BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001F05

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                218   3e-67   Nicotiana sylvestris
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                214   1e-65   Solanum lycopersicum
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                213   2e-65   Nicotiana tomentosiformis
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           211   1e-64   Solanum tuberosum [potatoes]
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           211   1e-64   Nicotiana tomentosiformis
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           211   2e-64   Nicotiana sylvestris
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           210   2e-64   Nicotiana sylvestris
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           209   4e-64   Solanum tuberosum [potatoes]
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           209   1e-63   Nicotiana tomentosiformis
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                208   2e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK41626.1|  unknown                                                 204   3e-63   Lotus japonicus
gb|AHA84189.1|  60S ribosomal protein L5                                207   6e-63   Phaseolus vulgaris [French bean]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             206   7e-63   Phaseolus vulgaris [French bean]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                206   7e-63   Solanum lycopersicum
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   206   8e-63   Phaseolus vulgaris [French bean]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             206   9e-63   Phaseolus vulgaris [French bean]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                206   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             202   2e-62   
ref|NP_001274803.1|  uncharacterized protein LOC102577675               205   2e-62   Solanum tuberosum [potatoes]
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           205   3e-62   
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             204   3e-62   
emb|CBI24704.3|  unnamed protein product                                206   3e-62   Vitis vinifera
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            204   3e-62   
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     204   4e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO51035.1|  hypothetical protein CISIN_1g022424mg                   203   4e-62   Citrus sinensis [apfelsine]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           204   7e-62   
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   201   7e-62   Citrus sinensis [apfelsine]
gb|AFK34395.1|  unknown                                                 204   7e-62   Lotus japonicus
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         204   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         204   8e-62   Malus domestica [apple tree]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             204   8e-62   Phaseolus vulgaris [French bean]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         204   9e-62   Pyrus x bretschneideri [bai li]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    204   9e-62   Elaeis guineensis
gb|KJB71615.1|  hypothetical protein B456_011G133700                    202   1e-61   Gossypium raimondii
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           203   2e-61   Cicer arietinum [garbanzo]
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   203   2e-61   Phaseolus vulgaris [French bean]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                203   2e-61   Malus domestica [apple tree]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           204   2e-61   Glycine max [soybeans]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             202   2e-61   Citrus clementina [clementine]
gb|ADR71226.1|  60S ribosomal protein L5B                               202   2e-61   Hevea brasiliensis [jebe]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           203   2e-61   Phoenix dactylifera
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                202   2e-61   Prunus mume [ume]
gb|ADR71225.1|  60S ribosomal protein L5A                               202   2e-61   Hevea brasiliensis [jebe]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           202   2e-61   Nelumbo nucifera [Indian lotus]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    202   3e-61   Gossypium raimondii
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  201   3e-61   Citrus sinensis [apfelsine]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    202   3e-61   Glycine max [soybeans]
gb|AFK36106.1|  unknown                                                 202   4e-61   Lotus japonicus
gb|AFK46994.1|  unknown                                                 202   4e-61   Lotus japonicus
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           202   4e-61   
gb|KHN15970.1|  60S ribosomal protein L5                                202   4e-61   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           202   4e-61   Glycine max [soybeans]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           202   5e-61   
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     202   5e-61   
gb|KHN36792.1|  60S ribosomal protein L5                                202   5e-61   Glycine soja [wild soybean]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   201   5e-61   Citrus sinensis [apfelsine]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           201   5e-61   Glycine max [soybeans]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                202   6e-61   
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           201   6e-61   Cucumis melo [Oriental melon]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   201   7e-61   Citrus sinensis [apfelsine]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           201   7e-61   Tarenaya hassleriana [spider flower]
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           201   7e-61   Citrus sinensis [apfelsine]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  201   7e-61   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           201   8e-61   Citrus sinensis [apfelsine]
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                201   9e-61   Fragaria vesca subsp. vesca
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           201   1e-60   Sesamum indicum [beniseed]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           201   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    201   1e-60   
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           201   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524859.1|  ribosomal protein L5, putative                     201   2e-60   Ricinus communis
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           200   2e-60   Populus euphratica
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           200   2e-60   Cucumis sativus [cucumbers]
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                200   2e-60   Populus euphratica
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         200   2e-60   Prunus mume [ume]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                201   2e-60   Sesamum indicum [beniseed]
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             202   2e-60   
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              200   2e-60   Tarenaya hassleriana [spider flower]
gb|ACU23594.1|  unknown                                                 200   2e-60   Glycine max [soybeans]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                200   3e-60   Vitis vinifera
gb|KJB22673.1|  hypothetical protein B456_004G060400                    196   3e-60   Gossypium raimondii
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             200   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             199   3e-60   Prunus persica
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           199   3e-60   Glycine max [soybeans]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         200   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           199   3e-60   Sesamum indicum [beniseed]
gb|KJB22670.1|  hypothetical protein B456_004G060400                    195   4e-60   Gossypium raimondii
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         199   4e-60   Jatropha curcas
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                199   4e-60   Cucumis melo [Oriental melon]
gb|ABK93902.1|  unknown                                                 199   5e-60   Populus trichocarpa [western balsam poplar]
gb|ABK95722.1|  unknown                                                 199   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                199   6e-60   Eucalyptus grandis [rose gum]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    199   6e-60   
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         199   8e-60   Tarenaya hassleriana [spider flower]
gb|ACJ85054.1|  unknown                                                 199   8e-60   Medicago truncatula
gb|AFK41086.1|  unknown                                                 199   8e-60   Medicago truncatula
gb|KJB27798.1|  hypothetical protein B456_005G010200                    199   8e-60   Gossypium raimondii
gb|KJB27799.1|  hypothetical protein B456_005G010200                    198   8e-60   Gossypium raimondii
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         198   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   198   1e-59   
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           198   1e-59   Fragaria vesca subsp. vesca
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           198   1e-59   Phoenix dactylifera
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                198   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          198   2e-59   
gb|KJB22672.1|  hypothetical protein B456_004G060400                    195   2e-59   Gossypium raimondii
gb|KJB22671.1|  hypothetical protein B456_004G060400                    195   2e-59   Gossypium raimondii
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           197   2e-59   Cicer arietinum [garbanzo]
ref|NP_001267659.1|  60S ribosomal protein L5                           197   3e-59   Cucumis sativus [cucumbers]
emb|CDP17898.1|  unnamed protein product                                199   3e-59   Coffea canephora [robusta coffee]
gb|AFW84310.1|  hypothetical protein ZEAMMB73_937605                    195   4e-59   
emb|CDP18434.1|  unnamed protein product                                198   4e-59   Coffea canephora [robusta coffee]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          197   4e-59   Sorghum bicolor [broomcorn]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         197   4e-59   Setaria italica
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   198   7e-59   
gb|KJB22668.1|  hypothetical protein B456_004G060400                    196   8e-59   Gossypium raimondii
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             196   9e-59   Populus trichocarpa [western balsam poplar]
gb|ABK93596.1|  unknown                                                 196   9e-59   Populus trichocarpa [western balsam poplar]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    195   1e-58   
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                196   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    196   1e-58   Phoenix dactylifera
gb|AFK39593.1|  unknown                                                 196   1e-58   Lotus japonicus
gb|KJB84072.1|  hypothetical protein B456_N001600                       195   2e-58   Gossypium raimondii
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         195   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         195   2e-58   Brachypodium distachyon [annual false brome]
gb|ACR38045.1|  unknown                                                 195   3e-58   Zea mays [maize]
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           194   3e-58   Populus euphratica
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   194   3e-58   
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         194   4e-58   Jatropha curcas
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     194   4e-58   Eucalyptus grandis [rose gum]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               194   4e-58   Erythranthe guttata [common monkey flower]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     194   5e-58   Eucalyptus grandis [rose gum]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    194   5e-58   Arabis alpina [alpine rockcress]
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         194   5e-58   Zea mays [maize]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    194   5e-58   Arabis alpina [alpine rockcress]
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         193   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              194   6e-58   Brachypodium distachyon [annual false brome]
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     196   7e-58   Eucalyptus grandis [rose gum]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   193   8e-58   
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    193   8e-58   Brassica rapa
dbj|BAJ89012.1|  predicted protein                                      193   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              193   1e-57   Zea mays [maize]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         193   1e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         193   1e-57   Zea mays [maize]
gb|AEV92989.1|  60S ribosomal protein L5                                193   1e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    193   2e-57   
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           192   2e-57   Nelumbo nucifera [Indian lotus]
ref|NP_198790.1|  60S ribosomal protein L5-2                            192   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    192   3e-57   Camelina sativa [gold-of-pleasure]
gb|ACG36552.1|  60S ribosomal protein L5-1                              192   3e-57   Zea mays [maize]
emb|CDX86312.1|  BnaA06g30290D                                          192   5e-57   
gb|EPS64989.1|  hypothetical protein M569_09790                         188   5e-57   Genlisea aurea
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         191   5e-57   Brassica rapa
gb|AAM64753.1|  ribosomal protein, putative                             191   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              191   6e-57   
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             192   6e-57   
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             191   6e-57   Arabidopsis lyrata subsp. lyrata
ref|NP_566767.1|  60S ribosomal protein L5-1                            191   6e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10809.1|  hypothetical protein B456_001G226000                    189   7e-57   Gossypium raimondii
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             191   7e-57   Eutrema salsugineum [saltwater cress]
emb|CDY52294.1|  BnaA03g57870D                                          192   7e-57   Brassica napus [oilseed rape]
gb|KHN27258.1|  60S ribosomal protein L5                                191   7e-57   Glycine soja [wild soybean]
ref|XP_002524558.1|  ribosomal protein L5, putative                     191   7e-57   Ricinus communis
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         190   1e-56   
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           192   2e-56   
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             189   3e-56   Capsella rubella
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             189   4e-56   Capsella rubella
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         189   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         189   4e-56   Camelina sativa [gold-of-pleasure]
gb|ABK21084.1|  unknown                                                 189   5e-56   Picea sitchensis
emb|CDY15088.1|  BnaC03g44490D                                          190   6e-56   Brassica napus [oilseed rape]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         189   7e-56   Oryza brachyantha
emb|CDY27889.1|  BnaA07g04790D                                          189   7e-56   Brassica napus [oilseed rape]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    188   7e-56   Gossypium raimondii
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         188   7e-56   Brassica rapa
emb|CDY50258.1|  BnaC07g47930D                                          189   8e-56   Brassica napus [oilseed rape]
emb|CDY15089.1|  BnaC03g44500D                                          189   8e-56   Brassica napus [oilseed rape]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             188   9e-56   
emb|CDY52293.1|  BnaA03g57860D                                          189   1e-55   Brassica napus [oilseed rape]
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             188   1e-55   Capsella rubella
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    188   2e-55   
emb|CDX85331.1|  BnaC07g26420D                                          190   2e-55   
dbj|BAD82173.1|  putative ribosomal protein L5                          187   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         187   2e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001045083.1|  Os01g0896800                                       187   3e-55   
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        186   6e-55   Oryza sativa Indica Group [Indian rice]
emb|CBI38286.3|  unnamed protein product                                182   7e-55   Vitis vinifera
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          186   8e-55   
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             186   9e-55   Eutrema salsugineum [saltwater cress]
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    186   1e-54   
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    185   1e-54   Oryza brachyantha
gb|KJB22669.1|  hypothetical protein B456_004G060400                    184   2e-54   Gossypium raimondii
gb|KJB84073.1|  hypothetical protein B456_N001600                       184   3e-54   Gossypium raimondii
ref|XP_010101365.1|  60S ribosomal protein L5                           184   5e-54   
gb|EPS61271.1|  hypothetical protein M569_13526                         182   6e-54   Genlisea aurea
gb|KHG14330.1|  60S ribosomal L5                                        182   1e-53   Gossypium arboreum [tree cotton]
ref|XP_002876523.1|  predicted protein                                  183   1e-53   Arabidopsis lyrata subsp. lyrata
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  181   2e-53   Citrus sinensis [apfelsine]
gb|AES74307.2|  60S ribosomal protein L5-2                              181   3e-53   Medicago truncatula
gb|EMT04099.1|  60S ribosomal protein L5-2                              181   4e-53   
tpg|DAA56365.1|  TPA: hypothetical protein ZEAMMB73_635593              176   6e-53   
ref|XP_003604056.1|  60S ribosomal protein L5                           181   7e-53   
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                180   1e-52   Elaeis guineensis
gb|KHG15135.1|  60S ribosomal L5                                        178   2e-52   Gossypium arboreum [tree cotton]
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           180   3e-52   Elaeis guineensis
gb|EMT23062.1|  60S ribosomal protein L5-2                              179   3e-52   
gb|KHG10378.1|  60S ribosomal protein L5                                177   5e-52   Gossypium arboreum [tree cotton]
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                179   5e-52   Nelumbo nucifera [Indian lotus]
gb|EMT20601.1|  60S ribosomal protein L5-2                              178   6e-52   
gb|KHG04393.1|  60S ribosomal L5                                        177   7e-52   Gossypium arboreum [tree cotton]
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           177   8e-52   
gb|EMS59984.1|  60S ribosomal protein L5-2                              177   1e-51   Triticum urartu
gb|KHG10377.1|  60S ribosomal protein L5                                175   5e-51   Gossypium arboreum [tree cotton]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        176   5e-51   
ref|XP_001783620.1|  predicted protein                                  175   1e-50   
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      175   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172693.1|  Os01g0896620                                       169   2e-50   
ref|XP_001767871.1|  predicted protein                                  174   4e-50   
ref|XP_001759628.1|  predicted protein                                  173   7e-50   
ref|XP_001783411.1|  predicted protein                                  172   2e-49   
gb|KHN36791.1|  60S ribosomal protein L5                                169   6e-49   Glycine soja [wild soybean]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             170   6e-49   
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             167   2e-47   Selaginella moellendorffii
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             167   2e-47   Selaginella moellendorffii
gb|ACN25149.1|  ribosomal-like protein                                  159   8e-45   Pectinaria gouldii
dbj|BAJ07363.1|  Tt5 protein                                            155   1e-44   Hydatigera taeniaeformis
ref|XP_005345167.1|  PREDICTED: 60S ribosomal protein L5-like           154   2e-44   Microtus ochrogaster [prairie voles]
ref|XP_005889093.1|  PREDICTED: 60S ribosomal protein L5-like           154   2e-44   Bos mutus
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         154   3e-44   Fragaria vesca subsp. vesca
ref|XP_010948703.1|  PREDICTED: 60S ribosomal protein L5                159   4e-44   Camelus bactrianus [camel]
gb|ACO09732.1|  60S ribosomal protein L5                                154   4e-44   Osmerus mordax
ref|XP_005359733.1|  PREDICTED: 60S ribosomal protein L5                157   5e-44   Microtus ochrogaster [prairie voles]
ref|XP_008049787.1|  PREDICTED: 60S ribosomal protein L5                155   6e-44   Carlito syrichta
gb|AAO25760.1|  ribosomal protein L5b                                   155   7e-44   Ictalurus punctatus
gb|ACI70102.1|  60S ribosomal protein L5                                153   9e-44   Salmo salar
ref|XP_010973953.1|  PREDICTED: 60S ribosomal protein L5                159   1e-43   
ref|XP_011283311.1|  PREDICTED: 60S ribosomal protein L5                158   1e-43   
ref|XP_005969822.1|  PREDICTED: 60S ribosomal protein L5-like           155   2e-43   
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           156   2e-43   Aplysia californica
emb|CDQ68843.1|  unnamed protein product                                154   2e-43   Oncorhynchus mykiss
ref|XP_008152973.1|  PREDICTED: 60S ribosomal protein L5                158   3e-43   
ref|XP_006197385.1|  PREDICTED: 60S ribosomal protein L5                155   3e-43   Vicugna pacos
gb|ABN14903.1|  60S ribosomal protein L5A                               152   3e-43   Taenia asiatica [Asian tapeworm]
ref|XP_007073490.1|  PREDICTED: 60S ribosomal protein L5-like           159   3e-43   
gb|KHJ46023.1|  ribosomal L18p/L5e family protein                       155   4e-43   Trichuris suis
gb|AFM74205.1|  ribosomal protein L5                                    155   4e-43   Spirometra erinaceieuropaei
ref|XP_001689859.1|  ribosomal protein L5, component of cytosolic...    155   4e-43   Chlamydomonas reinhardtii
ref|XP_004699318.1|  PREDICTED: 60S ribosomal protein L5                155   4e-43   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004884145.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   4e-43   
ref|XP_006728911.1|  PREDICTED: 60S ribosomal protein L5                155   4e-43   
ref|XP_004884144.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   4e-43   
ref|XP_004002245.1|  PREDICTED: 60S ribosomal protein L5                155   4e-43   
ref|XP_005542775.1|  PREDICTED: 60S ribosomal protein L5 isoform X3     155   4e-43   Macaca fascicularis [crab eating macaque]
gb|EHH14955.1|  hypothetical protein EGK_00972                          155   5e-43   Macaca mulatta [rhesus macaque]
ref|XP_004653832.1|  PREDICTED: 60S ribosomal protein L5                154   5e-43   
ref|XP_004378798.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   Trichechus manatus latirostris
ref|XP_006093256.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   Myotis lucifugus
ref|XP_003479207.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   Cavia porcellus [guinea pig]
ref|XP_006758248.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   Myotis davidii
ref|XP_007169651.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   Balaenoptera acutorostrata scammoni
ref|XP_006140244.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   
ref|NP_001182608.1|  60S ribosomal protein L5                           155   5e-43   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007533339.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   Erinaceus europaeus [common hedgehog]
ref|XP_005983309.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   
ref|XP_004402579.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   Odobenus rosmarus divergens
ref|NP_001107756.1|  60S ribosomal protein L5                           155   5e-43   Sus scrofa [pigs]
ref|XP_004018480.1|  PREDICTED: 60S ribosomal protein L5-like           155   5e-43   Ovis aries [domestic sheep]
ref|XP_007934240.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   Orycteropus afer afer
ref|XP_007110786.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   
ref|XP_005610315.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   Equus caballus [domestic horse]
ref|XP_004319592.1|  PREDICTED: 60S ribosomal protein L5-like           155   5e-43   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_010596404.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   Loxodonta africana [African bush elephant]
sp|P15125.2|RL5A_XENLA  RecName: Full=60S ribosomal protein L5-A        155   5e-43   Xenopus laevis [clawed frog]
ref|XP_010643206.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   Fukomys damarensis [Damara mole rat]
gb|AAI09371.1|  Ribosomal protein L5                                    155   5e-43   Homo sapiens [man]
ref|NP_000960.2|  60S ribosomal protein L5                              155   5e-43   Homo sapiens [man]
gb|ELW72620.1|  60S ribosomal protein L5                                155   5e-43   Tupaia chinensis
dbj|BAD96324.1|  ribosomal protein L5 variant                           155   5e-43   Homo sapiens [man]
ref|XP_005385097.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   Chinchilla lanigera
pdb|4W20|D  Chain D, Structure Of The Mammalian 60s Ribosomal Sub...    155   5e-43   Sus scrofa [pigs]
ref|XP_002751148.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   Callithrix jacchus [common marmoset]
ref|XP_005385096.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   
ref|XP_003418527.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   
ref|XP_005879039.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   
ref|XP_008262168.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   
ref|NP_001187210.1|  ribosomal protein L5b                              155   5e-43   
ref|XP_003973919.1|  PREDICTED: 60S ribosomal protein L5-like           156   5e-43   
ref|XP_005077452.1|  PREDICTED: 60S ribosomal protein L5                155   5e-43   
ref|XP_005610314.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   5e-43   
ref|XP_010643208.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   5e-43   
ref|XP_004625113.1|  PREDICTED: 60S ribosomal protein L5-like           155   6e-43   
ref|XP_005542773.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   6e-43   
dbj|BAD92217.1|  ribosomal protein L5 variant                           155   6e-43   
ref|XP_007641146.1|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
ref|XP_007480367.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   6e-43   
gb|AAX46329.1|  ribosomal protein L5                                    155   6e-43   
ref|XP_003505203.1|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
ref|XP_007169652.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   6e-43   
ref|XP_006985881.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     155   6e-43   
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              155   6e-43   
ref|XP_006985882.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   6e-43   
ref|XP_007611466.1|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
ref|XP_008578547.1|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
ref|XP_007480368.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     155   6e-43   
ref|XP_008334234.1|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
ref|XP_001515074.2|  PREDICTED: 60S ribosomal protein L5                155   6e-43   
emb|CBX33183.1|  ribosomal protein L5                                   155   6e-43   
ref|NP_001079437.1|  60S ribosomal protein L5-B                         155   7e-43   
ref|XP_004752780.1|  PREDICTED: 60S ribosomal protein L5                157   7e-43   
emb|CDI98331.1|  ribosomal protein l5                                   155   7e-43   
sp|P15126.2|RL5B_XENLA  RecName: Full=60S ribosomal protein L5-B        155   7e-43   
gb|AFU54189.1|  ribosomal protein L5                                    150   7e-43   
ref|XP_004620003.1|  PREDICTED: 60S ribosomal protein L5                154   7e-43   
emb|CDS19989.1|  ribosomal protein l5                                   155   7e-43   
ref|XP_009680869.1|  PREDICTED: 60S ribosomal protein L5                155   7e-43   
gb|EGT59594.1|  hypothetical protein CAEBREN_20463                      150   7e-43   
ref|XP_006265613.1|  PREDICTED: 60S ribosomal protein L5                155   7e-43   
ref|XP_003220130.1|  PREDICTED: 60S ribosomal protein L5                154   8e-43   
ref|XP_008070593.1|  PREDICTED: 60S ribosomal protein L5                154   8e-43   
gb|ACO09827.1|  60S ribosomal protein L5                                154   8e-43   
gb|ETE73605.1|  60S ribosomal protein L5                                155   9e-43   
ref|XP_005153981.1|  PREDICTED: 60S ribosomal protein L5                154   9e-43   
gb|ACH70882.1|  Ribosomal protein L5b                                   154   1e-42   
ref|XP_010870379.1|  PREDICTED: 60S ribosomal protein L5                154   1e-42   
ref|XP_007437567.1|  PREDICTED: 60S ribosomal protein L5                154   1e-42   
ref|NP_989912.1|  60S ribosomal protein L5                              154   1e-42   
ref|XP_007233671.1|  PREDICTED: 60S ribosomal protein L5-like           154   1e-42   
gb|KFD48731.1|  hypothetical protein M513_10361                         155   1e-42   
ref|NP_001232619.1|  putative ribosomal protein L5                      154   1e-42   
tpg|DAA34076.1|  TPA: 60S ribosomal protein L5                          152   1e-42   
ref|NP_001187035.1|  ribosomal protein L5a                              154   1e-42   
ref|XP_009908172.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     154   1e-42   
ref|XP_008578545.1|  PREDICTED: 60S ribosomal protein L5                154   1e-42   
gb|ADO28300.1|  60S ribosomal protein l5                                154   1e-42   
gb|ADO29334.1|  60S ribosomal protein l5                                154   1e-42   
tpg|DAA23524.1|  TPA: ribosomal protein L5-like                         154   1e-42   
ref|XP_006040170.1|  PREDICTED: 60S ribosomal protein L5-like           151   1e-42   
ref|XP_008143036.1|  PREDICTED: 60S ribosomal protein L5                154   1e-42   
ref|XP_006001656.1|  PREDICTED: 60S ribosomal protein L5                154   1e-42   
ref|XP_009939484.1|  PREDICTED: 60S ribosomal protein L5                155   2e-42   
emb|CAG05644.1|  unnamed protein product                                154   2e-42   
ref|NP_001270867.1|  60S ribosomal protein L5                           154   2e-42   
gb|AFM86790.1|  60S ribosomal protein L5-A                              154   2e-42   
ref|XP_004417183.1|  PREDICTED: 60S ribosomal protein L5-like           154   2e-42   
gb|AFM87418.1|  60S ribosomal protein L5-B                              154   2e-42   
ref|XP_011442103.1|  PREDICTED: 60S ribosomal protein L5-like           150   2e-42   
ref|NP_001279040.1|  ribosomal protein L5                               154   2e-42   
dbj|BAF98650.1|  ribosomal protein L5                                   154   2e-42   
ref|XP_005298201.1|  PREDICTED: 60S ribosomal protein L5                154   2e-42   
gb|ACN10317.1|  60S ribosomal protein L5                                154   2e-42   
gb|ABO26701.1|  ribosomal protein l5                                    152   2e-42   
gb|AFM90058.1|  ribosomal protein L5                                    154   2e-42   
gb|AFM88682.1|  ribosomal protein L5                                    154   2e-42   
gb|AEI69274.1|  ribosomal protein L5                                    154   2e-42   
gb|ACO07680.1|  60S ribosomal protein L5                                154   2e-42   
gb|AFM88396.1|  ribosomal protein L5                                    153   2e-42   
gb|ACO07720.1|  60S ribosomal protein L5                                153   2e-42   
gb|ACH70844.1|  ribosomal protein L5a                                   153   2e-42   
gb|AFM89421.1|  ribosomal protein L5                                    153   2e-42   
gb|AFM87698.1|  60S ribosomal protein L5-A                              153   2e-42   
ref|XP_004589426.1|  PREDICTED: 60S ribosomal protein L5-like           153   2e-42   
gb|ABI26260.1|  ribosomal protein L5                                    153   2e-42   
ref|XP_007882704.1|  PREDICTED: 60S ribosomal protein L5-like           153   2e-42   
gb|AFM85809.1|  ribosomal protein L5                                    153   2e-42   
gb|AFM88337.1|  ribosomal protein L5                                    153   2e-42   
gb|AFM87650.1|  60S ribosomal protein L5-like protein                   153   2e-42   
ref|XP_008406082.1|  PREDICTED: 60S ribosomal protein L5                155   2e-42   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                153   3e-42   
gb|ACI69521.1|  60S ribosomal protein L5                                153   3e-42   
ref|XP_007058944.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     153   3e-42   
gb|AFM86481.1|  ribosomal protein L5                                    153   3e-42   
ref|XP_001634531.1|  predicted protein                                  153   3e-42   
ref|XP_004889785.1|  PREDICTED: 60S ribosomal protein L5-like           153   3e-42   
ref|XP_004848203.1|  PREDICTED: 60S ribosomal protein L5-like           153   3e-42   
gb|ACZ13335.1|  60S ribosomal protein L5                                153   3e-42   
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           153   3e-42   
pdb|2ZKR|NN  Chain n, Structure Of A Mammalian Ribosomal 60s Subu...    153   3e-42   
emb|CDQ69914.1|  unnamed protein product                                154   3e-42   
ref|NP_001079377.1|  60S ribosomal protein L5-A                         153   3e-42   
ref|NP_001291805.1|  ribosomal protein L5                               153   3e-42   
gb|EPY76441.1|  60S ribosomal protein L5                                153   3e-42   
ref|XP_006790548.1|  PREDICTED: 60S ribosomal protein L5-like           153   4e-42   
ref|NP_112361.1|  60S ribosomal protein L5                              153   4e-42   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 153   4e-42   
ref|XP_005727289.1|  PREDICTED: 60S ribosomal protein L5-like           153   4e-42   
ref|XP_537074.4|  PREDICTED: 60S ribosomal protein L5 isoform 1         155   4e-42   
emb|CDQ74996.1|  unnamed protein product                                155   4e-42   
gb|AFW84312.1|  hypothetical protein ZEAMMB73_937605                    150   4e-42   
ref|XP_005592505.1|  PREDICTED: 60S ribosomal protein L5-like           153   4e-42   
ref|XP_010339421.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    153   4e-42   
ref|XP_004552954.1|  PREDICTED: 60S ribosomal protein L5-like           153   4e-42   
ref|XP_006250647.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     153   4e-42   
ref|XP_009273931.1|  PREDICTED: 60S ribosomal protein L5                153   4e-42   
ref|XP_005451204.1|  PREDICTED: 60S ribosomal protein L5-like           153   4e-42   
gb|ACI34044.1|  60S ribosomal protein L5                                152   4e-42   
emb|CDQ77184.1|  unnamed protein product                                153   5e-42   
gb|ELR57120.1|  60S ribosomal protein L5                                152   5e-42   
ref|XP_005346907.1|  PREDICTED: 60S ribosomal protein L5-like           152   5e-42   
gb|ACI66198.1|  60S ribosomal protein L5                                155   5e-42   
gb|ADV40159.1|  putative 60S ribosomal protein L5                       152   5e-42   
ref|XP_005806012.1|  PREDICTED: 60S ribosomal protein L5-like           154   5e-42   
ref|XP_006882544.1|  PREDICTED: 60S ribosomal protein L5                152   5e-42   
ref|NP_001002106.1|  ribosomal protein L5                               152   5e-42   
ref|XP_010732697.1|  PREDICTED: 60S ribosomal protein L5                153   5e-42   
gb|KFM66007.1|  60S ribosomal protein L5-A                              152   5e-42   
gb|AFM89559.1|  ribosomal protein L5                                    152   5e-42   
ref|XP_005521032.1|  PREDICTED: 60S ribosomal protein L5                152   5e-42   
ref|XP_008628716.1|  PREDICTED: 60S ribosomal protein L5                153   6e-42   
ref|XP_006093255.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     152   6e-42   
ref|XP_006727091.1|  PREDICTED: 60S ribosomal protein L5-like           151   6e-42   
ref|XP_010891931.1|  PREDICTED: 60S ribosomal protein L5-like           152   6e-42   
ref|XP_005985559.1|  PREDICTED: 60S ribosomal protein L5-like           152   6e-42   
gb|KIY93440.1|  60S ribosomal protein L5                                149   7e-42   
ref|XP_006021921.1|  PREDICTED: 60S ribosomal protein L5                152   7e-42   
emb|CCQ18634.1|  60S ribosomal protein L5                               152   7e-42   
ref|XP_008992670.1|  PREDICTED: 60S ribosomal protein L5                152   8e-42   
ref|XP_010731643.1|  PREDICTED: 60S ribosomal protein L5-like           152   8e-42   
ref|NP_001279541.1|  60S ribosomal protein L5-like                      152   8e-42   
gb|ELK34439.1|  60S ribosomal protein L5                                153   9e-42   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   151   9e-42   
ref|XP_011354001.1|  PREDICTED: 60S ribosomal protein L5                152   9e-42   
ref|XP_005422184.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|AAM33437.1|  ribosomal protein L5                                    149   1e-41   
gb|KFV85217.1|  60S ribosomal protein L5                                152   1e-41   
gb|EOA96368.1|  60S ribosomal protein L5                                152   1e-41   
ref|XP_005026595.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_005482139.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|EDL14330.1|  mCG1026389                                              152   1e-41   
ref|XP_010159869.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_010713879.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|ACO10055.1|  60S ribosomal protein L5                                152   1e-41   
ref|XP_009075975.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|KFO98657.1|  60S ribosomal protein L5                                152   1e-41   
gb|KFO56565.1|  60S ribosomal protein L5                                152   1e-41   
ref|XP_010022288.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_006534747.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     152   1e-41   
ref|XP_009959874.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|ERE68201.1|  60S ribosomal protein L5-like protein                   152   1e-41   
ref|XP_009963721.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_003767272.1|  PREDICTED: 60S ribosomal protein L5                153   1e-41   
ref|XP_009087107.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_009512323.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|NP_001030383.1|  60S ribosomal protein L5                           151   1e-41   
ref|NP_058676.1|  60S ribosomal protein L5                              151   1e-41   
gb|ACO07510.1|  60S ribosomal protein L5                                151   1e-41   
dbj|BAE31169.1|  unnamed protein product                                151   1e-41   
gb|AFM86403.1|  60S ribosomal protein L5-A                              151   1e-41   
ref|XP_010303651.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_010291146.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|KFO07226.1|  60S ribosomal protein L5                                151   1e-41   
ref|XP_008942395.1|  PREDICTED: 60S ribosomal protein L5                151   1e-41   
ref|XP_004018164.1|  PREDICTED: 60S ribosomal protein L5-like           154   1e-41   
ref|XP_010005060.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|KFP17477.1|  60S ribosomal protein L5                                151   1e-41   
ref|XP_010196863.1|  PREDICTED: 60S ribosomal protein L5                151   1e-41   
ref|XP_009818493.1|  PREDICTED: 60S ribosomal protein L5                151   1e-41   
ref|XP_009920773.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
ref|XP_009554761.1|  PREDICTED: 60S ribosomal protein L5                152   1e-41   
gb|KFO69584.1|  60S ribosomal protein L5                                151   1e-41   
ref|XP_005690639.1|  PREDICTED: 60S ribosomal protein L5-like           150   1e-41   
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      151   1e-41   
ref|XP_005445628.1|  PREDICTED: 60S ribosomal protein L5                151   1e-41   
ref|XP_008489183.1|  PREDICTED: 60S ribosomal protein L5                152   2e-41   
gb|KFM02490.1|  60S ribosomal protein L5                                151   2e-41   
ref|XP_008295524.1|  PREDICTED: 60S ribosomal protein L5                152   2e-41   
ref|XP_010581057.1|  PREDICTED: 60S ribosomal protein L5                152   2e-41   
ref|XP_007554751.1|  PREDICTED: 60S ribosomal protein L5                152   2e-41   
ref|XP_005050402.1|  PREDICTED: 60S ribosomal protein L5                152   2e-41   
ref|NP_988881.1|  ribosomal protein L5                                  151   2e-41   
ref|XP_003264168.1|  PREDICTED: 60S ribosomal protein L5-like iso...    151   2e-41   
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           151   2e-41   
gb|ERG79917.1|  60s ribosomal protein l5                                150   2e-41   
ref|NP_495811.1|  Protein RPL-5                                         151   2e-41   
ref|XP_004020669.1|  PREDICTED: 60S ribosomal protein L5-like           151   2e-41   
ref|XP_003975748.1|  PREDICTED: 60S ribosomal protein L5-like           151   2e-41   
ref|XP_003743796.1|  PREDICTED: 60S ribosomal protein L5-like           151   2e-41   
gb|EPZ34992.1|  60S ribosomal protein L5                                151   2e-41   
emb|CAD91421.1|  ribosomal protein L5                                   150   2e-41   
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      151   2e-41   
ref|XP_007058943.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     151   2e-41   
ref|XP_006114225.1|  PREDICTED: 60S ribosomal protein L5                151   2e-41   
sp|Q26481.3|RL5_STYCL  RecName: Full=60S ribosomal protein L5           150   2e-41   
gb|EMP36618.1|  60S ribosomal protein L5                                150   3e-41   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           150   3e-41   
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           150   3e-41   
ref|XP_009466638.1|  PREDICTED: 60S ribosomal protein L5                152   3e-41   
ref|XP_004078696.1|  PREDICTED: 60S ribosomal protein L5-like           150   3e-41   
gb|ACO07790.1|  60S ribosomal protein L5                                150   3e-41   
emb|CAX78280.1|  putative ribosomal protein L5                          150   3e-41   
emb|CAX78293.1|  putative ribosomal protein L5                          150   3e-41   
emb|CAX78299.1|  putative ribosomal protein L5                          150   4e-41   
emb|CAF96378.1|  unnamed protein product                                150   4e-41   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           150   4e-41   
ref|XP_005237335.1|  PREDICTED: 60S ribosomal protein L5                152   4e-41   
ref|XP_004468431.1|  PREDICTED: 60S ribosomal protein L5-like           150   4e-41   
gb|ACD65156.1|  putative 60S ribosomal protein RPL5                     149   4e-41   
ref|XP_006634858.1|  PREDICTED: 60S ribosomal protein L5-like           152   4e-41   
gb|AAP06189.1|  similar to GenBank Accession Number L78668 60S ri...    150   4e-41   
gb|KFM05083.1|  60S ribosomal protein L5                                150   4e-41   
ref|XP_004635786.1|  PREDICTED: 60S ribosomal protein L5                150   4e-41   
ref|XP_006786853.1|  PREDICTED: 60S ribosomal protein L5-like           150   4e-41   
ref|XP_009883197.1|  PREDICTED: 60S ribosomal protein L5                151   4e-41   



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EA GEDYSVEP
Sbjct  121  GNLEANGEDYSVEP  134



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+E  GEDYSVEP
Sbjct  121  GNLEVNGEDYSVEP  134



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN+E  GEDYSVEP
Sbjct  121  GNLEVNGEDYSVEP  134



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ+VSASIAGDMILASAYANELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQVVSASIAGDMILASAYANELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+E  GEDYSVEP
Sbjct  121  GNLEVNGEDYSVEP  134



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN EA+GEDYSVEP
Sbjct  121  GNTEASGEDYSVEP  134



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELPRYGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPRYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN++  GEDYSVEP
Sbjct  121  GNLDVNGEDYSVEP  134



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELP+YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN EA+GEDYSVEP
Sbjct  121  GNPEASGEDYSVEP  134



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN EA+GEDYSVEP
Sbjct  121  GNPEASGEDYSVEP  134



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELP YGL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQIVSASIAGDMILASAYARELPHYGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN++  GEDYSVEP
Sbjct  121  GNLDVNGEDYSVEP  134



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK+RAYFKR+QVKF+RRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFRRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L KLEMDQEYE
Sbjct  61   TAQIISASITGDSVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLTKLEMDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|AFK41626.1| unknown [Lotus japonicus]
Length=207

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA ELP++GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYARELPQFGLQVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVE  457
            GN EA+GEDYSVE
Sbjct  121  GNPEASGEDYSVE  133



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AYANELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYANELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN+DI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   IAQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN++  GEDYSVEP
Sbjct  121  GNLDVNGEDYSVEP  134



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKVQKTRAYFKRFQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QIVSASIAGDMILASAYA+ELP +GL+VGLTNYAAAYCTGLLLARR+L+KLEMD+EY+
Sbjct  61   ITQIVSASIAGDMILASAYASELPHFGLKVGLTNYAAAYCTGLLLARRVLKKLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN++  GEDYSVEP
Sbjct  121  GNLDVNGEDYSVEP  134



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  8    LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  187
            + P  + L G  S  + M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  16   ICPLLSLLEGRGSRASAMVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  75

Query  188  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  367
            YNTPKYRFVVRFTNKDI+AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGL
Sbjct  76   YNTPKYRFVVRFTNKDIIAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGL  135

Query  368  llarrllqklEMDQEYEGNVEATGEDYSVEP  460
            LLARR+L+ LEMD EYEGNVEATGEDYSVEP
Sbjct  136  LLARRVLKMLEMDGEYEGNVEATGEDYSVEP  166



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YE
Sbjct  61   TAQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KDO51035.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=252

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            G+VEATGEDYSVEP
Sbjct  121  GHVEATGEDYSVEP  134



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   204 bits (519),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            G+VEATGEDYSVEP
Sbjct  121  GHVEATGEDYSVEP  134



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   IAQIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GEDYSVEP
Sbjct  121  GNVEASGEDYSVEP  134



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   IAQITSASIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F K QK+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFAKAQKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = +2

Query  8    LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  187
            L+P+ET      S +A M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNK
Sbjct  26   LNPKETQALLPFSPSA-MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNK  84

Query  188  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  367
            YNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGL
Sbjct  85   YNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGL  144

Query  368  llarrllqklEMDQEYEGNVEATGEDYSVEP  460
            LLARR+L+ LEMD+EYEGNVEATGEDYSVEP
Sbjct  145  LLARRVLKTLEMDEEYEGNVEATGEDYSVEP  175



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGEDYSVEP
Sbjct  121  GNEEATGEDYSVEP  134



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  KTRAY KRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTLKTRAYSKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AY+KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYYKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQILSASIAGDLVLAAAYAHELPSYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGDM+LA+AY++ELP++GLEVGLTNYAAAYCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISASIAGDMVLAAAYSHELPQFGLEVGLTNYAAAYCTGLLLARRTLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGEDYSVEP
Sbjct  121  GNEEATGEDYSVEP  134



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+
Sbjct  61   IAQILSASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD+EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRREGKTDYRAR RLINQDKNKY+TPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSRAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYSTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSA+IAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR LQKLEMD+EYE
Sbjct  61   TAQIVSATIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRTLQKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI SASIAGD++LA+AYA+ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQITSASIAGDLVLAAAYAHELPXYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
            AF+K QK+RAYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR VVRFTNKD+ 
Sbjct  4    AFVKAQKSRAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRIVVRFTNKDVT  63

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASI GD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD++YEG
Sbjct  64   AQIISASITGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEDYEG  123

Query  422  NVEATGEDYSVEP  460
            NVEATGEDYSVEP
Sbjct  124  NVEATGEDYSVEP  136



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            G+VEATGEDYSVEP
Sbjct  121  GHVEATGEDYSVEP  134



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K  K+RAYFKRFQVK++RRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKALKSRAYFKRFQVKYRRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVS+SIAGDM+LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGEDYSVEP
Sbjct  121  GNLEATGEDYSVEP  134



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            G+VEATGEDYSVEP
Sbjct  121  GHVEATGEDYSVEP  134



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GED+SVEP
Sbjct  121  GNVEASGEDFSVEP  134



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            G+VEATGEDYSVEP
Sbjct  121  GHVEATGEDYSVEP  134



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LASAYA+ELP YGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPHYGLDFGLTNYAAAYCTGLLLARRVLKTLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASI GDM+LA+AYA+ELP YGLEVGL+NYAAAYCTGLLLARR+L+KLEMD EY+
Sbjct  61   VAQIVSASITGDMVLAAAYAHELPHYGLEVGLSNYAAAYCTGLLLARRVLKKLEMDDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGEDYSVEP
Sbjct  121  GNLEATGEDYSVEP  134



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAHKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+S+SIAGD++LASA+A+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   VAQIISSSIAGDLVLASAFAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  5    FVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  64

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+GN
Sbjct  65   QIISATIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQGN  124

Query  425  VEATGEDYSVEP  460
            VEATGED+SVEP
Sbjct  125  VEATGEDFSVEP  136



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AY KR+QVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKTQKTKAYSKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQ++SASIAGD++LASAYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  61   CAQVISASIAGDLVLASAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AYA+ELP YGL+VGLTNYAAAYCTGLLLARR L+ LEMD+EY+
Sbjct  61   VAQIVSASIAGDIVLAAAYAHELPHYGLDVGLTNYAAAYCTGLLLARRTLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA+ K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSRAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+R TNKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVIRITNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVS+SIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLL+ARR+L+KLEMD EYE
Sbjct  61   TAQIVSSSIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLVARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGEDYSVEP
Sbjct  121  GNLEATGEDYSVEP  134



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIVSASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   MAFVKAQKTKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EY+
Sbjct  78   IAQILSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDDEYQ  137

Query  419  GNVEATGEDYSVEP  460
            GN+EATGEDYSVEP
Sbjct  138  GNLEATGEDYSVEP  151



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  41   SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  220
            +S    MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  82   NSKVRAMAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR  141

Query  221  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  400
            FTNKDI+AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  142  FTNKDIIAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLE  201

Query  401  MDQEYEGNVEATGEDYSVEP  460
            MD EYEGNVEATGEDYSVEP
Sbjct  202  MDDEYEGNVEATGEDYSVEP  221



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K +K++AYFKR++VKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKSRKSKAYFKRYRVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KJB22673.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=197

 Score =   196 bits (499),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  121  GNVEATGEDFTVEP  134



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAYFKR+QVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI SASIAGD++LASAYA+ELPRYGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIASASIAGDIVLASAYAHELPRYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K+RAYFKRFQVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSLKSRAYFKRFQVKYKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L KLEM  EYE
Sbjct  61   VAQIISASIAGDLVLASAYAHELPRYGLKVGLTNYAAAYCTGLLLARRVLHKLEMADEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AYA+ELP+YGLEVGLTNYAAAYCTGLLLARR+L  LEMD+EYE
Sbjct  61   VAQIISASIAGDIVLAAAYAHELPQYGLEVGLTNYAAAYCTGLLLARRVLNTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LASAY +ELPRYGLEVGLT+YAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVLASAYGHELPRYGLEVGLTSYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ+ SASIAGD +LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+KL+MD+EYE
Sbjct  61   IAQVSSASIAGDHVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLRKLDMDKEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KJB22670.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=171

 Score =   195 bits (496),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  121  GNVEATGEDFTVEP  134



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LASAY++ELP YGLEVGLTNYAAAYCTGLLLARR L+ LEMD EY+
Sbjct  61   VAQIVSASIAGDLVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRTLKMLEMDDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA+ K QK++AY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAYAKAQKSKAYSKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI SASI GD +LASAYA+ELPRYGLEVGLTNYAAAYCTGLLLARRLL+ LEMD+EYE
Sbjct  61   VAQITSASITGDTVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRLLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+S+EP
Sbjct  121  GNVEATGEDFSIEP  134



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVA
Sbjct  21   YVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVA  80

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  81   QIISASIAGDIVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGN  140

Query  425  VEATGEDYSVEP  460
            VEATGEDYSVEP
Sbjct  141  VEATGEDYSVEP  152



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K+RAYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAHKSRAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSA+IAGD++L +AY++ELPRYGLE+GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLTAAYSHELPRYGLEIGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++LA+AY++ELP +GL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVLAAAYSHELPHFGLKVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SA+I GDMILASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMILASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSQKSKAYFKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSA+IAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSATIAGDVVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGED+SVEP
Sbjct  121  GNTEATGEDFSVEP  134



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD EYE
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIK  K RAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+YCTGLLLARR L+KLEMD+EYE
Sbjct  61   VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  KTRAYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTLKTRAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   TAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVE  457
            GNVEATG+D+SVE
Sbjct  121  GNVEATGDDFSVE  133



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKR+QVK+KRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKSQKTKAYFKRYQVKYKRRRVGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAYA+ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   AAQIISASIAGDLVLASAYAHELPHYGLEAGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  121  GNVEATGEDFTVEP  134



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  121  GNVEATGEDFTVEP  134



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIVSASIAGDIVLAAAYSHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GED+SVEP
Sbjct  121  GNVEASGEDFSVEP  134



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct  1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGD++LASAY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKR+QV FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFT KDI
Sbjct  55   MAFVKAQKTKAYFKRYQVPFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTKKDI  114

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGD++LA+AY++ELP +GLEVGLTNYAAAY TGLLLARR+L+KLEMD+EYE
Sbjct  115  IAQIVSASIAGDLVLAAAYSHELPHFGLEVGLTNYAAAYATGLLLARRVLKKLEMDEEYE  174

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  175  GNVEATGEDYSVEP  188



>gb|AFW84310.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=233

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = +2

Query  77   QKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  256
            QKT+AYFKR+QV+FKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS
Sbjct  37   QKTKAYFKRYQVQFKRRREGKTDYRARVRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVS  96

Query  257  ASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEAT  436
            ASIAGD++LASAYA+ELPRYGLE+GLTNYAAAYCTGLLLARR+L++L+MD+EYEGNVEAT
Sbjct  97   ASIAGDIVLASAYAHELPRYGLEIGLTNYAAAYCTGLLLARRVLKELQMDEEYEGNVEAT  156

Query  437  GEDYSVEP  460
            GEDYSVEP
Sbjct  157  GEDYSVEP  164



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  4    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  63

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  64   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  123

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  124  NVEATGEDFSVEP  136



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIVSASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   AQIVSASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   198 bits (503),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD+
Sbjct  57   MAYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDL  116

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  117  IAQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYE  176

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  177  GNVEATGEDFTVEP  190



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  121  GNVEATGEDFTVEP  134



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   196 bits (498),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   196 bits (498),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAY KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV+RFTNKDI
Sbjct  1    MAFAKAQKSRAYCKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVMRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QIVSA+I GD +LA+AYA+ELP +GLEVGL+NYAAAYCTGLLL+RR+L+ LEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLEVGLSNYAAAYCTGLLLSRRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+
Sbjct  61   IAQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQ  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATG D+SVEP
Sbjct  121  GNIEATGLDFSVEP  134



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M FIK QK RAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNT KYRFVVR TNKDI
Sbjct  1    MVFIKAQKPRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTAKYRFVVRSTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+S++IAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISSTIAGDIVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGL VGLTNYAAAYCTGLLLARR+L+  E+DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLTVGLTNYAAAYCTGLLLARRILKYRELDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF K QK+RAY+KRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFAKAQKSRAYYKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+ AS+AGD+++A+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMD+EYE
Sbjct  61   TAQIIHASMAGDIVVAAAYSHELPCYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
            A++K QKT+AY KR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKD++
Sbjct  4    AYVKAQKTKAYSKRYQVKFKRRREGKTDYRARTRLINQDKNKYNTPKYRLVARFTNKDLI  63

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV ASIAGD++LASAYA+ELPRYGLEVGLTNYAAAYC GLLLARR+L++LEMD EYEG
Sbjct  64   AQIVHASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDAEYEG  123

Query  422  NVEATGEDYSVEP  460
            NVEATGED++VEP
Sbjct  124  NVEATGEDFTVEP  136



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+ ++IAGD++LA+AY++ELP+YGLEVGLTNYAAAYCTGLLLARR+L+ L+MD EYE
Sbjct  61   TAQIIHSTIAGDIVLAAAYSHELPKYGLEVGLTNYAAAYCTGLLLARRVLKTLQMDGEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK+RAYFKRFQVKFKRRREGKTDYRAR R+INQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKAQKSRAYFKRFQVKFKRRREGKTDYRARIRMINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QIVSA+I GD +LA+AYA+ELP +GL+VGL+NYAAAYCTGLLL+RR+L+KLEMD+EYE
Sbjct  61   ICQIVSATITGDHVLAAAYAHELPHFGLDVGLSNYAAAYCTGLLLSRRVLKKLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+NK I
Sbjct  1    MAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSNKFI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQEYE
Sbjct  61   VAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GEDYSVEP
Sbjct  121  GNVEASGEDYSVEP  134



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRF+VRFTNKDI+
Sbjct  3    GFVKTQKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFIVRFTNKDII  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIVSASI GD+ILA+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   AQIVSASITGDIILAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRDLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M  +K QK +AYFKR+QVKF+RRREGKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MVIVKPQKKQAYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ+VSA+IAGD++LASAYA+ELPRYGL+VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQVVSATIAGDIVLASAYAHELPRYGLQVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GEDYSVEP
Sbjct  121  GNVEASGEDYSVEP  134



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKTQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKFRDLDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEA+GED+SVEP
Sbjct  121  GNVEASGEDFSVEP  134



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QK+RAY KRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI A
Sbjct  67   FVKAQKSRAYSKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITA  126

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QI+SA+I GDM+LASAY++ELP YGLE GLTNYAAAYCTGLLLARR+L+ LEMD EYEGN
Sbjct  127  QIISATITGDMVLASAYSHELPHYGLEAGLTNYAAAYCTGLLLARRVLKSLEMDSEYEGN  186

Query  425  VEATGEDYSVEP  460
            VEATGED+S+EP
Sbjct  187  VEATGEDFSIEP  198



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA++K QKT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAYVKAQKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNY-AAAYCTGlllarrllqklEMDQEY  415
             AQIVSASIAGD +LA+AYA ELP YGLEVGLTNY AAAYCTGLLLARR+L+KLEMD EY
Sbjct  61   TAQIVSASIAGDQVLAAAYARELPCYGLEVGLTNYAAAAYCTGLLLARRVLKKLEMDDEY  120

Query  416  EGNVEATGEDYSVEP  460
            EGNVEATGED+SVEP
Sbjct  121  EGNVEATGEDFSVEP  135



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGEDYSVEP
Sbjct  121  GNAEATGEDYSVEP  134



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKIRGLDKEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKF+RRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFRRRRQGKTDYRARLRLTNQDKNKYNTPKYRFVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
            AF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+
Sbjct  4    AFVKTQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDII  63

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQ++SASIAGD++LA+A  +ELPRYGLEVGLTNYAAAYC GLLLARR+L+ LEMD+EY+G
Sbjct  64   AQVISASIAGDLVLAAARTHELPRYGLEVGLTNYAAAYCAGLLLARRVLKMLEMDEEYQG  123

Query  422  NVEATGEDYSVEP  460
            N+EATG D+SVEP
Sbjct  124  NIEATGLDFSVEP  136



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQ++ ASIAGDM+LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EY+G
Sbjct  63   AQVIYASIAGDMVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYQG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGEDY+VEP
Sbjct  123  NVEATGEDYAVEP  135



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AY+KR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPHKSNAYYKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLSVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  K+ AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKSNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGED+SVEP
Sbjct  123  NVEATGEDFSVEP  135



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  13   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  72

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  73   QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  132

Query  425  VEATGEDYSVEP  460
             EATGEDYSVEP
Sbjct  133  AEATGEDYSVEP  144



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   188 bits (478),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QK++AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI+A
Sbjct  1    FVKSQKSKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIA  60

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSA+IAGD +LA+AY++EL  YGLEVGLTNYAAAYCTGLLL RR+L+KL++DQEY+GN
Sbjct  61   QIVSATIAGDRVLAAAYSHELRHYGLEVGLTNYAAAYCTGLLLGRRVLKKLDLDQEYKGN  120

Query  425  VEATGEDYSVEP  460
            VEATGEDYSVEP
Sbjct  121  VEATGEDYSVEP  132



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  41   SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  220
            SS    M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVR
Sbjct  16   SSPQQTMVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVR  75

Query  221  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  400
            FTNKDIVAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LE
Sbjct  76   FTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLE  135

Query  401  MDQEYEGNVEATGEDYSVEP  460
            MD EYEGN+EATGED+SVEP
Sbjct  136  MDDEYEGNLEATGEDFSVEP  155



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATG+D++VEP
Sbjct  121  GNVEATGDDFTVEP  134



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPHYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  31   MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  90

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  91   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  150

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  151  GNLEATGEDFSVEP  164



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  131  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  310
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKDIVAQI+SASIAGD++LA+AYA+ELP
Sbjct  28   EGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP  87

Query  311  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEP  460
            RYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGNVEATGEDYSVEP
Sbjct  88   RYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYEGNVEATGEDYSVEP  137



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKTRAYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYR VVRFTNKD+
Sbjct  1    MAFVKAQKTRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFTNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQ++ + I GD++LA+AY++ELP YGL+VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQVIHSRIVGDIVLAAAYSHELPCYGLDVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGEDYSVEP
Sbjct  121  GNTEATGEDYSVEP  134



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F++ QK  AY+KRFQV+FKRRR+GKTDYRAR RLINQ+KNKY+TPKYRFVVRFTNKDI
Sbjct  1    MGFVRTQKANAYYKRFQVQFKRRRDGKTDYRARIRLINQEKNKYSTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGDM+LASAY++ELPRYGLEVGL NYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  61   TAQIMSASIAGDMVLASAYSHELPRYGLEVGLANYAAAYCTGLLLARRVLKLRDLDQEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+ VEP
Sbjct  121  GNVEATGEDFCVEP  134



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  50   TAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTN  229
            T   AF+K  K+RAY KR+QVK+KRRR+GKTDYRAR RLINQDKNKYNTPKYR VVRF+N
Sbjct  79   TVYQAFVKALKSRAYSKRYQVKYKRRRDGKTDYRARIRLINQDKNKYNTPKYRIVVRFSN  138

Query  230  KDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQ  409
            K IVAQI+SASIAGD++LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+KLEMDQ
Sbjct  139  KFIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDQ  198

Query  410  EYEGNVEATGEDYSVEP  460
            EYEGNVEATGED+SVEP
Sbjct  199  EYEGNVEATGEDFSVEP  215



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR VVRF+NKD+
Sbjct  1    MVFVKAQKTRAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVVRFSNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ A++AGD+++A+AY+ ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD+EY 
Sbjct  61   VAQIIYATLAGDVVMAAAYSRELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDEEYV  120

Query  419  GNVEATGEDYSVEP  460
            GN EA+GEDYSVEP
Sbjct  121  GNEEASGEDYSVEP  134



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  36   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  95

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  96   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  155

Query  425  VEATGEDYSVEP  460
            +EATGED+SVEP
Sbjct  156  LEATGEDFSVEP  167



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
            AF+K+QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    AFVKLQKTHAYHKRFQVKFKRRRQGKTDYRARVRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
             QI  A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYEG
Sbjct  63   CQIAYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRDLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEA GEDYSVEP
Sbjct  123  NVEAAGEDYSVEP  135



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  8    FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  67

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  68   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  127

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  128  GNLEATGEDFSVEP  141



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA++K QK++AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MAYVKAQKSKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AY++ELP YGLEVGLTNYAAAYC GLLLARR+L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYSHELPHYGLEVGLTNYAAAYCVGLLLARRVLKQLEMDTEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATG+D++VEP
Sbjct  121  GNVEATGDDFTVEP  134



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EY 
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYG  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  11   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  70

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  71   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  130

Query  425  VEATGEDYSVEP  460
            +EATGED+SVEP
Sbjct  131  LEATGEDFSVEP  142



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
              F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  18   FVFVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  77

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  78   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  137

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  138  GNLEATGEDFSVEP  151



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   188 bits (478),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNV ATGED+S+EP
Sbjct  121  GNVVATGEDFSIEP  134



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVA
Sbjct  27   FVKPSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVA  86

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD+EYEGN
Sbjct  87   QIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDEEYEGN  146

Query  425  VEATGEDYSVEP  460
            +EATGED+SVEP
Sbjct  147  LEATGEDFSVEP  158



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSDKSNAYFKRYQVKFRRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASI GD++ ASAYA+ELP+YGL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIVGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYE
Sbjct  61   VAQIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYE  120

Query  419  GNVE----ATGEDYSVEP  460
            GN E    ATGEDYSVEP
Sbjct  121  GNAEVRLIATGEDYSVEP  138



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QK +AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYR+VVRFTNKDI+A
Sbjct  95   FVKPQKKQAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRYVVRFTNKDIIA  154

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIVSA+I GD++LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+LQ LEMD EYEGN
Sbjct  155  QIVSATITGDIVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLQMLEMDAEYEGN  214

Query  425  VEATGEDYSVEP  460
             EATGEDYSVEP
Sbjct  215  AEATGEDYSVEP  226



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGEDY VEP
Sbjct  123  NVEATGEDYYVEP  135



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K  K+ AYFKR+QVKF+RRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVFVKSCKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQIVSASIAGD++ ASAYA+ELP+YGL VGLTNYAAAYC GLLLARR+L+ LEMD EYE
Sbjct  61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCAGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN+EATGED+SVEP
Sbjct  121  GNLEATGEDFSVEP  134



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            N+EATGEDY VEP
Sbjct  123  NIEATGEDYYVEP  135



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AY+KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            N+EATGEDY VEP
Sbjct  123  NIEATGEDYYVEP  135



>emb|CBI38286.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   182 bits (462),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  53   APMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNK  232
            +PMAF+K QKTRAY KRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNK
Sbjct  27   SPMAFVKAQKTRAYSKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNK  86

Query  233  DIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQE  412
            DI AQI+SASIAGDM+LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+E
Sbjct  87   DITAQIISASIAGDMVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEE  146

Query  413  YEGNV  427
            Y+G +
Sbjct  147  YQGKL  151



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTKAYFKRFQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SASIAGD++LAS+YA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L++LEMD EYE
Sbjct  61   IAQIISASIAGDLVLASSYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKQLEMDSEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK + YFKR+QVKF+RRREGKTDYRAR RLINQDKNKYN+PK+R+VVRFTNKDI
Sbjct  1    MVFVKPQKKQPYFKRYQVKFRRRREGKTDYRARIRLINQDKNKYNSPKFRYVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QIVSA+I GD +LASAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IVQIVSATITGDNVLASAYAHELPRYGLKAGLTNYAAAYCTGLLLARRVLKMLEMDAEYE  120

Query  419  GNVEATGEDYSVEP  460
            GN EATGEDYSVEP
Sbjct  121  GNAEATGEDYSVEP  134



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  65

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  66   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  125

Query  422  NVEATGEDYSVEP  460
            NVEATGEDY VEP
Sbjct  126  NVEATGEDYYVEP  138



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLE GLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEAGLTNYAAAYCTGLLLARRVLKIRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGEDY VEP
Sbjct  123  NVEATGEDYYVEP  135



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED++VEP
Sbjct  118  GNVEATGEDFTVEP  131



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RF   DI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARF---DI  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+ ASI+GD++LA+AY +ELP YGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  58   IAQIIHASISGDIVLAAAYGHELPHYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  117

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  118  GNVEATGEDYSVEP  131



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
             AF+K QKT+AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   TNK+I
Sbjct  9    FAFVKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---TNKNI  65

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSASIAGD++LA+AY+ ELP+YGLEVGLTNYAAAYCTGLL+ARR+L++LEMD EYE
Sbjct  66   IAQIVSASIAGDIVLAAAYSYELPQYGLEVGLTNYAAAYCTGLLVARRVLKQLEMDGEYE  125

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  126  GNVEATGEDFSVEP  139



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  131  EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELP  310
            EGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSA+IAGD +LA+AYA+EL 
Sbjct  1    EGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSATIAGDRVLAAAYAHELR  60

Query  311  RYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEP  460
             YGLEVGLTNYAAAYCTGLLL RR+L KL++DQEYEGNVEATGEDYSVEP
Sbjct  61   HYGLEVGLTNYAAAYCTGLLLGRRVLNKLDLDQEYEGNVEATGEDYSVEP  110



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKT+AYFKRFQV +KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NKD+
Sbjct  1    MAFVKAQKTKAYFKRFQVPYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIVSA+IAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIVSANIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKMLEMDDEYQ  120

Query  419  GNVEA  433
            GNVE 
Sbjct  121  GNVEG  125



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRAR-NRLINQDKNKYNTPKYRFVVRFTNKD  235
            M  +K Q +R Y  R+QVK++RRR+GKTDYRAR  RLINQDKNKYNTPKYRFVVRFTNKD
Sbjct  1    MVLVKPQNSRPYSMRYQVKYRRRRDGKTDYRARIRRLINQDKNKYNTPKYRFVVRFTNKD  60

Query  236  IVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEY  415
            I AQ+VSASIAGD+ILA+AYA+ELP+YGL VGLTNY+AAYCTGLLLARR+L+  EMD EY
Sbjct  61   ITAQLVSASIAGDVILAAAYAHELPQYGLNVGLTNYSAAYCTGLLLARRVLKMFEMDAEY  120

Query  416  EGNVEATGEDYSVEP  460
            EGN+EA+GED+SVEP
Sbjct  121  EGNLEASGEDFSVEP  135



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK++AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKSKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIVSA+I GD +LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   IAQIVSANIVGDSVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE  120

Query  419  GNVEA  433
            GNVE 
Sbjct  121  GNVEG  125



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NKY TPKYR+VVR TNKDI
Sbjct  1    MAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANKYGTPKYRYVVRLTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGLLLARR+L+ LEMD EYE
Sbjct  61   VCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGLLLARRVLKTLEMDDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNV ATGEDYSVEP
Sbjct  121  GNVVATGEDYSVEP  134



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVFVKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++DQEYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKCRDLDQEYE  117

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  118  GNVEATGEDFSVEP  131



>tpg|DAA56365.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=149

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K  KT AYFKRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTHKTNAYFKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQI+SASIAGDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +D+EYEG
Sbjct  63   AQIISASIAGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTRGLDKEYEG  122

Query  422  NVEAT  436
            NVEA+
Sbjct  123  NVEAS  127



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   181 bits (460),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +2

Query  8    LSPQETPLRG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  187
            +S Q T  RG       MAF+K QK+ AYFKRFQVKFKRRREGKTDYRAR  LI QD NK
Sbjct  16   VSIQSTDSRG-RRCPFGMAFVKAQKSNAYFKRFQVKFKRRREGKTDYRARVSLITQDANK  74

Query  188  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  367
            Y TPKYR+VVR TNKDIV QIVSA+IAGD++LA+AYA+ELP++GL VGLTNYAAAYCTGL
Sbjct  75   YGTPKYRYVVRLTNKDIVCQIVSATIAGDIVLAAAYAHELPQFGLHVGLTNYAAAYCTGL  134

Query  368  llarrllqklEMDQEYEGNVEATGEDYSVEP  460
            LLARR+L+ LEMD EYEGNV ATGEDYSVEP
Sbjct  135  LLARRVLKTLEMDDEYEGNVVATGEDYSVEP  165



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QKT+AYFKR+QVKFKRRR+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MVYVKTQKTKAYFKRYQVKFKRRRQGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SASIAGD++LA+AYA+ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  61   IAQIISASIAGDLVLAAAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  121  GNVEATGEDFSVEP  134



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFV RFTNKDI
Sbjct  1    MPYVKAQKSKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRFVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+ ASI+GD++LA+AYA+ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   VAQIIHASISGDIVLAAAYAHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEA  433
            GNVE 
Sbjct  121  GNVEG  125



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 5/151 (3%)
 Frame = +2

Query  23   TPLRG*SSSTAP-----MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNK  187
            +PL   S   AP     M ++K QKT+AYFKRFQVKFKRRR+GKTDYRAR RLINQDKNK
Sbjct  12   SPLPPKSDLGAPKRGSAMVYVKTQKTKAYFKRFQVKFKRRRQGKTDYRARIRLINQDKNK  71

Query  188  YNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGl  367
            YNTPKYRFVVRFTNKDI+AQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGL
Sbjct  72   YNTPKYRFVVRFTNKDIIAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGL  131

Query  368  llarrllqklEMDQEYEGNVEATGEDYSVEP  460
            LLARR+L+ LEMD+EYEGNVEATGED+SVEP
Sbjct  132  LLARRVLKMLEMDEEYEGNVEATGEDFSVEP  162



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 122/134 (91%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  118  GNVEATGEDFSVEP  131



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI
Sbjct  1    MPFVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQIV ASI+GD++LA+AY +ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYE
Sbjct  61   IAQIVHASISGDIVLAAAYGHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYE  120

Query  419  GNVEAT  436
            GNVE  
Sbjct  121  GNVEGA  126



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K  KT+AYFKRFQVK+KRRREGKTDYRAR RLINQDKNKYNTPKYRFVVRF+NK I
Sbjct  1    MAFVKAHKTKAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKHI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            +AQI+SASIAGDMILA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEM+ EYE
Sbjct  61   IAQIISASIAGDMILAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMEDEYE  120

Query  419  GNVEATGEDYSVEP  460
            GNVEATGEDYSVEP
Sbjct  121  GNVEATGEDYSVEP  134



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 3/134 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M +IK QKTRAY KRFQVKFKRRR GKTDYRAR RL NQDKNKYNTPKYRFV   TNKD+
Sbjct  1    MVYIKNQKTRAYSKRFQVKFKRRRRGKTDYRARLRLTNQDKNKYNTPKYRFV---TNKDV  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D+EYE
Sbjct  58   TAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLDEEYE  117

Query  419  GNVEATGEDYSVEP  460
            GNVEATGED+SVEP
Sbjct  118  GNVEATGEDFSVEP  131



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   177 bits (449),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+K QKT+AYFKRFQV FKRRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MGFVKAQKTKAYFKRFQVPFKRRREGKTDYRARIRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SA+I GDM+LASAY++ELPRYGLEVGLTNYAAAYCTGLLL RR+L+ LEMD EY+
Sbjct  61   TAQIISANITGDMVLASAYSHELPRYGLEVGLTNYAAAYCTGLLLGRRVLKLLEMDDEYQ  120

Query  419  GNVEA  433
            GNVE 
Sbjct  121  GNVEG  125



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAF+K QKTRAY KRFQVKFKRRR GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFVKAQKTRAYSKRFQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
             AQI+SASIAGDM+LA+AY++ELP YGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EY+
Sbjct  61   TAQIISASIAGDMVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDEEYQ  120

Query  419  GNV  427
            G  
Sbjct  121  GKC  123



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  47   STAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFT  226
            + AP+ +IK QKTRAY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   T
Sbjct  2    AAAPV-YIKNQKTRAYSKRFQVKFKRRRQGKTDYRARLRLTNQDKNKYNTPKYRFV---T  57

Query  227  NKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMD  406
            NKD+ AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+  ++D
Sbjct  58   NKDVTAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKNRDLD  117

Query  407  QEYEGNVEATGEDYSVEP  460
            +EYEGNVEATGED+SVEP
Sbjct  118  EEYEGNVEATGEDFSVEP  135



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   FIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIVA  244
            F+K QKT+AYFKR+QVKFKRRREGKTDYRARNRLINQDKNKYNTPKYR V RFTNKDI+A
Sbjct  10   FVKAQKTKAYFKRYQVKFKRRREGKTDYRARNRLINQDKNKYNTPKYRLVARFTNKDIIA  69

Query  245  QIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEGN  424
            QIV ASI+GD++LA+AY +ELPRYGLEVGLTNYAAAYC GLLLARR L++LEMD EYEGN
Sbjct  70   QIVHASISGDIVLAAAYGHELPRYGLEVGLTNYAAAYCVGLLLARRTLKQLEMDAEYEGN  129

Query  425  VEAT  436
            VE  
Sbjct  130  VEGA  133



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 118/133 (89%), Gaps = 3/133 (2%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  6    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  422  NVEATGEDYSVEP  460
            NVEATGEDY VEP
Sbjct  123  NVEATGEDYYVEP  135



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  419  GNVEATGEDYSVE  457
            GN  ATGEDY+VE
Sbjct  121  GNETATGEDYNVE  133



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 3/133 (2%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AY KRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI 
Sbjct  3    GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT  59

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+   +DQEYEG
Sbjct  60   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEG  119

Query  422  NVEATGEDYSVEP  460
            N+EATGEDY VEP
Sbjct  120  NIEATGEDYYVEP  132



>ref|NP_001172693.1| Os01g0896620 [Oryza sativa Japonica Group]
 dbj|BAH91423.1| Os01g0896620 [Oryza sativa Japonica Group]
Length=128

 Score =   169 bits (428),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+K QKT AYFKRFQVKFKRRR+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI 
Sbjct  3    GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDIT  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
            AQIV A+IAGD+++A+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L    +DQEYEG
Sbjct  63   AQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEG  122

Query  422  NVE  430
            NVE
Sbjct  123  NVE  125



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRLVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  419  GNVEATGEDYSVE  457
            GN +ATGEDY+VE
Sbjct  121  GNEQATGEDYNVE  133



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYR+VVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRYVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  E+DQEY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNFELDQEYV  120

Query  419  GNVEATGEDYSVE  457
            GN  ATGEDY+VE
Sbjct  121  GNETATGEDYNVE  133



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MAFIK  KT+AYFKRFQVK+KRRR GKTDYRAR RL  QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MAFIKPNKTKAYFKRFQVKYKRRRAGKTDYRARIRLTTQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A++AGD++L SAYA+ELPRYGL+ GLTNYAAAYCTGLLLARR L+  ++D EY 
Sbjct  61   VAQITYATLAGDIVLTSAYAHELPRYGLKGGLTNYAAAYCTGLLLARRHLKNYDLDDEYV  120

Query  419  GNVEATGEDYSVE  457
            GN +ATGEDY+VE
Sbjct  121  GNEQATGEDYNVE  133



>gb|KHN36791.1| 60S ribosomal protein L5 [Glycine soja]
Length=240

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 117/124 (94%), Gaps = 3/124 (2%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++K QK++AYFKR+QVKFKRRREGKTDYRAR RLINQDKNKYNTPKYRFV   +NKDI
Sbjct  1    MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFV---SNKDI  57

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI+SASIAGD++LA+AY++ELPRYGLEVGLTNYAAAYCTGLLLARR+L+ LEMD+EYE
Sbjct  58   VAQIISASIAGDLVLATAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKTLEMDEEYE  117

Query  419  GNVE  430
            GNVE
Sbjct  118  GNVE  121



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  161  RLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTN  340
            RLINQDKNKYNTPKYRFVVRF+NKDIVAQI SASI GD +LASAYA+ELPRYGLEVGLTN
Sbjct  30   RLINQDKNKYNTPKYRFVVRFSNKDIVAQITSASITGDTVLASAYAHELPRYGLEVGLTN  89

Query  341  YAAAYCTGlllarrllqklEMDQEYEGNVEATGEDYSVEP  460
            YAAAYCTGLLLARRLL+ LEMD+EYEGNVEATGED+SVEP
Sbjct  90   YAAAYCTGLLLARRLLKMLEMDEEYEGNVEATGEDFSVEP  129



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  419  GNVEATGEDYSVE  457
            GN +  GEDY+VE
Sbjct  121  GNTDVNGEDYNVE  133



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            MA  + QK+++Y+KR+QVK++RRREGKTDYRAR RL NQDKNKYNTPKYRFVVRF+NKDI
Sbjct  1    MAVARAQKSKSYYKRYQVKYRRRREGKTDYRARVRLTNQDKNKYNTPKYRFVVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A+IAGD+I+A+AYA+ELPRYGL+VGLTNYAAAYCTGLLLARRLL K+ M   YE
Sbjct  61   VAQIAYATIAGDVIMAAAYAHELPRYGLKVGLTNYAAAYCTGLLLARRLLTKMGMADIYE  120

Query  419  GNVEATGEDYSVE  457
            GN +  GEDY+VE
Sbjct  121  GNTDVNGEDYNVE  133



>gb|ACN25149.1| ribosomal-like protein [Pectinaria gouldii]
Length=269

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +2

Query  62   AFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIV  241
             F+KVQKT AYF R+QVKFKRRREGKTDY AR RLI QDKNKYNTPKYR +VRFTNKDI+
Sbjct  3    GFVKVQKTTAYFSRYQVKFKRRREGKTDYFARKRLICQDKNKYNTPKYRLIVRFTNKDII  62

Query  242  AQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYEG  421
             QI  A IAGD I+ SAYA+ELPRYGL+VGLTNY+AAYCTGLL+ARR+L+KL +DQ YE 
Sbjct  63   TQIAYARIAGDFIICSAYAHELPRYGLKVGLTNYSAAYCTGLLMARRVLKKLNLDQVYEV  122

Query  422  NVEATGEDYSVEP  460
            N E   E+Y VEP
Sbjct  123  NTEVQ-EEYHVEP  134



>dbj|BAJ07363.1| Tt5 protein [Hydatigera taeniaeformis]
Length=162

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYRFVVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRFVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QI+ A + GD ++A+AY++ELPRYG++VGLTNY AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVMATAYSHELPRYGVKVGLTNYPAAYCTGLLLARRVLKKLKLDGMYQ  120

Query  419  GNVEATGEDYSVE  457
            G  E  GE+Y VE
Sbjct  121  GQTEVNGENYLVE  133



>ref|XP_005345167.1| PREDICTED: 60S ribosomal protein L5-like [Microtus ochrogaster]
Length=136

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QV+F+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLA RLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLACRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+V 
Sbjct  121  GQVEVTGDEYNVH  133



>ref|XP_005889093.1| PREDICTED: 60S ribosomal protein L5-like [Bos mutus]
Length=149

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RR+EGKTDY AR RL+ QDKNKY+TPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRQEGKTDYYARKRLVIQDKNKYHTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYAHIEGDMIVGAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_004310188.1| PREDICTED: 60S ribosomal protein L5-2-like [Fragaria vesca subsp. 
vesca]
Length=171

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +2

Query  173  QDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAA  352
            +DKNKYNTPKYRFVV FTNKDIVAQI+S++I+GD++LASAY++ELPRYGL VGLTNYAA+
Sbjct  14   KDKNKYNTPKYRFVVCFTNKDIVAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAAS  73

Query  353  YCTGlllarrllqklEMDQEYEGNVEATGEDYSVEP  460
            YCTGLLLARR L+KLEMD+EYEGN+EATGED+SVEP
Sbjct  74   YCTGLLLARRTLKKLEMDEEYEGNLEATGEDFSVEP  109



>ref|XP_010948703.1| PREDICTED: 60S ribosomal protein L5 [Camelus bactrianus]
Length=329

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  32   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  211
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  24   RGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  83

Query  212  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  391
            VVR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  84   VVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  143

Query  392  klEMDQEYEGNVEATGEDYSVE  457
            +  MD+ YEG VE TG++Y+VE
Sbjct  144  RFGMDKIYEGQVEVTGDEYNVE  165



>gb|ACO09732.1| 60S ribosomal protein L5 [Osmerus mordax]
Length=176

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QI  A I GDMI+ +AY++ELP+YG+ VGLTNYAAAYCTGLL+ARRLL K  +D+ YE
Sbjct  61   VCQIAYAKIEGDMIVCAAYSHELPKYGIAVGLTNYAAAYCTGLLVARRLLNKFGLDKVYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++++VE
Sbjct  121  GQVEVTGDEFNVE  133



>ref|XP_005359733.1| PREDICTED: 60S ribosomal protein L5 [Microtus ochrogaster]
Length=259

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QV+F+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYANELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYANELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_008049787.1| PREDICTED: 60S ribosomal protein L5, partial [Tarsius syrichta]
Length=199

 Score =   155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GD+I+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL    MD+ YE
Sbjct  61   ICQIAYARIEGDVIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNSFGMDKTYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>gb|AAO25760.1| ribosomal protein L5b [Ictalurus punctatus]
Length=226

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QI  A I GD I+ +AY++ELPRYG+ VGLTNYAAAYCTGLLLARRLL K  +D+ YE
Sbjct  61   VCQIAYAKIEGDAIVCAAYSHELPRYGVSVGLTNYAAAYCTGLLLARRLLNKFNLDKVYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TGE+++VE
Sbjct  121  GQVEVTGEEFNVE  133



>gb|ACI70102.1| 60S ribosomal protein L5 [Salmo salar]
Length=164

 Score =   153 bits (386),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K++AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct  1    MGFVKVVKSKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
              QI  A I GD I+A+AY++ELP+YG+ VGLTNYAAAYCTGLLLARRLL K  +DQ YE
Sbjct  61   CCQIAYAKIEGDQIVAAAYSHELPKYGITVGLTNYAAAYCTGLLLARRLLNKFGLDQVYE  120

Query  419  GNVEATGEDYSV  454
            G VE TG++++V
Sbjct  121  GQVEVTGDEFNV  132



>ref|XP_010973953.1| PREDICTED: 60S ribosomal protein L5 [Camelus dromedarius]
Length=376

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  32   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  211
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  71   RGLGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  130

Query  212  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  391
            VVR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  131  VVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  190

Query  392  klEMDQEYEGNVEATGEDYSVE  457
            +  MD+ YEG VE TG++Y+VE
Sbjct  191  RFGMDKIYEGQVEVTGDEYNVE  212



>ref|XP_011283311.1| PREDICTED: 60S ribosomal protein L5 [Felis catus]
Length=364

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  32   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  211
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  59   RGRRSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  118

Query  212  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  391
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  119  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  178

Query  392  klEMDQEYEGNVEATGEDYSVE  457
            +  MD+ YEG VE TG++Y+VE
Sbjct  179  RFGMDKIYEGQVEVTGDEYNVE  200



>ref|XP_005969822.1| PREDICTED: 60S ribosomal protein L5-like [Pantholops hodgsonii]
Length=259

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_005107604.1| PREDICTED: 60S ribosomal protein L5-like [Aplysia californica]
Length=294

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K++AYFKRFQVKFKRRREG TDY AR RLI QDKNKYNTPKYR +VRF+NKDI
Sbjct  1    MGFVKVVKSKAYFKRFQVKFKRRREGVTDYYARKRLIFQDKNKYNTPKYRLIVRFSNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QI  A I GD+I+ +AYA+ELPRYG++VGLTNYAAAYCTGLLLARRLL+K  +DQ YE
Sbjct  61   VCQIAYARIEGDVIVCAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLKKFGLDQTYE  120

Query  419  GNVEATGEDYSVE  457
            G VE  GE++ VE
Sbjct  121  GQVEPDGEEFCVE  133



>emb|CDQ68843.1| unnamed protein product [Oncorhynchus mykiss]
Length=212

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  41   SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVR  220
            S  ++P  F+KV K++AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR
Sbjct  6    SHLSSPQGFVKVVKSKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVR  65

Query  221  FTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklE  400
            F+N+DI  QI  A I GD I+A+AY++EL +YG+ VGLTNY AAYCTGLLLA RLL K  
Sbjct  66   FSNRDICCQIAYAKIEGDQIVAAAYSHELLKYGITVGLTNYVAAYCTGLLLASRLLNKFG  125

Query  401  MDQEYEGNVEATGEDYSVE  457
            +DQ YEG VE TG++++VE
Sbjct  126  LDQVYEGQVEVTGDEFNVE  144



>ref|XP_008152973.1| PREDICTED: 60S ribosomal protein L5 [Eptesicus fuscus]
Length=381

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  32   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  211
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  107  RGRGSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  166

Query  212  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  391
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  167  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  226

Query  392  klEMDQEYEGNVEATGEDYSVE  457
            +  MD+ YEG VE TG++Y++E
Sbjct  227  RFGMDKIYEGQVEVTGDEYNME  248



>ref|XP_006197385.1| PREDICTED: 60S ribosomal protein L5 [Vicugna pacos]
Length=297

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR VVR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMVVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>gb|ABN14903.1| 60S ribosomal protein L5A [Taenia asiatica]
Length=166

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYR VVRFTNKDI
Sbjct  1    MGLVKVTKNKAYFKRFQVKFRRRREGKTDYYARKRLIWQDKNKYNTPKYRSVVRFTNKDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QI+ A + GD ++A+AY++ELPRYG+++GLTNY AAYCTGLLLARR+L+KL++D  Y+
Sbjct  61   VCQIIYACMDGDRVMATAYSHELPRYGVKIGLTNYPAAYCTGLLLARRVLKKLKLDSMYQ  120

Query  419  GNVEATGEDYSVE  457
            G  E  GE+Y VE
Sbjct  121  GQTEVNGENYLVE  133



>ref|XP_007073490.1| PREDICTED: 60S ribosomal protein L5-like [Panthera tigris altaica]
Length=423

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  32   RG*SSSTAPMAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRF  211
            RG  S    M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR 
Sbjct  118  RGRRSLFRRMGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM  177

Query  212  VVRFTNKDIVAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllq  391
            +VR TN+DI+ QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL 
Sbjct  178  IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN  237

Query  392  klEMDQEYEGNVEATGEDYSVE  457
            +  MD+ YEG VE TG++Y+VE
Sbjct  238  RFGMDKIYEGQVEVTGDEYNVE  259



>gb|KHJ46023.1| ribosomal L18p/L5e family protein [Trichuris suis]
Length=305

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRR+GKTDY+AR  L+ QDKNKYNTPKYR +VR TNKD+
Sbjct  1    MGFLKVVKNKAYFKRYQVKFRRRRQGKTDYQARRFLVVQDKNKYNTPKYRLIVRITNKDV  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            VAQI  A I GD++L SAY++ELPRYG++VGLTNYAAAYCTGLLLARR L+K  +D  Y+
Sbjct  61   VAQIAYAKIGGDVVLTSAYSHELPRYGVKVGLTNYAAAYCTGLLLARRHLKKRNLDSVYK  120

Query  419  GNVEATGEDYSVE  457
            G  EATGEDY+VE
Sbjct  121  GVEEATGEDYNVE  133



>gb|AFM74205.1| ribosomal protein L5 [Spirometra erinaceieuropaei]
Length=300

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M  +KV K +AYFKRFQVKF+RRREGKTDY AR RLI QDKNKYNTPKYR VVRFTN+DI
Sbjct  1    MGLVKVVKNKAYFKRFQVKFRRRREGKTDYFARKRLIWQDKNKYNTPKYRLVVRFTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            V QIV A + GD +L SAY++ELPRYG++VGLTNY AAYCTGLLLARR+L +L++D  YE
Sbjct  61   VCQIVYARMDGDRVLCSAYSHELPRYGVKVGLTNYPAAYCTGLLLARRVLAQLKLDGLYE  120

Query  419  GNVEATGEDYSVE  457
            G  E TGE+Y VE
Sbjct  121  GQKEVTGEEYHVE  133



>ref|XP_001689859.1| ribosomal protein L5, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09597.1| ribosomal protein L5 [Chlamydomonas reinhardtii]
Length=293

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M ++KV KT  YF RFQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR VVRFTN+DI
Sbjct  1    MGYVKVIKTSPYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
              QIV ++I GD++ A+AYA+ELP YGLE GLTNYAA YC GLL+ARR+L K  +D+ Y 
Sbjct  61   TCQIVRSTIKGDIVEAAAYAHELPDYGLECGLTNYAACYCVGLLVARRILTKFGLDKHYP  120

Query  419  GNVEATGEDYSVEP  460
            G  E  GEDY++EP
Sbjct  121  GQTEPDGEDYNIEP  134



>ref|XP_004699318.1| PREDICTED: 60S ribosomal protein L5 [Echinops telfairi]
Length=297

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_004884145.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004841319.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Heterocephalus 
glaber]
Length=296

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_006728911.1| PREDICTED: 60S ribosomal protein L5 [Leptonychotes weddellii]
Length=297

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_004884144.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004841318.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Heterocephalus 
glaber]
Length=297

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



>ref|XP_004002245.1| PREDICTED: 60S ribosomal protein L5 [Ovis aries]
Length=298

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  59   MAFIKVQKTRAYfkrfqvkfkrrrEGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI  238
            M F+KV K +AYFKR+QVKF+RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct  1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI  60

Query  239  VAQIVSASIAGDMILASAYANELPRYGLEVGLTNYAAAYCTGlllarrllqklEMDQEYE  418
            + QI  A I GDMI+ +AYA+ELP+YG++VGLTNYAAAYCTGLLLARRLL +  MD+ YE
Sbjct  61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE  120

Query  419  GNVEATGEDYSVE  457
            G VE TG++Y+VE
Sbjct  121  GQVEVTGDEYNVE  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535