+ +G +AWLSKQ LPVEA  VT   AAQG
Sbjct  5    EEKQGTM---VPSSMPEQQNPLQQLQAKFKEVENGFRAWLSKQPLPVEATVVTTTGAAQG  61

Query  255  GVIGAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQALT  371
              IGA++G L+ D+  +   PP A+L+P AMA+F QAQAL+
Sbjct  62   AAIGALMGTLTNDISSSFQTPPQASLNPQAMASFKQAQALS  102



>gb|EYU45348.1| hypothetical protein MIMGU_mgv1a012092mg [Erythranthe guttata]
Length=262

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  123  PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQP  302
            P QNP+   Q K  E+ +  + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D   
Sbjct  16   PQQNPLALVQFKLKEVETKFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTGDASS  75

Query  303  --TPPP-GANLDPNAMATFNQAQAL  368
              TPPP  AN +P+AMA+  QAQAL
Sbjct  76   LITPPPNAANFNPDAMASLKQAQAL  100



>ref|XP_006404129.1| hypothetical protein EUTSA_v10010930mg [Eutrema salsugineum]
 gb|ESQ45582.1| hypothetical protein EUTSA_v10010930mg [Eutrema salsugineum]
Length=263

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTP  308
            QNP++Q Q K+ E+  G K WLSKQSLPVEAA V+  S  QG  IG ++G LSP++    
Sbjct  27   QNPVQQLQVKFKEVEVGFKTWLSKQSLPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----  82

Query  309  PPGANLDPNAMATFNQ  356
             P + +DP AMA+ ++
Sbjct  83   -PQSGVDPQAMASMSK  97



>gb|EPS71171.1| hypothetical protein M569_03588, partial [Genlisea aurea]
Length=247

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQP--  302
            QNPI   Q+K  E+ +  + WL+KQ+LPVEAA VTA S+ QG  IG ++G L+ D     
Sbjct  16   QNPIAFVQSKLKEVETRFRGWLAKQTLPVEAAVVTATSSIQGAAIGGLMGTLTGDASSMV  75

Query  303  TPPPG-ANLDPNAMATFNQAQAL  368
            TPPP  A L+P+AMA+  QAQAL
Sbjct  76   TPPPNVAGLNPDAMASLKQAQAL  98



>ref|XP_010942297.1| PREDICTED: uncharacterized protein LOC105060333 [Elaeis guineensis]
 ref|XP_010942298.1| PREDICTED: uncharacterized protein LOC105060333 [Elaeis guineensis]
Length=259

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 5/98 (5%)
 Frame = +3

Query  90   EGKQGIMAVQLPSQ-NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            EG+QG++     S  NPI Q QA++ EL  G +AWL++QS+PVEAA VTA  AAQG  IG
Sbjct  2    EGRQGLVLAPAGSPPNPIAQVQARFRELEGGFRAWLARQSMPVEAAVVTATGAAQGAAIG  61

Query  267  AILGNLSPDLQ---PTPPP-GANLDPNAMATFNQAQAL  368
             ++G L+ DL    PTPPP  A L P AM++  QAQA 
Sbjct  62   GLMGTLTSDLTSAFPTPPPQAAGLSPQAMSSLKQAQAF  99



>ref|XP_008811010.1| PREDICTED: uncharacterized protein LOC103722289 isoform X2 [Phoenix 
dactylifera]
Length=238

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  90   EGKQGIMAVQLPSQ-NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            EG+QG++     S  NPI Q QA++ EL  G +AWL++QS+PVEAA VTA SAAQG  IG
Sbjct  2    EGRQGLVLAPAGSPPNPIAQVQARFKELEGGFRAWLARQSMPVEAAVVTATSAAQGAAIG  61

Query  267  AILGNLSPDLQP----TPPPGANLDPNAMATFNQAQAL  368
             ++G L+ DL       PP  A L P AM++  QAQA 
Sbjct  62   GLMGTLTSDLTSAFPAPPPQAAGLSPQAMSSLKQAQAF  99



>ref|XP_008811009.1| PREDICTED: uncharacterized protein LOC103722289 isoform X1 [Phoenix 
dactylifera]
Length=259

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  90   EGKQGIMAVQLPSQ-NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIG  266
            EG+QG++     S  NPI Q QA++ EL  G +AWL++QS+PVEAA VTA SAAQG  IG
Sbjct  2    EGRQGLVLAPAGSPPNPIAQVQARFKELEGGFRAWLARQSMPVEAAVVTATSAAQGAAIG  61

Query  267  AILGNLSPDLQP----TPPPGANLDPNAMATFNQAQAL  368
             ++G L+ DL       PP  A L P AM++  QAQA 
Sbjct  62   GLMGTLTSDLTSAFPAPPPQAAGLSPQAMSSLKQAQAF  99



>ref|XP_003579669.1| PREDICTED: uncharacterized protein LOC100827945 [Brachypodium 
distachyon]
Length=266

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +3

Query  111  AVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSP  290
            AV     NP+ +   +   L + V+AW++KQ   +EAA  TA  A QGG +G ++G  +P
Sbjct  20   AVSRGGANPLAELGDRVKSLEAEVRAWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAP  79

Query  291  DLQ-----PTPPPGANLDPNAMATFNQAQAL  368
            D       P PPPG  +DPNAMATF QAQAL
Sbjct  80   DGGAGLPVPQPPPG--VDPNAMATFKQAQAL  108



>dbj|BAJ88716.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ----  299
            NP+ +   ++  L  GV+ W++KQ   +EAA  TA  A QGG +G ++G  +P+      
Sbjct  31   NPLAELTDRFRSLEVGVREWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAPEGGAGLP  90

Query  300  -PTPPPGANLDPNAMATFNQAQAL  368
             P PPPG  LDP AMATF QAQAL
Sbjct  91   VPQPPPG--LDPKAMATFKQAQAL  112



>ref|XP_001766937.1| predicted protein [Physcomitrella patens]
 gb|EDQ68339.1| predicted protein [Physcomitrella patens]
Length=250

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 5/82 (6%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDL---QP  302
            NPI+  Q K  +L S +K WL KQ   VE   VTA SA QGG IGA++G  S D+    P
Sbjct  11   NPIQMIQLKVKKLDSDLKVWLKKQPAAVEVVLVTAGSAVQGGAIGALMGTFSSDVASTMP  70

Query  303  TPPPGANLDPNAMATFNQAQAL  368
            TPPPG  L+P A A+  QA+A 
Sbjct  71   TPPPG--LNPEAAASLQQAKAF  90



>gb|EMT03006.1| hypothetical protein F775_30606 [Aegilops tauschii]
Length=269

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ----  299
            NP+ +   ++  L  GV+ W++KQ   +EAA  TA  A QGG +G ++G  +P+      
Sbjct  28   NPLAELTDRFRSLEVGVREWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAPEGGAGLP  87

Query  300  -PTPPPGANLDPNAMATFNQAQAL  368
             P PPPG  LDP AMATF QAQAL
Sbjct  88   VPQPPPG--LDPKAMATFKQAQAL  109



>ref|XP_009404579.1| PREDICTED: uncharacterized protein LOC103987863 [Musa acuminata 
subsp. malaccensis]
Length=258

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +3

Query  144  QFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ---PTPPP  314
            Q Q +  EL +G +AWL+KQ   VEAA VTA SAAQG  IGA++G+L+ D     PTPPP
Sbjct  23   QLQTRIKELETGFRAWLAKQPTAVEAAIVTATSAAQGAFIGALMGSLTSDASSALPTPPP  82

Query  315  GA-NLDPNAMATFNQAQAL  368
             A  L+P AMA+  QAQA 
Sbjct  83   NAPGLNPQAMASLKQAQAF  101



>dbj|BAJ87822.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD-----  293
            +NP+E++  +   L +G +AW++KQ + VEAA  TA  A QGG +G ++G+++ D     
Sbjct  18   RNPLEEWSGRVRALEAGFRAWMAKQPVHVEAAVTTAVGAVQGGALGGLMGSITADGGAPW  77

Query  294  LQPTPPPGANLDPNAMATFNQAQAL  368
            + P PP   N +P AMA+F QAQAL
Sbjct  78   VPPLPP---NANPQAMASFKQAQAL  99



>ref|XP_009421320.1| PREDICTED: uncharacterized protein LOC104000893 [Musa acuminata 
subsp. malaccensis]
Length=260

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +3

Query  144  QFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ---PTPPP  314
            Q QA+  EL SG +AWL+KQ   +EAA VTA SAAQG  IGA++G+L+ D     PTPP 
Sbjct  24   QLQARVKELESGFRAWLAKQPTAMEAAIVTATSAAQGAFIGALMGSLTSDASSAIPTPPS  83

Query  315  GA-NLDPNAMATFNQAQAL  368
             A  L+P AMA+  QAQA 
Sbjct  84   NAPGLNPEAMASLKQAQAF  102



>emb|CDY69408.1| BnaAnng30370D [Brassica napus]
 emb|CDX88122.1| BnaA06g27130D [Brassica napus]
Length=252

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 16/89 (18%)
 Frame = +3

Query  105  IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNL  284
            +M++    QNPI QFQ+           WLSKQ LPVEAA VTA    QG  IG ++G L
Sbjct  20   VMSLMKDQQNPIHQFQS-----------WLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL  68

Query  285  SPDLQPTPPPGANLDPNAMATFNQAQALT  371
            SP++     P   +DP AMA+  Q QAL 
Sbjct  69   SPEM-----PQTGVDPQAMASLQQTQALV  92



>ref|XP_004307936.1| PREDICTED: uncharacterized protein LOC101296523 [Fragaria vesca 
subsp. vesca]
Length=261

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 5/75 (7%)
 Frame = +3

Query  153  AKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ---PTPPPGAN  323
            A+   L +G ++WL+KQS+ VEAA VT AS AQG  IG I+G L+ D+    PTPP    
Sbjct  26   ARVKHLETGFRSWLAKQSVAVEAAIVTVASGAQGAAIGGIMGTLTGDISSALPTPPQA--  83

Query  324  LDPNAMATFNQAQAL  368
            L+P AMA+F QAQAL
Sbjct  84   LNPQAMASFKQAQAL  98



>ref|NP_001146865.1| SAM domain family protein [Zea mays]
 gb|ACG24035.1| SAM domain family protein [Zea mays]
 gb|AFW62507.1| SAM domain protein [Zea mays]
Length=270

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQ---P  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  31   NPLEEWSGRVKAIEAGFRAWMAKQPIHIEAAVSTAVGAVQGGALGGLMGSLTADGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P +N + +AMA+F QAQAL
Sbjct  91   IPQPPSNANSDAMASFKQAQAL  112



>ref|XP_009413503.1| PREDICTED: uncharacterized protein LOC103994789 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD----LQ  299
            NP+   QA+  EL +G +AWL+KQS+ VEAA VTA +AAQG  IG +LG L+ D    L 
Sbjct  24   NPVALAQARIKELETGFRAWLAKQSMAVEAAVVTATNAAQGAAIGGLLGTLTSDVSSALP  83

Query  300  PTPPPGANLDPNAMATFNQAQAL  368
             + P  A L+P A+A+   AQAL
Sbjct  84   ASTPNAAGLNPEAIASLKNAQAL  106



>ref|XP_004952617.1| PREDICTED: uncharacterized protein LOC101769651 isoform X2 [Setaria 
italica]
Length=272

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++ A+   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+LS D     P
Sbjct  32   NPLEEWSARVKAIEAGFRAWMAKQPIHIEAAVTTAVGAVQGGALGGLMGSLSADGGSPFP  91

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P+AMA+F QAQAL
Sbjct  92   MPQPPPNANPDAMASFKQAQAL  113



>ref|XP_004952616.1| PREDICTED: uncharacterized protein LOC101769651 isoform X1 [Setaria 
italica]
Length=282

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++ A+   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+LS D     P
Sbjct  32   NPLEEWSARVKAIEAGFRAWMAKQPIHIEAAVTTAVGAVQGGALGGLMGSLSADGGSPFP  91

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P+AMA+F QAQAL
Sbjct  92   MPQPPPNANPDAMASFKQAQAL  113



>gb|KJB39517.1| hypothetical protein B456_007G017700, partial [Gossypium raimondii]
Length=275

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 11/116 (9%)
 Frame = +3

Query  45   KKSTEKGFTSDSQMGEGKQGIMAVQLPSQ-----NPIEQFQAKYNELASGVKAWLSKQSL  209
            K  TEK  T   ++ E KQG +   +PS      NP++Q QAK+ E+ +G +AWLSKQ L
Sbjct  44   KSYTEKSLTKMVRIEE-KQGTI---VPSSMPQQQNPLQQLQAKFKEVENGFRAWLSKQPL  99

Query  210  PVEaafvtaasaaQGGVIGAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQALT  371
            PVEA  VT   AAQG  IGA++G L+ D+  +   PP A+L+P AMA+F QAQAL+
Sbjct  100  PVEATVVTTTGAAQGAAIGALMGTLTNDISSSLQTPPQASLNPQAMASFKQAQALS  155



>ref|XP_001766099.1| predicted protein [Physcomitrella patens]
 gb|EDQ69158.1| predicted protein [Physcomitrella patens]
Length=233

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPT-P  308
            NPI+  Q K  +L   VK WL KQ   VE A VTA SA QGG IGA++G  S D+  T P
Sbjct  11   NPIQMIQLKVKQLDQDVKVWLKKQPAAVEVALVTAGSAVQGGAIGALMGTFSADVVSTMP  70

Query  309  PPGANLDPNAMATFNQAQ  362
             P   L+P A A+  QA+
Sbjct  71   TPSPQLNPEAAASLQQAK  88



>emb|CDM80696.1| unnamed protein product [Triticum aestivum]
Length=262

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +3

Query  129  QNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD-----  293
            +N +E++  +   + +G +AW++KQ + VEAA  TAA A QGG +G ++G+++ D     
Sbjct  19   RNLLEEWSGRVRAIEAGFRAWMAKQPIHVEAAVTTAAGAVQGGALGGLMGSITADGGASW  78

Query  294  LQPTPPPGANLDPNAMATFNQAQAL  368
            + P PP   N DP AMA+F QAQAL
Sbjct  79   VPPLPP---NADPQAMASFKQAQAL  100



>gb|KJB39516.1| hypothetical protein B456_007G017700 [Gossypium raimondii]
Length=263

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +3

Query  153  AKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPT--PPPGANL  326
            AK+ E+ +G +AWLSKQ LPVEA  VT   AAQG  IGA++G L+ D+  +   PP A+L
Sbjct  28   AKFKEVENGFRAWLSKQPLPVEATVVTTTGAAQGAAIGALMGTLTNDISSSLQTPPQASL  87

Query  327  DPNAMATFNQAQALT  371
            +P AMA+F QAQAL+
Sbjct  88   NPQAMASFKQAQALS  102



>ref|XP_002453918.1| hypothetical protein SORBIDRAFT_04g021420 [Sorghum bicolor]
 gb|EES06894.1| hypothetical protein SORBIDRAFT_04g021420 [Sorghum bicolor]
Length=270

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+PD     P
Sbjct  31   NPLEEWTGRVKAIEAGFRAWMAKQPIQIEAAVATAVGAVQGGALGGLMGSLTPDGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  91   MPQPPPNANPEAMASFKQAQAL  112



>gb|ACG31629.1| hypothetical protein [Zea mays]
Length=271

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = +3

Query  72   SDSQMGEGKQGIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQ  251
            S + M  G +G+        NP+E++  +   + +G +AW++KQ + +EAA  TA  A Q
Sbjct  19   SSAVMAGGLRGV-------SNPLEEWSGRVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQ  71

Query  252  GGVIGAILGNLSPD---LQPTPPPGANLDPNAMATFNQAQAL  368
            GG +G ++G+L+ D     P P P  N +P AMA+F QAQAL
Sbjct  72   GGALGGLMGSLTADGGSPFPIPQPPPNANPEAMASFKQAQAL  113



>ref|NP_001132412.1| uncharacterized protein LOC100193860 [Zea mays]
 gb|ACF81241.1| unknown [Zea mays]
Length=249

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  10   NPLEEWSGRVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFP  69

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  70   IPQPPPNANPEAMASFKQAQAL  91



>gb|AFW71638.1| hypothetical protein ZEAMMB73_527455 [Zea mays]
Length=271

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  32   NPLEEWSGRVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFP  91

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  92   IPQPPPNANPEAMASFKQAQAL  113



>gb|AFW71637.1| hypothetical protein ZEAMMB73_527455 [Zea mays]
Length=124

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  32   NPLEEWSGRVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFP  91

Query  303  TPPPGANLDPNAMATFNQAQ  362
             P P  N +P AMA+F QAQ
Sbjct  92   IPQPPPNANPEAMASFKQAQ  111



>gb|AGT17334.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  31   NPLEEWSGRVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  91   MPQPPPNANPEAMASFKQAQAL  112



>gb|AGT16087.1| hypothetical protein SHCRBa_224_E06_F_230 [Saccharum hybrid cultivar 
R570]
Length=270

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  31   NPLEEWSGRVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  91   MPQPPPNANPEAMASFKQAQAL  112



>gb|AGT17006.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  31   NPLEEWSGRVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F QAQAL
Sbjct  91   MPQPPPNANPEAMASFKQAQAL  112



>gb|AGT16912.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+E++  +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P
Sbjct  31   NPLEEWSGRVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFP  90

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P  N +P AMA+F Q QAL
Sbjct  91   MPQPPPNANPEAMASFKQTQAL  112



>ref|XP_004975523.1| PREDICTED: uncharacterized protein LOC101781948 isoform X2 [Setaria 
italica]
Length=271

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ ++  +   L +G++AWL+KQ   VEAA  TA  A QG  +G ++G L+PD     P
Sbjct  32   NPLAEWTDRVRSLEAGLRAWLAKQPTHVEAAVSTAVGAVQGAALGGLMGTLAPDGGAALP  91

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             PPP    DP A+A+F QAQAL
Sbjct  92   VPPPPLGADPKALASFKQAQAL  113



>ref|XP_004975522.1| PREDICTED: uncharacterized protein LOC101781948 isoform X1 [Setaria 
italica]
Length=296

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ ++  +   L +G++AWL+KQ   VEAA  TA  A QG  +G ++G L+PD     P
Sbjct  32   NPLAEWTDRVRSLEAGLRAWLAKQPTHVEAAVSTAVGAVQGAALGGLMGTLAPDGGAALP  91

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             PPP    DP A+A+F QAQAL
Sbjct  92   VPPPPLGADPKALASFKQAQAL  113



>ref|XP_003575054.1| PREDICTED: uncharacterized protein LOC100840753 [Brachypodium 
distachyon]
Length=256

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = +3

Query  111  AVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSP  290
            A+Q    NP+E++  +   L +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ 
Sbjct  8    AMQARGGNPLEEWSGRVKALEAGFRAWMAKQPIYIEAAVTTAVGAVQGGALGGLMGSLTA  67

Query  291  D---LQPTPPPGANLDPNAMATFNQAQAL  368
            D     P PPP AN +P AMA+F QAQAL
Sbjct  68   DAGSPFPVPPPPANANPQAMASFKQAQAL  96



>gb|EEC77226.1| hypothetical protein OsI_15770 [Oryza sativa Indica Group]
Length=266

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ +   +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P
Sbjct  27   NPLAELTDRVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFP  86

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P    DPNA+A+F QAQAL
Sbjct  87   VPQPPPGADPNALASFKQAQAL  108



>emb|CAE05370.1| OJ000315_02.15 [Oryza sativa Japonica Group]
Length=275

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ +   +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P
Sbjct  27   NPLAELTDRVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFP  86

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P    DPNA+A+F QAQAL
Sbjct  87   VPQPPPGADPNALASFKQAQAL  108



>ref|NP_001052708.1| Os04g0405100 [Oryza sativa Japonica Group]
 dbj|BAF14622.1| Os04g0405100 [Oryza sativa Japonica Group]
Length=307

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ +   +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P
Sbjct  27   NPLAELTDRVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFP  86

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P    DPNA+A+F QAQAL
Sbjct  87   VPQPPPGADPNALASFKQAQAL  108



>emb|CAH66528.1| H0502B11.8 [Oryza sativa Indica Group]
Length=266

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQP  302
            NP+ +   +   L  G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P
Sbjct  27   NPLAELNDRVKTLEGGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFP  86

Query  303  TPPPGANLDPNAMATFNQAQAL  368
             P P    DPNA+A+F QAQAL
Sbjct  87   VPQPPPGADPNALASFKQAQAL  108



>gb|EEE60938.1| hypothetical protein OsJ_14687 [Oryza sativa Japonica Group]
Length=271

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +3

Query  135  PIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPD---LQPT  305
            P+ +   +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P 
Sbjct  28   PLAELTDRVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPV  87

Query  306  PPPGANLDPNAMATFNQAQAL  368
            P P    DPNA+A+F QAQAL
Sbjct  88   PQPPPGADPNALASFKQAQAL  108



>tpg|DAA37984.1| TPA: SAM domain protein [Zea mays]
Length=270

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 15/88 (17%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTPP  311
            NP+ ++  +   L +GV+AWL+KQ   VEAA VTA  A QG  +G ++G L+PD      
Sbjct  31   NPLAEWTDRVRSLEAGVRAWLAKQPTHVEAAVVTAVGAVQGAALGGLMGTLAPD------  84

Query  312  PGANL---------DPNAMATFNQAQAL  368
             GA L         DP  +A+F QAQAL
Sbjct  85   GGAALPVPPPPPGTDPKVLASFKQAQAL  112



>gb|ACF84635.1| unknown [Zea mays]
Length=257

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 15/88 (17%)
 Frame = +3

Query  132  NPIEQFQAKYNELASGVKAWLSKQSLPVEaafvtaasaaQGGVIGAILGNLSPDLQPTPP  311
            NP+ ++  +   L +GV+AWL+KQ   VEAA VTA  A QG  +G ++G L+PD      
Sbjct  18   NPLAEWTDRVRSLEAGVRAWLAKQPTHVEAAVVTAVGAVQGAALGGLMGTLAPD------  71

Query  312  PGANL---------DPNAMATFNQAQAL  368
             GA L         DP  +A+F QAQAL
Sbjct  72   GGAALPVPPPPPGTDPKVLASFKQAQAL  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005