BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001C04

Length=354
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     147   1e-38   Nicotiana sylvestris
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               147   1e-38   Nicotiana tabacum [American tobacco]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    147   2e-38   
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    147   3e-38   
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     145   1e-37   Solanum tuberosum [potatoes]
emb|CDP16685.1|  unnamed protein product                                144   3e-37   Coffea canephora [robusta coffee]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          144   4e-37   Solanum lycopersicum
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     142   1e-36   Nicotiana tomentosiformis
gb|KDO43322.1|  hypothetical protein CISIN_1g0039661mg                  131   1e-35   Citrus sinensis [apfelsine]
ref|XP_002300101.1|  Chloride channel protein CLC-a                     139   1e-35   Populus trichocarpa [western balsam poplar]
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         139   2e-35   Jatropha curcas
ref|XP_010111585.1|  Chloride channel protein CLC-b                     139   2e-35   Morus notabilis
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     139   3e-35   Sesamum indicum [beniseed]
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          138   4e-35   Populus euphratica
gb|KJB76409.1|  hypothetical protein B456_012G087500                    137   9e-35   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    137   9e-35   Gossypium raimondii
ref|XP_008365471.1|  PREDICTED: chloride channel protein CLC-a-like     127   1e-34   
gb|KJB76408.1|  hypothetical protein B456_012G087500                    136   2e-34   Gossypium raimondii
ref|XP_008353449.1|  PREDICTED: chloride channel protein CLC-b-like     129   2e-34   
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             134   7e-34   Citrus clementina [clementine]
ref|XP_002509531.1|  chloride channel clc, putative                     134   1e-33   Ricinus communis
ref|XP_007031848.1|  Chloride channel B isoform 2                       133   2e-33   
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     133   3e-33   Fragaria vesca subsp. vesca
gb|KHN10806.1|  Chloride channel protein CLC-b                          133   3e-33   Glycine soja [wild soybean]
gb|KHN01525.1|  Chloride channel protein CLC-b                          133   3e-33   Glycine soja [wild soybean]
ref|NP_001236494.1|  chloride channel                                   133   3e-33   
ref|XP_007031850.1|  Chloride channel B isoform 4                       132   4e-33   
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             131   1e-32   Prunus persica
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          131   1e-32   Prunus mume [ume]
emb|CDY11722.1|  BnaC06g13300D                                          130   2e-32   Brassica napus [oilseed rape]
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     130   2e-32   
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             130   2e-32   Phaseolus vulgaris [French bean]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     130   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    130   2e-32   Vitis vinifera
ref|NP_001268190.1|  uncharacterized protein LOC100260066               130   2e-32   Vitis vinifera
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             130   3e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             129   4e-32   Capsella rubella
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    129   6e-32   Glycine max [soybeans]
emb|CAN82189.1|  hypothetical protein VITISV_031114                     129   6e-32   Vitis vinifera
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          129   6e-32   Eucalyptus grandis [rose gum]
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     129   6e-32   
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    129   6e-32   Glycine max [soybeans]
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     129   6e-32   
gb|KHN24330.1|  Chloride channel protein CLC-b                          129   7e-32   Glycine soja [wild soybean]
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     129   8e-32   Brassica rapa
emb|CDX67478.1|  BnaA07g15180D                                          129   8e-32   
ref|XP_002875360.1|  CLC-B                                              129   8e-32   
ref|NP_189353.1|  chloride channel protein CLC-b                        129   8e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          128   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        128   9e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         128   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     128   1e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001267676.1|  chloride channel protein CLC-b-like                128   1e-31   Cucumis sativus [cucumbers]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          128   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          128   1e-31   Camelina sativa [gold-of-pleasure]
gb|AAB17007.1|  voltage-gated chloride channel                          128   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    127   2e-31   Gossypium raimondii
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          127   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             127   3e-31   Phaseolus vulgaris [French bean]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     127   3e-31   Cucumis melo [Oriental melon]
dbj|BAJ33828.1|  unnamed protein product                                124   3e-31   Eutrema halophilum
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          127   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          127   3e-31   Brassica rapa
emb|CDX83663.1|  BnaC07g24030D                                          127   3e-31   
emb|CDY13685.1|  BnaA06g32380D                                          127   3e-31   Brassica napus [oilseed rape]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    127   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             127   4e-31   Phaseolus vulgaris [French bean]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    126   5e-31   Camelina sativa [gold-of-pleasure]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    126   8e-31   Arabis alpina [alpine rockcress]
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             125   1e-30   Capsella rubella
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     125   1e-30   Sesamum indicum [beniseed]
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     125   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    125   2e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    124   3e-30   Arabis alpina [alpine rockcress]
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                124   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    124   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDX99630.1|  BnaC04g33870D                                          124   3e-30   
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          124   3e-30   Brassica rapa
emb|CDY15925.1|  BnaA04g11860D                                          124   3e-30   Brassica napus [oilseed rape]
gb|AES75065.2|  ClC chloride channel family protein                     124   5e-30   Medicago truncatula
ref|XP_003618847.1|  Chloride channel protein CLC-a                     124   5e-30   
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             123   6e-30   Eutrema salsugineum [saltwater cress]
gb|ADD09860.1|  chloride channel A                                      123   6e-30   Eutrema halophilum
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     123   9e-30   
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     122   1e-29   Cicer arietinum [garbanzo]
emb|CDY34173.1|  BnaA02g28670D                                          121   3e-29   Brassica napus [oilseed rape]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     121   3e-29   Brassica rapa
emb|CDY28488.1|  BnaC02g36720D                                          121   3e-29   Brassica napus [oilseed rape]
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                120   5e-29   Erythranthe guttata [common monkey flower]
ref|XP_002868624.1|  ATCLC-A                                            120   7e-29   
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     119   1e-28   
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     117   6e-28   Solanum tuberosum [potatoes]
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     116   2e-27   Tarenaya hassleriana [spider flower]
gb|EEC69203.1|  hypothetical protein OsI_38196                          107   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    113   3e-26   Setaria italica
gb|KEH22046.1|  ClC chloride channel family protein                     113   3e-26   Medicago truncatula
dbj|BAJ92499.1|  predicted protein                                      112   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      112   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96369.1|  predicted protein                                      112   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...    113   4e-26   
gb|EMT23598.1|  hypothetical protein F775_52599                         111   7e-26   
gb|EMS65031.1|  Chloride channel protein CLC-b                          110   7e-26   Triticum urartu
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          112   9e-26   Sorghum bicolor [broomcorn]
dbj|BAJ91019.1|  predicted protein                                      111   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     111   1e-25   Oryza brachyantha
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     110   3e-25   Brachypodium distachyon [annual false brome]
gb|EEE53145.1|  hypothetical protein OsJ_35963                          110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183936.1|  chloride channel protein                           109   8e-25   Zea mays [maize]
gb|AFW87644.1|  hypothetical protein ZEAMMB73_318834                    105   8e-25   
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     108   9e-25   Zea mays [maize]
gb|EMT27070.1|  Chloride channel protein CLC-b                          107   9e-25   
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     108   2e-24   Solanum lycopersicum
ref|XP_006848424.1|  hypothetical protein AMTR_s00013p00233520        97.1    6e-23   
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like   93.6    2e-19   Phoenix dactylifera
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like   93.2    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like   92.8    4e-19   Elaeis guineensis
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like   91.3    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...  90.1    4e-18   Eucalyptus grandis [rose gum]
gb|ADD09861.1|  chloride channel C                                    89.7    4e-18   Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg           89.7    4e-18   Eutrema salsugineum [saltwater cress]
gb|KDP42489.1|  hypothetical protein JCGZ_00286                       89.7    4e-18   Jatropha curcas
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like   89.4    6e-18   
ref|NP_001268053.1|  uncharacterized protein LOC100245380             89.4    7e-18   Vitis vinifera
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...  89.4    7e-18   Vitis vinifera
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg              89.4    7e-18   Erythranthe guttata [common monkey flower]
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like   89.0    8e-18   
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like   89.0    9e-18   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI29647.3|  unnamed protein product                              88.6    1e-17   Vitis vinifera
emb|CDO97645.1|  unnamed protein product                              88.6    1e-17   Coffea canephora [robusta coffee]
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c        88.6    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like   88.2    2e-17   Solanum lycopersicum
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like   88.2    2e-17   Oryza brachyantha
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like   88.2    2e-17   Setaria italica
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like   87.8    2e-17   Nicotiana sylvestris
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like   87.8    2e-17   Nicotiana tomentosiformis
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c        87.8    3e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001275140.1|  chloride channel protein CLC-c-like              87.4    3e-17   Solanum tuberosum [potatoes]
gb|ADF30876.1|  chloride channel protein                              87.4    3e-17   Citrus trifoliata [hardy orange]
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg           87.4    3e-17   Capsella rubella
ref|XP_002865761.1|  CLC-C                                            87.4    4e-17   
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like   87.0    4e-17   Nicotiana tomentosiformis
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...  87.0    4e-17   Nelumbo nucifera [Indian lotus]
ref|NP_199800.1|  chloride channel protein CLC-c                      87.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c        87.0    5e-17   Tarenaya hassleriana [spider flower]
gb|EEC77341.1|  hypothetical protein OsI_16021                        84.3    5e-17   Oryza sativa Indica Group [Indian rice]
dbj|BAB97268.1|  chloride channel                                     86.7    5e-17   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97961.1|  predicted protein                                    86.7    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like   86.7    5e-17   Nicotiana sylvestris
dbj|BAJ92873.1|  predicted protein                                    86.7    6e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960        86.3    7e-17   Amborella trichopoda
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like   86.3    8e-17   
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c        86.3    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like   86.3    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like   86.3    8e-17   Camelina sativa [gold-of-pleasure]
gb|KDP30234.1|  hypothetical protein JCGZ_17016                       86.3    8e-17   Jatropha curcas
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                  86.3    9e-17   Zea mays [maize]
ref|NP_001105216.1|  LOC542114                                        86.3    9e-17   Zea mays [maize]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c        86.3    9e-17   Brassica rapa
emb|CDX83179.1|  BnaA03g23270D                                        86.3    9e-17   
emb|CDX91539.1|  BnaC02g16210D                                        86.3    9e-17   
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c        86.3    9e-17   Brassica rapa
emb|CDY21447.1|  BnaC03g27500D                                        86.3    9e-17   Brassica napus [oilseed rape]
ref|XP_006381102.1|  chloride channel-like family protein             86.3    9e-17   
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...  86.3    9e-17   Nicotiana tomentosiformis
ref|XP_002530769.1|  chloride channel clc, putative                   85.9    1e-16   Ricinus communis
ref|NP_001267998.1|  uncharacterized protein LOC100255837             85.9    1e-16   Vitis vinifera
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...  85.9    1e-16   Vitis vinifera
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg           85.9    1e-16   Eutrema salsugineum [saltwater cress]
emb|CAN62616.1|  hypothetical protein VITISV_036165                   85.9    1e-16   Vitis vinifera
ref|XP_006388251.1|  hypothetical protein POPTR_0261s002202g          82.0    1e-16   
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...  85.5    1e-16   Populus euphratica
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...  85.5    2e-16   Citrus sinensis [apfelsine]
gb|EEE60792.1|  hypothetical protein OsJ_14377                        85.1    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c        85.1    2e-16   
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg           85.1    2e-16   
gb|EEC73409.1|  hypothetical protein OsI_07665                        85.1    2e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAB97267.1|  chloride channel                                     85.1    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94258.1|  hypothetical protein OsI_16029                        85.1    2e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAB97269.1|  chloride channel                                     85.1    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890        85.1    2e-16   Sorghum bicolor [broomcorn]
dbj|BAD16425.1|  chloride channel                                     85.1    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like   85.1    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like   85.1    2e-16   Oryza brachyantha
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...  85.1    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like   85.1    2e-16   Solanum tuberosum [potatoes]
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                  85.1    2e-16   
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...  84.7    3e-16   Brassica rapa
emb|CDY47559.1|  BnaA08g07280D                                        84.7    3e-16   Brassica napus [oilseed rape]
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c        84.7    3e-16   
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c        84.3    4e-16   Solanum lycopersicum
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like   84.3    4e-16   Populus euphratica
gb|EMT27046.1|  Chloride channel protein CLC-c                        84.3    4e-16   
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570        84.0    5e-16   Sorghum bicolor [broomcorn]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                 84.0    5e-16   Citrus sinensis [apfelsine]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg           84.0    5e-16   Citrus clementina [clementine]
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...  83.6    6e-16   Sesamum indicum [beniseed]
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  83.6    6e-16   
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...  83.6    7e-16   
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg           83.6    7e-16   Prunus persica
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...  83.6    7e-16   
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    7e-16   Pyrus x bretschneideri [bai li]
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    8e-16   Brachypodium distachyon [annual false brome]
gb|ADW93911.1|  chloride channel 1                                    83.6    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...  83.2    8e-16   Eucalyptus grandis [rose gum]
emb|CDY12393.1|  BnaC08g08120D                                        83.2    8e-16   Brassica napus [oilseed rape]
emb|CBI27719.3|  unnamed protein product                              83.2    8e-16   Vitis vinifera
gb|EPS68170.1|  hypothetical protein M569_06601                       83.2    8e-16   Genlisea aurea
ref|NP_001268085.1|  uncharacterized protein LOC100259734             83.2    9e-16   Vitis vinifera
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like   83.2    9e-16   Brachypodium distachyon [annual false brome]
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...  83.2    1e-15   Prunus mume [ume]
gb|KJB64678.1|  hypothetical protein B456_010G060300                  82.8    1e-15   Gossypium raimondii
gb|EMS67360.1|  Chloride channel protein CLC-c                        82.4    2e-15   Triticum urartu
ref|XP_006389435.1|  chloride channel-like family protein             82.4    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_003592890.1|  Chloride channel protein CLC-c                   82.0    2e-15   Medicago truncatula
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like   82.0    2e-15   Populus euphratica
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576           82.0    2e-15   
ref|NP_198313.2|  putative chloride channel-like protein CLC-g        82.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099780.1|  Chloride channel protein CLC-c                   82.0    2e-15   Morus notabilis
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like   81.6    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...  81.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...  81.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                  81.6    4e-15   Arabis alpina [alpine rockcress]
ref|XP_007048601.1|  Chloride channel C                               81.6    4e-15   
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...  81.6    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT13398.1|  Chloride channel protein CLC-c                        80.9    4e-15   
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...  81.3    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...  81.3    4e-15   Phoenix dactylifera
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like   81.3    5e-15   Populus euphratica
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like   81.3    5e-15   Populus euphratica
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                   80.9    5e-15   Eucalyptus grandis [rose gum]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...  80.9    6e-15   Phoenix dactylifera
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                 80.9    6e-15   Citrus sinensis [apfelsine]
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c        80.9    6e-15   Fragaria vesca subsp. vesca
emb|CDP10469.1|  unnamed protein product                              80.9    6e-15   Coffea canephora [robusta coffee]
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...  80.9    6e-15   Eucalyptus grandis [rose gum]
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg           80.9    7e-15   
ref|XP_006385193.1|  Chloride channel protein CLC-c                   80.5    8e-15   
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...  80.5    8e-15   Nicotiana sylvestris
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like   80.5    8e-15   Populus euphratica
gb|KJB40520.1|  hypothetical protein B456_007G067500                  80.1    9e-15   Gossypium raimondii
gb|KJB40519.1|  hypothetical protein B456_007G067500                  80.1    9e-15   Gossypium raimondii
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g          80.1    1e-14   Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...  80.1    1e-14   Glycine max [soybeans]
gb|AIY56605.1|  CLC                                                   80.1    1e-14   Arachis hypogaea [goober]
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like   80.1    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...  80.1    1e-14   Elaeis guineensis
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like   80.1    1e-14   Eucalyptus grandis [rose gum]
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...  80.1    1e-14   
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...  80.1    1e-14   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...  80.1    1e-14   
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...  80.1    1e-14   
ref|XP_008378937.1|  PREDICTED: chloride channel protein CLC-c-li...  76.3    1e-14   
ref|XP_008365341.1|  PREDICTED: chloride channel protein CLC-c-like   76.6    1e-14   
ref|XP_006385076.1|  Chloride channel protein CLC-c                   79.7    1e-14   
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg           79.7    2e-14   
emb|CDM85188.1|  unnamed protein product                              79.3    2e-14   Triticum aestivum [Canadian hard winter wheat]
gb|KDP44103.1|  hypothetical protein JCGZ_05570                       79.0    2e-14   Jatropha curcas
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g           79.0    3e-14   Phaseolus vulgaris [French bean]
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...  79.0    3e-14   Phoenix dactylifera
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...  79.0    3e-14   Phoenix dactylifera
ref|XP_008378936.1|  PREDICTED: chloride channel protein CLC-c-li...  75.5    3e-14   
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                78.6    3e-14   Medicago truncatula
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...  78.6    3e-14   Populus euphratica
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...  78.6    4e-14   Populus euphratica
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like   78.6    4e-14   
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...  78.6    4e-14   Sesamum indicum [beniseed]
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...  78.2    5e-14   Solanum tuberosum [potatoes]
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g           78.2    5e-14   Phaseolus vulgaris [French bean]
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like   78.2    5e-14   
gb|EPS73799.1|  hypothetical protein M569_00956                       78.2    5e-14   Genlisea aurea
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...  78.2    5e-14   Solanum lycopersicum
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  77.8    6e-14   Cucumis melo [Oriental melon]
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...  77.8    6e-14   Camelina sativa [gold-of-pleasure]
gb|EMS50378.1|  Chloride channel protein CLC-c                        77.8    8e-14   Triticum urartu
gb|EMS55037.1|  Chloride channel protein CLC-c                        77.8    8e-14   Triticum urartu
gb|EMT28663.1|  Chloride channel protein CLC-c                        77.8    8e-14   
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  77.4    8e-14   
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...  77.4    9e-14   
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...  77.4    9e-14   
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...  77.4    9e-14   
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg              77.4    1e-13   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg           77.4    1e-13   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...  77.0    1e-13   
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...  77.0    1e-13   
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...  77.0    1e-13   
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...  76.6    2e-13   
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...  76.6    2e-13   
gb|KJB53990.1|  hypothetical protein B456_009G015100                  76.3    2e-13   
gb|ADF78069.1|  chloride channel protein                              76.3    2e-13   
tpg|DAA56573.1|  TPA: chloride channel protein                        76.3    2e-13   
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c        76.3    2e-13   
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like   76.3    2e-13   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  76.3    2e-13   
gb|KEH32756.1|  chloride channel ClC1 protein                         76.3    2e-13   
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...  76.3    2e-13   
gb|EEC71893.1|  hypothetical protein OsI_04638                        75.9    3e-13   
dbj|BAD82092.1|  putative chloride channel                            75.9    3e-13   
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like   75.9    3e-13   
gb|EEE55755.1|  hypothetical protein OsJ_04269                        75.9    3e-13   
gb|AES75975.2|  chloride channel ClC1 protein                         75.9    3e-13   
ref|XP_003619757.1|  Chloride channel protein CLC-c                   75.9    3e-13   
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g     75.9    3e-13   
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...  75.9    3e-13   
ref|XP_001756485.1|  predicted protein                                75.5    4e-13   
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480        75.5    4e-13   
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...  75.5    5e-13   
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...  75.1    5e-13   
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...  75.1    5e-13   
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...  75.1    5e-13   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like   75.1    6e-13   
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like   75.1    6e-13   
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270        74.7    9e-13   
gb|KJB46914.1|  hypothetical protein B456_008G001200                  73.6    2e-12   
emb|CAD41919.2|  OSJNBa0033G05.20                                     73.2    3e-12   
emb|CAJ86158.1|  H0413E07.11                                          73.2    3e-12   
gb|ABB86548.1|  chloride channel-like protein Osclc                   73.2    3e-12   
gb|EEE61792.1|  hypothetical protein OsJ_16396                        73.2    3e-12   
gb|ACF87782.1|  unknown                                               70.9    3e-12   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...  72.8    3e-12   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...  72.8    3e-12   
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...  72.8    4e-12   
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...  72.8    4e-12   
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530        72.8    4e-12   
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g          72.4    4e-12   
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g          72.4    5e-12   
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...  72.0    6e-12   
gb|AAQ56538.1|  putative chloride channel                             72.0    7e-12   
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...  71.6    9e-12   
gb|KHM99790.1|  Chloride channel protein CLC-c                        71.6    1e-11   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...  71.6    1e-11   
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...  71.6    1e-11   
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...  71.2    1e-11   
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...  71.2    1e-11   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...  71.2    1e-11   
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...  70.9    2e-11   
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...  70.5    2e-11   
gb|AFW70590.1|  hypothetical protein ZEAMMB73_498282                  67.4    2e-11   
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1         70.5    3e-11   
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870            70.5    3e-11   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...  70.1    3e-11   
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...  70.1    3e-11   
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...  69.7    4e-11   
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906           69.7    4e-11   
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...  69.7    4e-11   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...  69.7    4e-11   
gb|KDO43323.1|  hypothetical protein CISIN_1g0039661mg                65.5    7e-11   
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...  68.9    7e-11   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...  68.2    1e-10   
gb|KHG13135.1|  Chloride channel CLC-b -like protein                  68.2    1e-10   
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899           68.2    2e-10   
ref|XP_002885387.1|  hypothetical protein ARALYDRAFT_898491           64.3    2e-10   
dbj|BAJ97313.1|  predicted protein                                    67.4    2e-10   
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250        66.6    4e-10   
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g          66.6    4e-10   
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g          66.2    6e-10   
gb|KHF97413.1|  Chloride channel CLC-b -like protein                  64.7    2e-09   
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870            64.7    2e-09   
tpg|DAA35720.1|  TPA: chloride channel G                              64.7    2e-09   
ref|NP_001130407.2|  chloride channel G                               64.7    2e-09   
gb|KEH25446.1|  ClC chloride channel family protein                   63.5    4e-09   
ref|XP_004173256.1|  PREDICTED: chloride channel protein CLC-c-like   58.5    2e-08   
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632           59.7    9e-08   
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560           59.7    9e-08   
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...  55.8    2e-06   
ref|XP_002980983.1|  hypothetical protein SELMODRAFT_420553           52.4    2e-05   
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...  50.4    1e-04   



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   147 bits (372),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 79/99 (80%), Positives = 81/99 (82%), Gaps = 5/99 (5%)
 Frame = +3

Query  63   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  236
            MEE  +  E AT   M GQ  EEE  RDPESNSLHQPLL KRN TLSSSP A+VGAKVSH
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLHQPLL-KRNRTLSSSPFALVGAKVSH  57

Query  237  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFL
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFL  96



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   147 bits (372),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 79/99 (80%), Positives = 81/99 (82%), Gaps = 5/99 (5%)
 Frame = +3

Query  63   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  236
            MEE  +  E AT   M GQ  EEE  RDPESNSLHQPLL KRN TLSSSP A+VGAKVSH
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLHQPLL-KRNRTLSSSPFALVGAKVSH  57

Query  237  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFL
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFL  96



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   147 bits (371),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 81/102 (79%), Gaps = 6/102 (6%)
 Frame = +3

Query  57   SRMEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAK  227
            S MEE   QYAE+A    M    E    ERDPES +LHQPLLLKRN TLSS+PLAMVGAK
Sbjct  2    SPMEEHSNQYAEAAVPQTM---QETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAK  58

Query  228  VSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            VSHIESLDYEINENDLF HDWRSR++ QVLQYVFLKW LAFL
Sbjct  59   VSHIESLDYEINENDLFMHDWRSRTKVQVLQYVFLKWILAFL  100



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   147 bits (370),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 81/102 (79%), Gaps = 6/102 (6%)
 Frame = +3

Query  57   SRMEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAK  227
            S MEE   QYAE+A    M    E    ERDPES +LHQPLLLKRN TLSS+PLAMVGAK
Sbjct  2    SPMEEHSNQYAEAAVPQTM---QETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAK  58

Query  228  VSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            VSHIESLDYEINENDLF HDWRSR++ QVLQYVFLKW LAFL
Sbjct  59   VSHIESLDYEINENDLFMHDWRSRTKVQVLQYVFLKWILAFL  100



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   145 bits (365),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 77/98 (79%), Positives = 81/98 (83%), Gaps = 4/98 (4%)
 Frame = +3

Query  63   MEEQ-YAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  239
            MEEQ   E ATT  + GQ  EEE  RDPESNS+ QPLL KRN TLSSSP A+VGAKVSHI
Sbjct  1    MEEQRLVEEATTNDINGQLNEEE--RDPESNSMRQPLL-KRNRTLSSSPFALVGAKVSHI  57

Query  240  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            ESLDYEINENDLFKHDWR RSR QVLQYVFLKW+LAFL
Sbjct  58   ESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWSLAFL  95



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   144 bits (363),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 3/94 (3%)
 Frame = +3

Query  72   QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLD  251
            Q+A +A T  + GQA+ +E  RDPESNSLHQPLL KRN TLSS+PLA+VGAKVS+IESLD
Sbjct  6    QFAAAAVTNDVDGQAQNQE--RDPESNSLHQPLL-KRNRTLSSNPLAVVGAKVSYIESLD  62

Query  252  YEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            YEINENDLFKHDWRSR++ QVLQYVFLKWTLAFL
Sbjct  63   YEINENDLFKHDWRSRAQVQVLQYVFLKWTLAFL  96



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   144 bits (362),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 77/98 (79%), Positives = 81/98 (83%), Gaps = 4/98 (4%)
 Frame = +3

Query  63   MEE-QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  239
            MEE +  E ATT  + GQ  EEE  RDPESNSL QPLL KRN TLSSSP A+VGAKVSHI
Sbjct  1    MEEPRLVEEATTNDINGQLNEEE--RDPESNSLRQPLL-KRNRTLSSSPFALVGAKVSHI  57

Query  240  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            ESLDYEINENDLFKHDWR RSR QVLQYVFLKW+LAFL
Sbjct  58   ESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWSLAFL  95



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   142 bits (358),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 77/99 (78%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +3

Query  63   MEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  236
            MEE  +  E AT   M GQ  EEE  RDPESNSL QPLL KRN TLSSSP A+VGAKVS+
Sbjct  1    MEEPTRLVEEATINNMDGQQNEEE--RDPESNSLRQPLL-KRNRTLSSSPFALVGAKVSY  57

Query  237  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            IESLDYEINENDLFKHDWR RSR QVLQYVFLKWTLAFL
Sbjct  58   IESLDYEINENDLFKHDWRRRSRVQVLQYVFLKWTLAFL  96



>gb|KDO43322.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=188

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESNSL QPLL KR+ TLSSSPLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  23   RDPESNSLQQPLL-KRSRTLSSSPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  81

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW+LA L
Sbjct  82   LQYIFLKWSLACL  94



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   139 bits (351),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN+LHQPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  24   RDPESNTLHQPLL-KRNRTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  82

Query  315  LQYVFLKWTLAFL  353
            LQY+F KWTLAFL
Sbjct  83   LQYIFWKWTLAFL  95



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   139 bits (350),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 74/100 (74%), Positives = 81/100 (81%), Gaps = 5/100 (5%)
 Frame = +3

Query  63   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE   Q AE   T+  +   E  E ERDPESN+L QPLL KRN TLSS+PLA+VGAKVS
Sbjct  1    MEETSTQLAEEQATV-QSHNTEAGEDERDPESNTLQQPLL-KRNRTLSSNPLALVGAKVS  58

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            HIESLDYEINENDLFKHDWRSRS+ QVLQY+FLKWTLAFL
Sbjct  59   HIESLDYEINENDLFKHDWRSRSQIQVLQYIFLKWTLAFL  98



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   139 bits (350),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +3

Query  63   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE   QYAE+A  I        +  ERDPESNSL +PLL KRN TLSSSPLA+VG KVS
Sbjct  1    MEENSKQYAETA--IPQVEAETVDLEERDPESNSLTRPLL-KRNRTLSSSPLAIVGTKVS  57

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            HIESLDYEINENDLFKHDWRSRSR QVLQYVFLKWTLA L
Sbjct  58   HIESLDYEINENDLFKHDWRSRSRAQVLQYVFLKWTLACL  97



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   139 bits (349),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN+LHQPLL KRN TLSSSPLA+VGAKVSHIESLDYEINENDLFK DWRSRS+T+V
Sbjct  25   RDPESNTLHQPLL-KRNRTLSSSPLAIVGAKVSHIESLDYEINENDLFKQDWRSRSKTEV  83

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  84   LQYIFLKWLLAFL  96



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   138 bits (347),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN+LH+PLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  24   RDPESNALHKPLL-KRNTTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  82

Query  315  LQYVFLKWTLAFL  353
            LQY+F KWTLAFL
Sbjct  83   LQYIFWKWTLAFL  95



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   137 bits (345),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW+LAFL
Sbjct  87   LQYIFLKWSLAFL  99



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   137 bits (345),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW+LAFL
Sbjct  87   LQYIFLKWSLAFL  99



>ref|XP_008365471.1| PREDICTED: chloride channel protein CLC-a-like [Malus domestica]
Length=117

 Score =   127 bits (318),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPES SL QPLL KRN TLSS+PLAMVGAKVSHIESLDYEINEN LFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRNRTLSSTPLAMVGAKVSHIESLDYEINENXLFKHDWRSRSKVQV  83

Query  315  LQYVFLKWTLAFL  353
            LQYVFLKW LA L
Sbjct  84   LQYVFLKWILACL  96



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   136 bits (343),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESNSL QPLL KRN TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  28   RDPESNSLRQPLL-KRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQV  86

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW+LAFL
Sbjct  87   LQYIFLKWSLAFL  99



>ref|XP_008353449.1| PREDICTED: chloride channel protein CLC-b-like [Malus domestica]
Length=196

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPES SL QPLL KRN TLSS+PLAMVGAKVSHIESLDYEINEN LFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRNRTLSSTPLAMVGAKVSHIESLDYEINENXLFKHDWRSRSKVQV  83

Query  315  LQYVFLKWTLAFL  353
            LQYVFLKW LA L
Sbjct  84   LQYVFLKWILACL  96



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   134 bits (338),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +3

Query  81   ESATTIAMAGQaeeee--aeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDY  254
            E++  +A A QA  E    ERDPESNSL QPLL KR+ TLSSSPLA+VGAKVSHIESLDY
Sbjct  3    ENSNPVARATQAHMEADEEERDPESNSLQQPLL-KRSRTLSSSPLALVGAKVSHIESLDY  61

Query  255  EINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            EINENDLFKHDWRSRS+ QVLQY+FLKW+LA L
Sbjct  62   EINENDLFKHDWRSRSKVQVLQYIFLKWSLACL  94



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   134 bits (336),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESNSL QPLL KRN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS  Q+
Sbjct  26   RDPESNSLQQPLL-KRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSNVQI  84

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  85   LQYIFLKWILAFL  97



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 1/71 (1%)
 Frame = +3

Query  141  PESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  320
            PESNSL +PLL KRN TLSSSPLA+VGAKVSHIESLDYEINEND+FKHDWRSRS+ QVLQ
Sbjct  28   PESNSLGEPLL-KRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQ  86

Query  321  YVFLKWTLAFL  353
            Y+FLKWTLAFL
Sbjct  87   YIFLKWTLAFL  97



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   133 bits (334),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 67/94 (71%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  63   MEEQYAESATTIAMAG--QaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSH  236
            MEE    SA++ A+    +   E  ERD ESNSL QPLLLKRN TLSS+PLA+VGAKVSH
Sbjct  1    MEEHLKHSASSAAIPQSIEGVVESEERDLESNSLIQPLLLKRNRTLSSNPLALVGAKVSH  60

Query  237  IESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  338
            IESLDYEINENDLFKHDWRSRS+ QVLQY+ LKW
Sbjct  61   IESLDYEINENDLFKHDWRSRSKVQVLQYILLKW  94



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   133 bits (334),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN L++PLLLKR  TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  11   DPESNPLNEPLLLKRTRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  70

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  71   QYIFLKWLLAFL  82



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   133 bits (334),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN L++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSRTQV
Sbjct  26   RDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRTQV  84

Query  315  LQYVFLKWTLAFL  353
            LQY+F KWTLAFL
Sbjct  85   LQYIFWKWTLAFL  97



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   133 bits (334),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN L++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSRTQV
Sbjct  26   RDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRTQV  84

Query  315  LQYVFLKWTLAFL  353
            LQY+F KWTLAFL
Sbjct  85   LQYIFWKWTLAFL  97



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   132 bits (333),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 1/71 (1%)
 Frame = +3

Query  141  PESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  320
            PESNSL +PLL KRN TLSSSPLA+VGAKVSHIESLDYEINEND+FKHDWRSRS+ QVLQ
Sbjct  26   PESNSLGEPLL-KRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQ  84

Query  321  YVFLKWTLAFL  353
            Y+FLKWTLAFL
Sbjct  85   YIFLKWTLAFL  95



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   131 bits (329),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPES SL QPLL +RN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  29   RDPESISLSQPLL-RRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSKVQV  87

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  88   LQYIFLKWILAFL  100



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   131 bits (329),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPES SL QPLL +RN TLSSSPLA+VGAKVS+IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  29   RDPESISLSQPLL-RRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDWRSRSKVQV  87

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  88   LQYIFLKWILAFL  100



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+TQVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKTQVL  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLAFL
Sbjct  80   QYIFAKWTLAFL  91



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPES SL QPLL KR+ TLSS+PLAMVGAKVSHIESLDYEINENDLFKHDWRSRS+ QV
Sbjct  25   RDPESISLQQPLL-KRSRTLSSTPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSKVQV  83

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LA L
Sbjct  84   LQYIFLKWILACL  96



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  63   MEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIE  242
            M E+ +    + +M     EE  ERDPESN L++PLL KRN TLSS+PLA+VGAKVS+IE
Sbjct  1    MSEESSLLKGSTSMNDTMVEEVEERDPESNPLNEPLL-KRNRTLSSNPLALVGAKVSYIE  59

Query  243  SLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            SLDYEINENDLFK DWRSRSR QVLQY+F KW+LAFL
Sbjct  60   SLDYEINENDLFKQDWRSRSRAQVLQYIFWKWSLAFL  96



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESNSL QPLL KR+ TL+SS  AMVGAKVSHIESLDYEINENDLFKHDWRSRS T+VL
Sbjct  25   DPESNSLQQPLL-KRSPTLTSSHYAMVGAKVSHIESLDYEINENDLFKHDWRSRSSTEVL  83

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLAFL
Sbjct  84   QYIFLKWTLAFL  95



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +3

Query  63   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE   Q AE+ TT   + +   E  ERD ESN L+QPLL KR+ TLSS+PLA+VGAKVS
Sbjct  1    MEEDPSQVAETTTTTTSSVEGVGEGEERDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVS  59

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            HIESLDYEINENDLFKHDWRSRS  QVLQY+FLKW+LAFL
Sbjct  60   HIESLDYEINENDLFKHDWRSRSSAQVLQYIFLKWSLAFL  99



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +3

Query  63   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE   Q AE+ TT   + +   E  ERD ESN L+QPLL KR+ TLSS+PLA+VGAKVS
Sbjct  1    MEEDPSQVAETTTTTTSSVEGVGEGEERDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVS  59

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            HIESLDYEINENDLFKHDWRSRS  QVLQY+FLKW+LAFL
Sbjct  60   HIESLDYEINENDLFKHDWRSRSSAQVLQYIFLKWSLAFL  99



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   130 bits (326),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  19   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKTQVL  77

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  78   QYIFLKWTLACL  89



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   129 bits (325),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPE+N+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QV
Sbjct  19   RDPENNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQV  77

Query  315  LQYVFLKWTLAFL  353
            LQYVFLKWTLA L
Sbjct  78   LQYVFLKWTLACL  90



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  87   QYIFLKWLLAFL  98



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RD ESN L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS  QV
Sbjct  23   RDLESNPLNQPLL-KRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKHDWRSRSSAQV  81

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW+LAFL
Sbjct  82   LQYIFLKWSLAFL  94



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 72/100 (72%), Positives = 84/100 (84%), Gaps = 6/100 (6%)
 Frame = +3

Query  63   MEE---QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE   + AE ++   MAG+ +EEE +   ESNSL+QPLL +R+ TLSS+PLAMVGAKV+
Sbjct  2    MEEDPNRVAEESSPNGMAGEEDEEERDP--ESNSLNQPLL-RRHRTLSSNPLAMVGAKVA  58

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            HIESLDYEINENDLFKHDWRSRS+ QVLQYVFLKWTLAFL
Sbjct  59   HIESLDYEINENDLFKHDWRSRSKVQVLQYVFLKWTLAFL  98



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            +DPES+SLHQPLL KR  TL++  LAMVGAK+SHIESLDYEINENDLFKHDWRSRS  QV
Sbjct  27   QDPESHSLHQPLL-KRTPTLTTHHLAMVGAKISHIESLDYEINENDLFKHDWRSRSSVQV  85

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKWTLAFL
Sbjct  86   LQYIFLKWTLAFL  98



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  87   QYIFLKWLLAFL  98



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   129 bits (324),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            +DPESNSLHQPLL  R  TL+++ LAMVGAKVSHIESLDYEINENDLFKHDWRSRS  QV
Sbjct  27   QDPESNSLHQPLL-GRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWRSRSSVQV  85

Query  315  LQYVFLKWTLAFL  353
            LQYVFLKWTL FL
Sbjct  86   LQYVFLKWTLVFL  98



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   129 bits (323),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  11   DPESNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  69

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  70   QYIFLKWLLAFL  81



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   129 bits (323),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVL  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLAFL
Sbjct  80   QYIFAKWTLAFL  91



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   129 bits (323),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QVL
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVL  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLAFL
Sbjct  80   QYIFAKWTLAFL  91



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   129 bits (323),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  79   QYVFLKWTLACL  90



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   129 bits (323),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  21   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVL  79

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  80   QYVFLKWTLACL  91



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   128 bits (322),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   128 bits (322),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPESN L+QPLL KRN TLSSSPLA+VGAKVS IESLDYEINENDLFKHDWRSRS+ QV
Sbjct  26   RDPESNPLNQPLL-KRNRTLSSSPLAIVGAKVSLIESLDYEINENDLFKHDWRSRSKVQV  84

Query  315  LQYVFLKWTLAFL  353
            LQY+F KWTLA L
Sbjct  85   LQYIFSKWTLACL  97



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   128 bits (321),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  22   DPENNTLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVF  80

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  81   QYIFLKWTLACL  92



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = +3

Query  135  RDPESNS-LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  311
            RDPESNS L +PLL KRN TLSS+PLA+VGA VSHIESLDYEINENDLFKHDWRSRS+ Q
Sbjct  26   RDPESNSSLSEPLL-KRNRTLSSNPLALVGATVSHIESLDYEINENDLFKHDWRSRSKVQ  84

Query  312  VLQYVFLKWTLAFL  353
            VLQY+FLKWTLAFL
Sbjct  85   VLQYIFLKWTLAFL  98



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   127 bits (320),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R+ ESN LHQ LL KR+ TL S+PLAMVGAKV+H+ESLDYEINENDLFKHDWRSRSR QV
Sbjct  10   REVESNYLHQTLL-KRSPTLPSNPLAMVGAKVTHMESLDYEINENDLFKHDWRSRSRIQV  68

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKWTLAFL
Sbjct  69   LQYIFLKWTLAFL  81



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   127 bits (319),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE N L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPEGNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  87   QYIFLKWLLAFL  98



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   127 bits (319),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +3

Query  63   MEEQ---YAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVS  233
            MEE      ES  T +M  + +EEE  RDPESN L+QPLL KR+ TLSSSPLA+VGAKVS
Sbjct  1    MEENPSFVTESTLTNSMEAEPQEEE--RDPESNPLNQPLL-KRSRTLSSSPLAIVGAKVS  57

Query  234  HIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
             IESLDYEINENDLFKHDWRSRS+ QVLQY+F KWTLA L
Sbjct  58   LIESLDYEINENDLFKHDWRSRSKVQVLQYIFSKWTLACL  97



>dbj|BAJ33828.1| unnamed protein product [Thellungiella halophila]
Length=363

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  79   QYVFLKWTLACL  90



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   127 bits (318),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  79   QYVFLKWTLACL  90



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   127 bits (318),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE N L++PLL KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKHDWRSRSR QVL
Sbjct  28   DPEGNPLNEPLL-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSRSRVQVL  86

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  87   QYIFLKWLLAFL  98



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   126 bits (317),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  79   QYVFLKWTLACL  90



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   126 bits (316),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VGAKVS+IESLDYEINENDLFKHDWR RS+ QVL
Sbjct  19   DPESNTLNQPLV-KANRTLSSTPLALVGAKVSYIESLDYEINENDLFKHDWRKRSKAQVL  77

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  78   QYVFLKWTLACL  89



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 2/73 (3%)
 Frame = +3

Query  138  DPESN-SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            DPE+N +L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+TQV
Sbjct  23   DPENNMALNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQV  81

Query  315  LQYVFLKWTLAFL  353
             QY+FLKWTLA L
Sbjct  82   FQYIFLKWTLACL  94



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   125 bits (314),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            N+LHQPLL KRN TLSSSPLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QVLQY+F
Sbjct  30   NNLHQPLL-KRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKQDWRSRSRVQVLQYIF  88

Query  330  LKWTLAFL  353
            LKW LAFL
Sbjct  89   LKWLLAFL  96



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   125 bits (313),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +3

Query  78   AESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYE  257
            +E A+T +M  +A       D ESN LHQPLL KRN TLS+S LAMVGAKVS+IESLDYE
Sbjct  24   SELASTPSMEAEAVANGDA-DLESNVLHQPLL-KRNRTLSASHLAMVGAKVSYIESLDYE  81

Query  258  INENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            INENDLFK DWRSRS+ QVLQYVFLKW LAFL
Sbjct  82   INENDLFKQDWRSRSKVQVLQYVFLKWKLAFL  113



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   125 bits (313),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 68/105 (65%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +3

Query  39   DLRVSASRMEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMV  218
            DL  S+ ++  Q  E+     + G+A       D ESNSLHQPLL K N TLS++ LAMV
Sbjct  43   DLNDSSEQVTLQSMEADAETLVNGEA------EDLESNSLHQPLL-KGNRTLSANHLAMV  95

Query  219  GAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            GAKVSHIESLDYEINENDLFK DWRSRS+ QVLQYVFLKW LAFL
Sbjct  96   GAKVSHIESLDYEINENDLFKQDWRSRSKMQVLQYVFLKWKLAFL  140



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   124 bits (312),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN L+ PLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+TQV 
Sbjct  21   DPESNILNTPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKTQVF  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   124 bits (312),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+LH+PLL K N TLSS+ LA+VG KVSHIESLDYEINENDLFK DWRSRS+ QVL
Sbjct  29   DPESNTLHEPLL-KVNRTLSSNQLAIVGGKVSHIESLDYEINENDLFKQDWRSRSKVQVL  87

Query  318  QYVFLKWTLAFL  353
            QY+FLKW LAFL
Sbjct  88   QYIFLKWLLAFL  99



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   124 bits (312),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESL+YEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLNYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLA  347
            QYVFLKWTLA
Sbjct  79   QYVFLKWTLA  88



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+L+QPL+ K N TLSS+PLA+VG KVSHIESL+YEINENDLFKHDWR RS+ QVL
Sbjct  20   DPESNTLNQPLV-KANRTLSSTPLALVGTKVSHIESLNYEINENDLFKHDWRKRSKAQVL  78

Query  318  QYVFLKWTLA  347
            QYVFLKWTLA
Sbjct  79   QYVFLKWTLA  88



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVF  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   124 bits (310),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPE N +++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QV
Sbjct  21   RDPERNPMNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQV  79

Query  315  LQYVFLKWTLAFL  353
            +QY+ LKW LAFL
Sbjct  80   MQYIILKWLLAFL  92



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   124 bits (310),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RDPE N +++PLL KRN TLSS+PLA+VGAKVS+IESLDYEINENDLFK DWRSRSR QV
Sbjct  21   RDPERNPMNEPLL-KRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQV  79

Query  315  LQYVFLKWTLAFL  353
            +QY+ LKW LAFL
Sbjct  80   MQYIILKWLLAFL  92



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   123 bits (309),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   123 bits (309),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE+N+++QPLL KR+ TLSS+PLA+VG KVSHIESLDYEINENDLFKHDWRSRS+ QV 
Sbjct  21   DPENNTMNQPLL-KRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKAQVY  79

Query  318  QYVFLKWTLAFL  353
            QY+F KWTLA L
Sbjct  80   QYIFAKWTLACL  91



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   123 bits (308),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPE NSLHQPLL KR  TL+++ LAMVGAKVSHIESLDYEINEND+FKHDW SRS  QVL
Sbjct  29   DPERNSLHQPLL-KRTATLTTNHLAMVGAKVSHIESLDYEINENDIFKHDWTSRSSVQVL  87

Query  318  QYVFLKWTLAFL  353
            QYVFLKW  AFL
Sbjct  88   QYVFLKWMSAFL  99



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   122 bits (307),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 2/73 (3%)
 Frame = +3

Query  138  DPES-NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            DPES NSL+QPL+ KRN TLSS+PLA+VG KVS+IESLDYEINENDLFKH WRSRSR +V
Sbjct  26   DPESSNSLNQPLI-KRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHGWRSRSRIEV  84

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  85   LQYIFLKWLLAFL  97



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   121 bits (304),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   121 bits (304),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   121 bits (304),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D ESN+L+QPL+ K N  LSS+PLA+VG KVSHIESLDYEINENDLFKHDWR RS+TQVL
Sbjct  23   DAESNTLNQPLV-KANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKTQVL  81

Query  318  QYVFLKWTLAFL  353
            QY+FLKWT A L
Sbjct  82   QYIFLKWTFACL  93



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   120 bits (302),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/73 (79%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            RD  SN+LHQ LL KRN TLSS+ LA VG KVSHIESLDYEINENDLFK DWRSRS+ QV
Sbjct  24   RDCSSNNLHQSLL-KRNRTLSSNQLAFVGTKVSHIESLDYEINENDLFKQDWRSRSKVQV  82

Query  315  LQYVFLKWTLAFL  353
            LQY+FLKW LAFL
Sbjct  83   LQYIFLKWLLAFL  95



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   120 bits (301),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 1/67 (1%)
 Frame = +3

Query  153  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            +L+QPLL KR+ TLSS+PLA+VGAKVSHIESLDYEINENDLFKHDWRSRS+TQV QY+FL
Sbjct  28   TLNQPLL-KRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQVFQYIFL  86

Query  333  KWTLAFL  353
            KWTLA L
Sbjct  87   KWTLACL  93



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            S SLHQPLL KR  TL+++ LAMVGAKVSHIESLDYEINENDLFKHDWRSRS  QVLQYV
Sbjct  31   SISLHQPLL-KRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWRSRSSVQVLQYV  89

Query  327  FLKWTLAFL  353
            FLKW LAFL
Sbjct  90   FLKWMLAFL  98



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   117 bits (294),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 71/101 (70%), Gaps = 11/101 (11%)
 Frame = +3

Query  63   MEEQ--YAESATTIAMA--GQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKV  230
            MEE   +AE AT I M   GQ   EE     ESN L       RN TLSS+ +A+VGAKV
Sbjct  1    MEEPNGFAEVATIIDMELEGQHNNEEERESTESNYL-------RNRTLSSTSVAIVGAKV  53

Query  231  SHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            SHIESLDYEINENDLFKHDWR RSR Q LQYVF+KWTLAFL
Sbjct  54   SHIESLDYEINENDLFKHDWRKRSRLQTLQYVFIKWTLAFL  94



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNL-TLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            DPE+N+++Q  LLKR+  TLSS+PLA+VGA VS IESLDYEINENDLFKHDWRSR +TQV
Sbjct  20   DPENNAVNQQPLLKRHTRTLSSTPLALVGANVSKIESLDYEINENDLFKHDWRSRKKTQV  79

Query  315  LQYVFLKWTLAFL  353
            +QY+FLKW LA L
Sbjct  80   IQYIFLKWALACL  92



>gb|EEC69203.1| hypothetical protein OsI_38196 [Oryza sativa Indica Group]
Length=140

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            +SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDWR RS  +VLQY+F
Sbjct  39   SSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIF  97

Query  330  LKWTLAFL  353
            LKW +AFL
Sbjct  98   LKWAMAFL  105



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 7/78 (9%)
 Frame = +3

Query  138  DPES------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  299
            DPES      +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  36   DPESTAGNGISSLEQPLL-KRSPTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSR  94

Query  300  SRTQVLQYVFLKWTLAFL  353
            S  +VLQY+FLKW +AFL
Sbjct  95   SNVEVLQYIFLKWAMAFL  112



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            DPESN+     L+KR+ TLSSSPLA+VG KVS+IESLDYE NENDLFK  WRSRSR +VL
Sbjct  33   DPESNNPLNQRLIKRSRTLSSSPLALVGEKVSYIESLDYETNENDLFKDGWRSRSRIEVL  92

Query  318  QYVFLKWTLAFL  353
            QY+F+KW LAFL
Sbjct  93   QYIFMKWVLAFL  104



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 6/77 (8%)
 Frame = +3

Query  138  DPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS
Sbjct  30   DPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRS  88

Query  303  RTQVLQYVFLKWTLAFL  353
              +VLQY+FLKW+LAFL
Sbjct  89   NVEVLQYIFLKWSLAFL  105



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 6/77 (8%)
 Frame = +3

Query  138  DPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS
Sbjct  30   DPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRS  88

Query  303  RTQVLQYVFLKWTLAFL  353
              +VLQY+FLKW+LAFL
Sbjct  89   NVEVLQYIFLKWSLAFL  105



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 6/77 (8%)
 Frame = +3

Query  138  DPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS
Sbjct  30   DPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRS  88

Query  303  RTQVLQYVFLKWTLAFL  353
              +VLQY+FLKW+LAFL
Sbjct  89   NVEVLQYIFLKWSLAFL  105



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 7/78 (9%)
 Frame = +3

Query  138  DPES------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSR  299
            DPES      +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSR
Sbjct  36   DPESTAGNGISSLEQPLL-KRSPTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSR  94

Query  300  SRTQVLQYVFLKWTLAFL  353
            S  +VLQY+FLKW +AFL
Sbjct  95   SNVEVLQYIFLKWAMAFL  112



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   111 bits (278),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 6/77 (8%)
 Frame = +3

Query  138  DPES-----NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            DP S     +SL +PLL KR+ TL+SS LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS
Sbjct  30   DPGSAGDGISSLEKPLL-KRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRS  88

Query  303  RTQVLQYVFLKWTLAFL  353
              +VLQY+FLKW+LAFL
Sbjct  89   NVEVLQYIFLKWSLAFL  105



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 75/103 (73%), Gaps = 13/103 (13%)
 Frame = +3

Query  63   MEEQYAESATTIAMAGQaeee-eaeRDPES-----NSLHQPLLLKRNLTLSSSPLAMVGA  224
            MEE   E+ATT   AG+  ++     DP S     +SL QPLL K N TL+++ LAMVGA
Sbjct  1    MEE---ETATT---AGRKHDDGVDSEDPGSAGNGISSLEQPLLKKSN-TLTANHLAMVGA  53

Query  225  KVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            KVSHIESLDYEI ENDLFKHDWRSRS  +VLQYVFLKW LAFL
Sbjct  54   KVSHIESLDYEIIENDLFKHDWRSRSTVEVLQYVFLKWALAFL  96



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   112 bits (279),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 11/82 (13%)
 Frame = +3

Query  138  DPES----------NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHD  287
            DPES          +SL QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHD
Sbjct  39   DPESTGGGGDGNGISSLEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHD  97

Query  288  WRSRSRTQVLQYVFLKWTLAFL  353
            WRSRS  +VLQY+FLKW +AFL
Sbjct  98   WRSRSNVEVLQYIFLKWAMAFL  119



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   111 bits (278),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            +SL QPLL KR+ TL+++ LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQYVF
Sbjct  34   SSLQQPLL-KRSNTLTANHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRSTVEVLQYVF  92

Query  330  LKWTLAFL  353
            LKW LAFL
Sbjct  93   LKWALAFL  100



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 62/77 (81%), Gaps = 6/77 (8%)
 Frame = +3

Query  138  DPESN-----SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            DPES      SL QPLL KR+ TL++S LAMVGAKVS IESLDYEI ENDLFKHDWRSRS
Sbjct  29   DPESTGGPITSLEQPLL-KRSNTLTASHLAMVGAKVSRIESLDYEIIENDLFKHDWRSRS  87

Query  303  RTQVLQYVFLKWTLAFL  353
              +VLQY+FLKW +AFL
Sbjct  88   NVEVLQYIFLKWAMAFL  104



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   110 bits (275),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 62/80 (78%), Gaps = 9/80 (11%)
 Frame = +3

Query  138  DPESN--------SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWR  293
            DPE+         SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDWR
Sbjct  37   DPENQESGNGGIRSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWR  95

Query  294  SRSRTQVLQYVFLKWTLAFL  353
             RS  +VLQY+FLKW LAFL
Sbjct  96   RRSNGEVLQYIFLKWALAFL  115



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   110 bits (274),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            +SL QPLL KR+ TL++S LAMVGAKVSHIESLDYEI ENDLFKHDWR RS  +VLQY+F
Sbjct  37   SSLEQPLL-KRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKHDWRRRSNVEVLQYIF  95

Query  330  LKWTLAFL  353
            LKW +AFL
Sbjct  96   LKWAMAFL  103



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score =   109 bits (272),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  336  WTLAFL  353
            W +AFL
Sbjct  114  WAMAFL  119



>gb|AFW87644.1| hypothetical protein ZEAMMB73_318834, partial [Zea mays]
Length=252

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  336  WTLAFL  353
            W +AFL
Sbjct  114  WAMAFL  119



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   108 bits (271),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L QPLL KR+ TL++S LA+VGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQY+FLK
Sbjct  55   LEQPLL-KRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLK  113

Query  336  WTLAFL  353
            W +AFL
Sbjct  114  WAMAFL  119



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            +SL QPLL K N TL+++ LAMVGAKVSHIESLDYEI ENDLFKHDWRSRS  +VLQYVF
Sbjct  36   SSLEQPLLKKSN-TLTANHLAMVGAKVSHIESLDYEIIENDLFKHDWRSRSTVEVLQYVF  94

Query  330  LKWTLAFL  353
            LKW LAFL
Sbjct  95   LKWALAFL  102



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  180  RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            RN TLSS+ +A+ GAKVSHIESLDYEINENDLFKHDWR RSR Q LQYVF+KWTLAFL
Sbjct  26   RNRTLSSTSVALEGAKVSHIESLDYEINENDLFKHDWRKRSRVQTLQYVFIKWTLAFL  83



>ref|XP_006848424.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
 gb|ERN10005.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
Length=127

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 4/67 (6%)
 Frame = +3

Query  153  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            +LH+PLL KR   + +S LA++GAK+S IESLDYEINENDLFKHDWRSRSR +VLQY+ +
Sbjct  30   NLHRPLL-KR---VRTSQLALIGAKLSPIESLDYEINENDLFKHDWRSRSRVEVLQYIIM  85

Query  333  KWTLAFL  353
            KWT AFL
Sbjct  86   KWTFAFL  92



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D +   + QPLLL++    ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  29   DEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCSIESLDYEIVENDLFKQDWRSRKKVQIF  88

Query  318  QYVFLKWTLAFL  353
            QY+ LKWTLA L
Sbjct  89   QYIVLKWTLALL  100



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            ++ S+ QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY
Sbjct  34   DAGSVRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVQIFQY  92

Query  324  VFLKWTLAFL  353
            V LKWTLA L
Sbjct  93   VLLKWTLALL  102



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D +   + QPLLL++    ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  29   DEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVQIF  88

Query  318  QYVFLKWTLAFL  353
            QY+ LKWTLA L
Sbjct  89   QYIVLKWTLALL  100



>ref|XP_009403721.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403722.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403723.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            + E+ S+ +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLF+ DWRSR + Q+ 
Sbjct  30   NEEAGSMREPLLRKRTMN-TTSQIAIVGANVCTIESLDYEIVENDLFEQDWRSRKKVQIF  88

Query  318  QYVFLKWTLAFL  353
            QY+ LKWTLA L
Sbjct  89   QYIVLKWTLALL  100



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +3

Query  138  DPESNSLHQPLL-LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            DPES  L QP L L+R+   S+S +A+VGA V  IESLDYEI END FK DWR+R + Q+
Sbjct  8    DPES--LTQPFLALQRSTINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRTRGKMQI  65

Query  315  LQYVFLKWTLAFL  353
             QY+F+KW L FL
Sbjct  66   FQYIFMKWLLCFL  78



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            + + ++QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++LQY
Sbjct  29   DGSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQY  88

Query  324  VFLKWTLAFL  353
              LKW LAFL
Sbjct  89   TILKWALAFL  98



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            + + ++QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++LQY
Sbjct  29   DGSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEILQY  88

Query  324  VFLKWTLAFL  353
              LKW LAFL
Sbjct  89   TILKWALAFL  98



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D E NS+ +PLL  RN   ++S +A+VGA V  IESLDYEI EN+L K DWRSR + ++ 
Sbjct  22   DKEFNSMREPLL--RNRKNTTSQIAIVGANVCPIESLDYEIFENELIKQDWRSRKKIEIF  79

Query  318  QYVFLKWTLAFL  353
            QY+FLKWTLA L
Sbjct  80   QYIFLKWTLALL  91



>ref|XP_008806106.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
 ref|XP_008806107.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=765

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            + +PLL +R +  ++S LA+VGA VS IESLDYEI ENDL+K DWRSR + Q+ QYV LK
Sbjct  24   MREPLLRRRTMN-TTSQLAIVGANVSPIESLDYEIVENDLYKQDWRSRRKVQIFQYVVLK  82

Query  336  WTLAFL  353
            WTLA L
Sbjct  83   WTLALL  88



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            +  ++ +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY
Sbjct  32   KDTAMREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQY  90

Query  324  VFLKWTLAFL  353
            + LKWTLA L
Sbjct  91   IVLKWTLALL  100



>ref|XP_010657885.1| PREDICTED: uncharacterized protein LOC100245380 isoform X1 [Vitis 
vinifera]
Length=777

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            +  ++ +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY
Sbjct  32   KDTAMREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQY  90

Query  324  VFLKWTLAFL  353
            + LKWTLA L
Sbjct  91   IVLKWTLALL  100



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D E  ++ +PLL  R+   ++S +A+VGAKV  IESLDYEI EN+L K DWR+R R ++ 
Sbjct  43   DREGGAVREPLLNLRSRVNTTSQIAIVGAKVYPIESLDYEIFENELIKQDWRTRKRIEIF  102

Query  318  QYVFLKWTLAFL  353
            QYVFLKWTLA L
Sbjct  103  QYVFLKWTLALL  114



>ref|XP_010927804.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=761

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            + +PLL +R +  ++S LA+VGAKV  IESLDYEI ENDL+K DWRSR + Q+ QY+ LK
Sbjct  19   MREPLLRRRTMN-TTSQLAIVGAKVCPIESLDYEIVENDLYKQDWRSRKKVQIFQYIVLK  77

Query  336  WTLAFL  353
            WTLA L
Sbjct  78   WTLALL  83



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            +S+  PLL KR  T ++S +A++GA    IESLDYEINEN+LFK DWRSR + Q+ QYVF
Sbjct  41   SSMRMPLLRKR--TNTTSQIAVIGANSCPIESLDYEINENELFKQDWRSRKKVQIFQYVF  98

Query  330  LKWTLAFL  353
            LKW LA L
Sbjct  99   LKWALALL  106



>emb|CBI29647.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            + +PLL+++ L  S+S +A+VGA V  IESLDYEI EN+LFK DWRSR R Q+ QY+ LK
Sbjct  1    MREPLLVRKRLN-STSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQYIVLK  59

Query  336  WTLAFL  353
            WTLA L
Sbjct  60   WTLALL  65



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +PLL  ++   ++S +A+VGA VS IESLDYEI EN+LFK DWRSR + ++ QYVFLK
Sbjct  67   LREPLLKSKSRINTTSQIAIVGANVSPIESLDYEIIENELFKQDWRSRKKVEIYQYVFLK  126

Query  336  WTLAFL  353
            WTLA L
Sbjct  127  WTLALL  132



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D +   + +PLL +R +  ++S LA+VGA V  IESLDYEI ENDL+K DWRSR + Q+ 
Sbjct  32   DDKEAGMREPLLRRRTMN-TTSQLAVVGANVCPIESLDYEIVENDLYKEDWRSRKKAQIF  90

Query  318  QYVFLKWTLAFL  353
            QYV LKWTLA L
Sbjct  91   QYVVLKWTLALL  102



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E+ S+ +PLL  ++   ++S +A+VGA V  IESLDY+I ENDLFK DWRSR + ++ QY
Sbjct  32   ETGSIREPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  91

Query  324  VFLKWTLAFL  353
            +FLKWTL  L
Sbjct  92   IFLKWTLVLL  101



>ref|XP_006647383.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=804

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR +TQ+ QYV LKWT
Sbjct  56   EPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKTQIFQYVILKWT  114

Query  342  LAFL  353
            L  L
Sbjct  115  LVLL  118



>ref|XP_004952777.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=950

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            +  S H+PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  196  DRGSTHEPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  254

Query  324  VFLKWTLAFL  353
            + LKW+L  L
Sbjct  255  IVLKWSLVLL  264



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            + + QPLL  ++   ++S +A++GA V  IESLDYEI ENDLFK DWRSR + Q+ QY+F
Sbjct  35   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  94

Query  330  LKWTLAFL  353
            LKWTL  L
Sbjct  95   LKWTLVLL  102



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            + + QPLL  ++   ++S +A++GA V  IESLDYEI ENDLFK DWRSR + Q+ QY+F
Sbjct  37   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  96

Query  330  LKWTLAFL  353
            LKWTL  L
Sbjct  97   LKWTLVLL  104



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            + +PLL KR  T ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QYV LK
Sbjct  33   IREPLLKKR--TNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKIQIFQYVVLK  90

Query  336  WTLAFL  353
            WTLA L
Sbjct  91   WTLALL  96



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            ES S+  PLL  ++   ++S +A+VGA V  IESLDY+I ENDLFK DWRSR + ++ QY
Sbjct  18   ESGSIRVPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWRSRKKVEIFQY  77

Query  324  VFLKWTLAFL  353
            +FLKWTL  L
Sbjct  78   IFLKWTLVLL  87



>gb|ADF30876.1| chloride channel protein [Citrus trifoliata]
Length=789

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E ++L +PLLLK   T ++S +A+VGA +S IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANISPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  324  VFLKWTLAFL  353
            V LKWTLA L
Sbjct  101  VVLKWTLALL  110



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  29   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQDWRSRKKIEIL  87

Query  318  QYVFLKWTLAFL  353
            QY FLKW LAFL
Sbjct  88   QYTFLKWALAFL  99



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +3

Query  60   RMEEQYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHI  239
            R EE +       A  G   +     D  S    QPLL  RN   ++S +A+VGA    I
Sbjct  4    RSEEDHDIEVEGGAFQGYERKISGILDDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPI  62

Query  240  ESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            ESLDYEI END FK DWRSR + ++LQY FLKW LAFL
Sbjct  63   ESLDYEIFENDFFKQDWRSRKKIEILQYTFLKWALAFL  100



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            + + +PLL  ++   ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+F
Sbjct  31   SGIREPLLKSKSRVNNTSQIAIVGANVYPIESLDYEIVENDLFKQDWRSRKKVQIFQYIF  90

Query  330  LKWTLAFL  353
            LKWTL  L
Sbjct  91   LKWTLVLL  98



>ref|XP_010250239.1| PREDICTED: putative chloride channel-like protein CLC-g [Nelumbo 
nucifera]
Length=776

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 7/79 (9%)
 Frame = +3

Query  138  DPESNSLHQPLL-------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  296
            D E+  L +PLL       L+R+ + ++S +A+VG+ V  IESLDYEI END FK DWRS
Sbjct  6    DEEAPPLTEPLLNNHLQFQLRRSASNTTSQVAIVGSNVCPIESLDYEIIENDFFKQDWRS  65

Query  297  RSRTQVLQYVFLKWTLAFL  353
            R + Q+ QY+F+KW+L FL
Sbjct  66   RGKIQIFQYIFMKWSLCFL  84



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  31   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQDWRSRKKIEIL  89

Query  318  QYVFLKWTLAFL  353
            QY FLKW LAFL
Sbjct  90   QYTFLKWALAFL  101



>ref|XP_010529978.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529986.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529994.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
Length=779

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWR+R +TQ+ 
Sbjct  32   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRARKKTQIF  90

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  91   QYTVLKWALAFL  102



>gb|EEC77341.1| hypothetical protein OsI_16021 [Oryza sativa Indica Group]
Length=350

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D       QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ 
Sbjct  51   DEAGGGPRQPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  318  QYVFLKWTLAFL  353
            QY+ LKW L  L
Sbjct  110  QYIVLKWALVLL  121



>dbj|BAB97268.1| chloride channel [Oryza sativa Japonica Group]
Length=756

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            S S  +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+
Sbjct  1    SGSAGEPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYI  59

Query  327  FLKWTLAFL  353
             LKWTL  L
Sbjct  60   VLKWTLVLL  68



>dbj|BAJ97961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=739

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R  +  S+H+PL+ KR +  ++S +A+VGA +  IESLDYE+ EN+LFK DWRSR + Q+
Sbjct  48   RYDDRQSVHEPLMRKRTIN-TASQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQI  106

Query  315  LQYVFLKWTLAFL  353
             QY+ +KWTL  L
Sbjct  107  FQYIVMKWTLVLL  119



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  150  NSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            + + +PLL  ++   ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+F
Sbjct  31   SGIREPLLNSKSRVNNTSQIAIVGANVYPIESLDYEIVENDLFKQDWRSRKKVQIFQYIF  90

Query  330  LKWTLAFL  353
            LKWTL  L
Sbjct  91   LKWTLVLL  98



>dbj|BAJ92873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=805

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R  +  S+H+PL+ KR +  ++S +A+VGA +  IESLDYE+ EN+LFK DWRSR + Q+
Sbjct  48   RYDDRQSVHEPLMRKRTIN-TASQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQI  106

Query  315  LQYVFLKWTLAFL  353
             QY+ +KWTL  L
Sbjct  107  FQYIVMKWTLVLL  119



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L  PLL +R  T  +S LA+VG+ V  +ESLDYEI END FK DWRSR R Q+ QYVFLK
Sbjct  31   LRVPLLKQRRNT--TSQLAIVGSNVCPVESLDYEIIENDTFKQDWRSRKRVQIFQYVFLK  88

Query  336  WTLAFL  353
            WTLA L
Sbjct  89   WTLALL  94



>ref|XP_010909770.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=737

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            + +P L +R +  ++S LA+VGA VS IESLDYEI ENDL+K DWRSR + Q+ QYV LK
Sbjct  1    MREPFLRRRTMN-TASQLAVVGADVSPIESLDYEIVENDLYKQDWRSRKKVQIFQYVVLK  59

Query  336  WTLAFL  353
            WT A L
Sbjct  60   WTFALL  65



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  29   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  87

Query  318  QYVFLKWTLAFL  353
            QY FLKW LAFL
Sbjct  88   QYTFLKWALAFL  99



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  30   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  88

Query  318  QYVFLKWTLAFL  353
            QY FLKW LAFL
Sbjct  89   QYTFLKWALAFL  100



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI END FK DWRSR + ++L
Sbjct  31   DDGSVGFRQPLL-ARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQDWRSRKKIEIL  89

Query  318  QYVFLKWTLAFL  353
            QY FLKW LAFL
Sbjct  90   QYTFLKWALAFL  101



>gb|KDP30234.1| hypothetical protein JCGZ_17016 [Jatropha curcas]
Length=773

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  320
            +  SL  PLL   R++T S+S +A+VGA V  IESLDYE+ END FK DWR+R + Q+ Q
Sbjct  11   DQESLTVPLLTSSRSITNSTSQVAIVGANVCPIESLDYEVAENDFFKQDWRTRGKIQIFQ  70

Query  321  YVFLKWTLAFL  353
            Y+F+KW+L FL
Sbjct  71   YLFMKWSLCFL  81



>ref|XP_008644266.1| PREDICTED: LOC542114 isoform X1 [Zea mays]
 gb|AFW71856.1| chloride channel [Zea mays]
Length=813

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            +  S  QPLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  59   DRGSTQQPLLRKRTVN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  117

Query  324  VFLKWTLAFL  353
            + LKW+L  L
Sbjct  118  IVLKWSLVLL  127



>ref|NP_001105216.1| LOC542114 [Zea mays]
 gb|AAP04392.2| chloride channel [Zea mays]
Length=786

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            +  S  QPLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY
Sbjct  32   DHGSTQQPLLRKRTVN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQY  90

Query  324  VFLKWTLAFL  353
            + LKW+L  L
Sbjct  91   IVLKWSLVLL  100



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  87   QYTILKWALAFL  98



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  87   QYTILKWALAFL  98



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  87   QYTILKWALAFL  98



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  87   QYTILKWALAFL  98



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D  S    QPLL  RN   ++S +A+VGA    IESLDYEI ENDLFK DWRSR + ++L
Sbjct  28   DDGSVGFQQPLL-ARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRSRKKIEIL  86

Query  318  QYVFLKWTLAFL  353
            QY  LKW LAFL
Sbjct  87   QYTILKWALAFL  98



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            + +  SL  PLL  +R+L  S+S +A+VGA V  IESLDYEI EN+ FK DWRSR + Q+
Sbjct  11   NTDQESLIIPLLSPRRSLINSTSQVAIVGANVCPIESLDYEIAENEFFKQDWRSRGKMQI  70

Query  315  LQYVFLKWTLAFL  353
             QYVF+KW+L FL
Sbjct  71   FQYVFMKWSLCFL  83



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 3/75 (4%)
 Frame = +3

Query  138  DPESNSLHQPLLL---KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            + +  SL QPLLL   +R+ + ++S +A+VG+ V  IESLDYEI+END FK DWR R + 
Sbjct  22   EADEESLTQPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDWRRREKI  81

Query  309  QVLQYVFLKWTLAFL  353
            Q LQYVF+KW + F 
Sbjct  82   QTLQYVFMKWMMCFF  96



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQ  311
            ++ E  SL  PLL  +R+L  S+S +A+VGA V  IESLDYEI END FK DWR+  + Q
Sbjct  11   QEQEHESLTLPLLTSQRSLINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRTHKKIQ  70

Query  312  VLQYVFLKWTLAFL  353
            + QYVF+KW L FL
Sbjct  71   IFQYVFMKWLLCFL  84



>ref|NP_001267998.1| uncharacterized protein LOC100255837 [Vitis vinifera]
 gb|ADK66983.1| chloride channel ClC5 [Vitis vinifera]
Length=770

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = +3

Query  138  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QY+F+KW L FL
Sbjct  66   QIFQYIFVKWLLCFL  80



>ref|XP_010656505.1| PREDICTED: uncharacterized protein LOC100255837 isoform X1 [Vitis 
vinifera]
 emb|CBI25542.3| unnamed protein product [Vitis vinifera]
Length=772

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = +3

Query  138  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QY+F+KW L FL
Sbjct  66   QIFQYIFVKWLLCFL  80



>ref|XP_006395982.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
 gb|ESQ33268.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
Length=765

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  SLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVF  329
            S+  PLL   R+ T SSS +A+VG+ V  IESLDYEI END FK DWR+RS+TQ+ QYVF
Sbjct  9    SVTVPLLPSLRHATNSSSQVAIVGSNVCPIESLDYEIAENDFFKQDWRARSKTQIFQYVF  68

Query  330  LKWTLAFL  353
            +KW L F 
Sbjct  69   MKWLLCFF  76



>emb|CAN62616.1| hypothetical protein VITISV_036165 [Vitis vinifera]
Length=805

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = +3

Query  138  DPESNSLHQPLL---LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            D ES +  QPLL   L R+L+  +S +A+VG+ V  IESLDYEI END FK DWRSR + 
Sbjct  8    DEESQA--QPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKV  65

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QY+F+KW L FL
Sbjct  66   QIFQYIFVKWLLCFL  80



>ref|XP_006388251.1| hypothetical protein POPTR_0261s002202g, partial [Populus trichocarpa]
 gb|ERP47165.1| hypothetical protein POPTR_0261s002202g, partial [Populus trichocarpa]
Length=202

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL+KR  T S +  A+VGA +S IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW 
Sbjct  46   EPLLVKRRNTTSQT--AIVGANISLIESLDYEIAENELFKQDWRSRKKVQIFQYILLKWA  103

Query  342  LAFL  353
             A L
Sbjct  104  FALL  107



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +3

Query  138  DPESNSLHQPLLL-----KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            D E+N+  + L++     +R+   S+S +A+VGA V  IESLDYEI EN+ FK DWRSR 
Sbjct  38   DGEANTDQESLIIPLLSPRRSFINSTSQVAIVGANVCPIESLDYEIAENEFFKQDWRSRG  97

Query  303  RTQVLQYVFLKWTLAFL  353
            + Q+ QYVF+KW+L FL
Sbjct  98   KMQIFQYVFMKWSLCFL  114



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  324  VFLKWTLAFL  353
            V LKWTLA L
Sbjct  101  VVLKWTLALL  110



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+ LKW 
Sbjct  33   QPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVLKWA  91

Query  342  LAFL  353
            L  L
Sbjct  92   LVLL  95



>ref|XP_008218680.1| PREDICTED: chloride channel protein CLC-c [Prunus mume]
Length=743

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L QPLL+K N    +S  A+VGA +  IESLDYEI ENDLFK DWRSR+R ++LQYV LK
Sbjct  7    LRQPLLVK-NRRNHTSQHAIVGANICPIESLDYEIIENDLFKQDWRSRTRVEILQYVSLK  65

Query  336  WTLAFL  353
            WTL  L
Sbjct  66   WTLVLL  71



>ref|XP_007225226.1| hypothetical protein PRUPE_ppa001898mg [Prunus persica]
 gb|EMJ26425.1| hypothetical protein PRUPE_ppa001898mg [Prunus persica]
Length=745

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L QPLL+K N    +S  A+VGA +  IESLDYEI ENDLFK DWRSR+R ++LQYV LK
Sbjct  3    LRQPLLVK-NRRNHTSQHAIVGANICPIESLDYEIIENDLFKQDWRSRTRVEILQYVSLK  61

Query  336  WTLAFL  353
            WTL  L
Sbjct  62   WTLVLL  67



>gb|EEC73409.1| hypothetical protein OsI_07665 [Oryza sativa Indica Group]
Length=708

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+ LKWT
Sbjct  56   EPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVLKWT  114

Query  342  LAFL  353
            L  L
Sbjct  115  LVLL  118



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+ LKW 
Sbjct  59   QPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVLKWA  117

Query  342  LAFL  353
            L  L
Sbjct  118  LVLL  121



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+ LKW 
Sbjct  63   QPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVLKWA  121

Query  342  LAFL  353
            L  L
Sbjct  122  LVLL  125



>dbj|BAB97269.1| chloride channel [Oryza sativa Japonica Group]
Length=726

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+ LKWT
Sbjct  56   EPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVLKWT  114

Query  342  LAFL  353
            L  L
Sbjct  115  LVLL  118



>ref|XP_002454002.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
 gb|EES06978.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
Length=817

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+ LKW+
Sbjct  69   QPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVLKWS  127

Query  342  LAFL  353
            L  L
Sbjct  128  LVLL  131



>dbj|BAD16425.1| chloride channel [Oryza sativa Japonica Group]
 gb|EEE57198.1| hypothetical protein OsJ_07147 [Oryza sativa Japonica Group]
Length=804

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYE+ ENDLFK DWRSR + Q+ QY+ LKWT
Sbjct  56   EPLLRKRTMN-TTSQIAIVGANVCPIESLDYEVVENDLFKQDWRSRKKKQIFQYIVLKWT  114

Query  342  LAFL  353
            L  L
Sbjct  115  LVLL  118



>ref|XP_003575152.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=808

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  153  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            S+ +PLL KR L  ++S +A+VGA V  IESLDYE+ EN+LFK DWRSR + Q+ QY+ +
Sbjct  57   SVREPLLRKRTLN-TTSQIAIVGANVCPIESLDYEVVENNLFKQDWRSRKKKQIFQYIVM  115

Query  333  KWTLAFL  353
            KWTL  L
Sbjct  116  KWTLVLL  122



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+ LKW 
Sbjct  63   QPLLRKRTIN-TTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVLKWA  121

Query  342  LAFL  353
            L  L
Sbjct  122  LVLL  125



>ref|XP_010541946.1| PREDICTED: putative chloride channel-like protein CLC-g [Tarenaya 
hassleriana]
Length=775

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            S S+  PLL  R+ T S+S +A+VG+ VS IESLDYEI END FK DWR+R + Q+ QYV
Sbjct  14   SYSVSVPLL--RSATNSTSQVAIVGSDVSPIESLDYEIAENDFFKQDWRARGKAQIFQYV  71

Query  327  FLKWTLAFL  353
            F+KW L F 
Sbjct  72   FMKWLLCFF  80



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            ++   +PLL  ++   ++S +A++GA V  IESLDY+I ENDLFK DWRSR + Q+ QY+
Sbjct  31   ASGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQYI  90

Query  327  FLKWTLAFL  353
            FLKWTL  L
Sbjct  91   FLKWTLVLL  99



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +3

Query  135  RDPESNSL--------HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDW  290
            +DP S +L         +PLL +R +  ++S +A+VGA +  IESLDYEI ENDLFK DW
Sbjct  38   QDPSSEALMRYDDDGPREPLLRRRTMN-TTSQIAIVGANICPIESLDYEIVENDLFKQDW  96

Query  291  RSRSRTQVLQYVFLKWTLAFL  353
            RSR + Q+ QY+ LKW+L  L
Sbjct  97   RSRKKQQIFQYIVLKWSLVLL  117



>ref|XP_009108066.1| PREDICTED: putative chloride channel-like protein CLC-g [Brassica 
rapa]
Length=764

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  150  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            +S+  PLL   R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ QYV
Sbjct  8    DSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQYV  67

Query  327  FLKWTLAFL  353
            F+KW L F 
Sbjct  68   FMKWLLCFF  76



>emb|CDY47559.1| BnaA08g07280D [Brassica napus]
Length=764

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  150  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            +S+  PLL   R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ QYV
Sbjct  8    DSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQYV  67

Query  327  FLKWTLAFL  353
            F+KW L F 
Sbjct  68   FMKWLLCFF  76



>ref|XP_011087632.1| PREDICTED: chloride channel protein CLC-c [Sesamum indicum]
Length=789

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            S S  +PLL  ++   ++S +A+VG+KV  IESLDYEI EN+L K DWRSR R ++ QY+
Sbjct  41   SESAREPLLHLKSRVNTTSQIAIVGSKVYPIESLDYEIFENELIKQDWRSRKRVEIFQYI  100

Query  327  FLKWTLAF  350
            FLKWTLA 
Sbjct  101  FLKWTLAL  108



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
              +PLL  ++   ++S +A++GA V  IESLDY+I ENDLFK DWRSR + Q+ QY+FLK
Sbjct  34   FREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQYIFLK  93

Query  336  WTLAFL  353
            WTL  L
Sbjct  94   WTLVLL  99



>ref|XP_010999722.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_010999723.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=784

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL+KR  T S +  A+VGA +S IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW 
Sbjct  46   EPLLVKRRNTTSQT--AIVGANISPIESLDYEIAENELFKQDWRSRKKVQIFQYILLKWA  103

Query  342  LAFL  353
             A L
Sbjct  104  FALL  107



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QYV LKW 
Sbjct  65   EPLLRKRTMN-TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQYVVLKWA  123

Query  342  LAFL  353
            L  L
Sbjct  124  LVLL  127



>ref|XP_002447895.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
 gb|EES12223.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
Length=798

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL KR +  ++S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW+
Sbjct  58   QPLLRKRTMN-TTSQIAIVGANVCPIESLDYEIVENELFKQDWRSRKKKQIFQYIVLKWS  116

Query  342  LAFL  353
            L  L
Sbjct  117  LVLL  120



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  324  VFLKWTLAFL  353
            V  KWTLA L
Sbjct  101  VVFKWTLALL  110



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E ++L +PLLLK   T ++S +A+VGA +  IESLDYEI EN+LFK DWR+R + ++ QY
Sbjct  42   EDHNLREPLLLKCR-TNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQY  100

Query  324  VFLKWTLAFL  353
            V  KWTLA L
Sbjct  101  VVFKWTLALL  110



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D ++  LHQPLL   ++T++   +A+VG+ V  IESLDYE+ END FK DWRSR + Q  
Sbjct  14   DDDTALLHQPLLPSESITVAE--VAIVGSSVCPIESLDYEVIENDFFKADWRSRGKIQKY  71

Query  318  QYVFLKWTLAFL  353
            QY+F+KW L FL
Sbjct  72   QYIFMKWILCFL  83



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  177  KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            +R+ + ++S +A VG+ V  IESLDYEI END FK DWRSR + Q+LQY+F+KWTL FL
Sbjct  26   RRSASNTTSQVAFVGSNVCPIESLDYEIIENDFFKQDWRSRGKVQILQYIFMKWTLCFL  84



>ref|XP_007013577.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31196.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
Length=773

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  141  PESNSLHQ----PLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            P+ N  H+    PLL       S+S +A+VGA V  IES DYEI END FK DWR+R++ 
Sbjct  7    PDQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKI  66

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QY+F+KW L FL
Sbjct  67   QIFQYIFMKWLLCFL  81



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  96   IAMAGQaeeeeaeRDPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINEND  272
            +++ G +       DPES  +  PL+  +R+   S+S +A+VGA V  IESLDYEI EN+
Sbjct  1    MSVNGNSNAFLNAEDPES--ITAPLISGQRSAPNSTSQVALVGANVCPIESLDYEILENE  58

Query  273  LFKHDWRSRSRTQVLQYVFLKWTLAFL  353
             FK DWRSR + QV QY+F+KW L FL
Sbjct  59   FFKQDWRSRGKMQVFQYIFMKWFLCFL  85



>ref|XP_007013578.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31197.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
Length=788

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  141  PESNSLHQ----PLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            P+ N  H+    PLL       S+S +A+VGA V  IES DYEI END FK DWR+R++ 
Sbjct  7    PDQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKI  66

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QY+F+KW L FL
Sbjct  67   QIFQYIFMKWLLCFL  81



>ref|XP_009355373.1| PREDICTED: chloride channel protein CLC-c-like [Pyrus x bretschneideri]
Length=758

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQY  323
            E   L +PLL +     ++S LA+VGA  S IESLDYEI ENDLFK DWRSR++ ++ QY
Sbjct  12   ERGGLREPLLERNRRRNTTSQLAIVGANFSPIESLDYEIIENDLFKQDWRSRTKGEIFQY  71

Query  324  VFLKWTLAFL  353
            V LKW L  L
Sbjct  72   VCLKWALVLL  81



>ref|XP_003567326.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=779

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +PLL +R  + ++S +A+VG  VSHIESLDYEI END++K DWRSR R Q+ QY  +K
Sbjct  37   LERPLLRQRG-SNTTSQMAVVGVNVSHIESLDYEIVENDVYKQDWRSRGRIQIFQYQVMK  95

Query  336  WTLAFL  353
            W LA L
Sbjct  96   WLLALL  101



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PL+ KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QYV LKW 
Sbjct  59   EPLMRKRTMN-TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQYVVLKWA  117

Query  342  LAFL  353
            L  L
Sbjct  118  LVLL  121



>ref|XP_010030223.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57159.1| hypothetical protein EUGRSUZ_I02790 [Eucalyptus grandis]
Length=778

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLS----SSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            ++     + QPLL +++ + S    +S +A+VGA +  IESLDYEI ENDLFK DWRSR+
Sbjct  25   KESSPKGMRQPLLSRKHDSGSRINRTSQIAIVGANLCPIESLDYEIVENDLFKQDWRSRT  84

Query  303  RTQVLQYVFLKWTLAFL  353
            ++++ QYV LKWTLA L
Sbjct  85   KSEIYQYVVLKWTLALL  101



>emb|CDY12393.1| BnaC08g08120D [Brassica napus]
Length=764

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  180  RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            R+ T SSS +A+VG+ +  +ESLDYEI END FK DWR+RS+TQ+ QYVF+KW L F 
Sbjct  19   RHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQIFQYVFMKWLLCFF  76



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR  T  +S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QYV LKW 
Sbjct  6    EPLLTKRMNT--TSQIAIVGANVCSIESLDYEIVENELFKQDWRSRKKAQIFQYVVLKWA  63

Query  342  LAFL  353
            LA L
Sbjct  64   LALL  67



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = +3

Query  162  QPLLLK--RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            +PLLL   ++   ++S +A+VG+KV  IESLDYEI EN+LFK DWRSR + Q+ QY+FLK
Sbjct  40   EPLLLHHLKHRVNTTSQIAIVGSKVYPIESLDYEIIENELFKQDWRSRKKIQIFQYIFLK  99

Query  336  WTLAFL  353
            WTL+ L
Sbjct  100  WTLSLL  105



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR  T  +S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QYV LKW 
Sbjct  44   EPLLTKRMNT--TSQIAIVGANVCSIESLDYEIVENELFKQDWRSRKKAQIFQYVVLKWA  101

Query  342  LAFL  353
            LA L
Sbjct  102  LALL  105



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR +  ++S +A+VGA V  IESLDYEI ENDLFK DWRSR + Q+ QY+ LKW 
Sbjct  55   EPLLRKRTMN-TTSQIAIVGANVFPIESLDYEIVENDLFKQDWRSRKKKQIFQYIVLKWA  113

Query  342  LAFL  353
            L  L
Sbjct  114  LVLL  117



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  138  DPESNSLHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            DPES  +  PL+  +R+   S+S +A+VGA V  +ESLDYEI EN+ FK DWRSR + QV
Sbjct  15   DPES--ITAPLISGQRSAPNSTSQVALVGANVCPVESLDYEILENEFFKQDWRSRGKMQV  72

Query  315  LQYVFLKWTLAFL  353
             QY+F+KW L FL
Sbjct  73   FQYIFMKWILCFL  85



>gb|KJB64678.1| hypothetical protein B456_010G060300 [Gossypium raimondii]
Length=774

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +3

Query  144  ESNSLHQPLLLKRNLTL-SSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQ  320
            + +SL  PLL  +  ++ S+S +A+VGA V  IESLDYEI END FK DWR+R + Q+ Q
Sbjct  12   DHDSLTIPLLSHQQRSINSTSQVAIVGANVCPIESLDYEIVENDFFKQDWRARGKVQIFQ  71

Query  321  YVFLKWTLAFL  353
            Y+F+KW L FL
Sbjct  72   YIFMKWLLCFL  82



>gb|EMS67360.1| Chloride channel protein CLC-c [Triticum urartu]
Length=835

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R  +  S+ +PL+ KR +  ++S +A+VGA +  IESLDYE+ EN+LFK DWRSR + Q+
Sbjct  108  RYDDRGSICEPLMRKRTIN-TTSQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQI  166

Query  315  LQYVFLKWTLAFL  353
             QY+ +KWTL  L
Sbjct  167  FQYIVMKWTLVLL  179



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 5/75 (7%)
 Frame = +3

Query  144  ESNSLHQ----PLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            E+N  H+    PLL  +R+   S+S +A+VGA V  IESLDYEI ENDLFK DWRS  + 
Sbjct  9    EANDDHESVTIPLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFKQDWRSGGKI  68

Query  309  QVLQYVFLKWTLAFL  353
            Q+ QYVF+KW L FL
Sbjct  69   QIFQYVFMKWLLCFL  83



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            QPLL++  +  +SS LA+VGA +  I+SLDYE+ ENDL K DWRSR++ ++ QYV LKWT
Sbjct  17   QPLLIRSRIN-NSSQLAIVGANICPIQSLDYELIENDLLKQDWRSRTKVEIYQYVVLKWT  75

Query  342  LAFL  353
            LA L
Sbjct  76   LALL  79



>ref|XP_011047852.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +P L+ RN+  ++S +A+VGA    IESLDYEI +N+LFK DWRSR + ++ QYV LK
Sbjct  27   LREPFLV-RNIKNNTSQIAIVGANTCPIESLDYEITDNELFKQDWRSRKKVEIYQYVVLK  85

Query  336  WTLAFL  353
            WTLA L
Sbjct  86   WTLALL  91



>ref|XP_002870407.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46666.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            +S+  PLL   R  T S+S +A+VGA V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  327  FLKWTLAF  350
            F+KW L F
Sbjct  68   FMKWLLCF  75



>ref|NP_198313.2| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
 sp|P60300.2|CLCG_ARATH RecName: Full=Putative chloride channel-like protein CLC-g; AltName: 
Full=CBS domain-containing protein CBSCLC6 [Arabidopsis 
thaliana]
 gb|AED93891.1| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
Length=765

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            +S+  PLL   R  T S+S +A+VGA V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  327  FLKWTLAF  350
            F+KW L F
Sbjct  68   FMKWLLCF  75



>ref|XP_010099780.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB80398.1| Chloride channel protein CLC-c [Morus notabilis]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R+     L +PLL  R     +S +A+VGA V  IESLDYEI ENDLFK DWRSR + ++
Sbjct  14   REGSGACLKEPLLKSR--IKYTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVEI  71

Query  315  LQYVFLKWTLAFL  353
             QYVF KW LA L
Sbjct  72   YQYVFFKWALALL  84



>ref|XP_010682061.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=781

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 15/107 (14%)
 Frame = +3

Query  39   DLRVSASRMEE--QYAESATTIAMAGQaeeeeaeRDPESNSLHQPLLLKRNLTLSSSPLA  212
            D++V  +R  E     E  TT++  G             +   QPLL KR  T  +S LA
Sbjct  11   DIKVERTRSFEYGTNTEVVTTLSRYGS-----------DDEFKQPLLRKR--TNQTSQLA  57

Query  213  MVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWTLAFL  353
            +VGA VS IESLDYEI EN+L K DWRS    ++ QY+F KWT+A L
Sbjct  58   IVGANVSPIESLDYEIMENELLKEDWRSMKNFEIFQYIFFKWTMALL  104



>ref|XP_009392135.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=757

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  338
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  339  TLAFL  353
            T    
Sbjct  104  TFCLF  108



>ref|XP_009392134.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=784

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  338
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  339  TLAFL  353
            T    
Sbjct  104  TFCLF  108



>gb|KFK30515.1| hypothetical protein AALP_AA7G272300 [Arabis alpina]
Length=765

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  153  SLHQPLL--LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            S+  PLL  L+R +  S+S +A+VG+ +  IESLDYEI END FK DWR+RS+ Q+ QYV
Sbjct  9    SVAVPLLPSLRRTIN-STSQVAIVGSNLCPIESLDYEIEENDFFKQDWRARSKVQIFQYV  67

Query  327  FLKWTLAFL  353
            F+KW L F 
Sbjct  68   FMKWLLCFF  76



>ref|XP_007048601.1| Chloride channel C [Theobroma cacao]
 gb|EOX92758.1| Chloride channel C [Theobroma cacao]
Length=771

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL+KR  T  +S +A+VGA V  IESLDYEI EN+LFK DWRSR + Q+ QY+ LKW 
Sbjct  33   EPLLVKRRNT--TSQIAIVGANVCPIESLDYEIAENELFKQDWRSRKKIQIFQYLLLKWA  90

Query  342  LAFL  353
             A +
Sbjct  91   FALI  94



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  159  HQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKW  338
            H P+ L+R+   ++S LA+VG+ +  IESLDYE+ ENDLF  DWRSR R  +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  339  TLAFL  353
            T    
Sbjct  104  TFCLF  108



>gb|EMT13398.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=624

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R  +  S  +PL+ KR +  ++S +A+VGA +  IESLDYE+ EN+LFK DWRSR + Q+
Sbjct  92   RYDDRGSACEPLMRKRTIN-TTSQIAIVGANICPIESLDYEVVENNLFKQDWRSRKKKQI  150

Query  315  LQYVFLKWTLAFL  353
             QY+ +KWTL  L
Sbjct  151  FQYIVIKWTLVLL  163



>ref|XP_010450335.1| PREDICTED: putative chloride channel-like protein CLC-g [Camelina 
sativa]
Length=765

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +3

Query  150  NSLHQPLLLK-RNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            +S+  PLL   R  T S+S +A+VG+ V  IESLDYEI END FK DWR RS+ ++ QYV
Sbjct  8    DSVAVPLLASLRRATNSTSQVAIVGSDVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  327  FLKWTLAF  350
            F+KW L F
Sbjct  68   FMKWLLCF  75



>ref|XP_008788815.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Phoenix dactylifera]
Length=757

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +3

Query  144  ESNSLHQPLL-------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            +  +L +PLL       L+R+   S+S +A++G+    IESLDYE+ E+DLF  DWRSR 
Sbjct  16   QRQALREPLLGHLHSINLRRHARNSTSQIAIIGSNPCPIESLDYEMIESDLFNQDWRSRG  75

Query  303  RTQVLQYVFLKWTLAFL  353
            R  +LQY+FLKWTL FL
Sbjct  76   RAAILQYIFLKWTLCFL  92



>ref|XP_011016274.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +P L+ RN   ++S +A+VGA    IESLDYEI EN+LFK DWRSR + ++ QYV LK
Sbjct  25   LREPFLV-RNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWRSRKKAEIFQYVVLK  83

Query  336  WTLAFL  353
            WTLA L
Sbjct  84   WTLALL  89



>ref|XP_011028391.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_011028392.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +P L+ RN   ++S +A+VGA    IESLDYEI EN+LFK DWRSR + ++ QYV LK
Sbjct  25   LREPFLV-RNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWRSRKKAEIFQYVVLK  83

Query  336  WTLAFL  353
            WTLA L
Sbjct  84   WTLALL  89



>gb|KCW74788.1| hypothetical protein EUGRSUZ_E03522 [Eucalyptus grandis]
Length=735

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  144  ESNSLHQPLLLKR--NLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            E+ S  +PLL      L  S+S +A+VGA +  IESLDYEI+END FK DWR+ S  Q+ 
Sbjct  8    EAESQARPLLSSEVSPLAQSTSQVAVVGANLCPIESLDYEISENDFFKQDWRTNSTVQIF  67

Query  318  QYVFLKWTLAFL  353
            QYVF+KW L FL
Sbjct  68   QYVFMKWLLCFL  79



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +3

Query  144  ESNSLHQPLL-------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            +  +L +PLL       L+R+   S+S +A++G+    IESLDYE+ E+DLF  DWRSR 
Sbjct  16   QRQALREPLLGHLHSINLRRHARNSTSQIAIIGSNPCPIESLDYEMIESDLFNQDWRSRG  75

Query  303  RTQVLQYVFLKWTLAFL  353
            R  +LQY+FLKWTL FL
Sbjct  76   RAAILQYIFLKWTLCFL  92



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSS----PLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            +DPES  L  PLL  +    S S     +A+VGA V  IESLDYEI END FK DWR+R 
Sbjct  28   QDPES--LTVPLLSHQRSRSSISNSTSQVALVGADVCPIESLDYEIAENDFFKEDWRTRG  85

Query  303  RTQVLQYVFLKWTLAFL  353
            R Q++QY+F+KW+L FL
Sbjct  86   RNQMIQYIFMKWSLCFL  102



>ref|XP_004288642.1| PREDICTED: chloride channel protein CLC-c [Fragaria vesca subsp. 
vesca]
Length=782

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  147  SNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYV  326
            ++S  +PLL +R +T ++S +A+VG+ V  IESLDYEI ENDLFK DWRS  ++++L+YV
Sbjct  37   THSYKEPLLTRR-ITNTTSQIAIVGSNVCPIESLDYEIFENDLFKQDWRSAKKSRILKYV  95

Query  327  FLKWTLAFL  353
             LKW LA +
Sbjct  96   VLKWALALV  104



>emb|CDP10469.1| unnamed protein product [Coffea canephora]
Length=784

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 9/79 (11%)
 Frame = +3

Query  144  ESNSLHQPLL---------LKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRS  296
            E + L QPLL         L+R+ + ++S LA+VG+ +  IESLDYEI EN LFK DWR+
Sbjct  14   EESLLSQPLLQQHEEQHHTLRRSASNTTSQLAIVGSNLCAIESLDYEIMENALFKQDWRN  73

Query  297  RSRTQVLQYVFLKWTLAFL  353
              + Q+ QY+F+KWT  FL
Sbjct  74   NRKIQIFQYIFMKWTFCFL  92



>ref|XP_010057598.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Eucalyptus grandis]
 gb|KCW74787.1| hypothetical protein EUGRSUZ_E03522 [Eucalyptus grandis]
Length=771

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  144  ESNSLHQPLLLKR--NLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            E+ S  +PLL      L  S+S +A+VGA +  IESLDYEI+END FK DWR+ S  Q+ 
Sbjct  8    EAESQARPLLSSEVSPLAQSTSQVAVVGANLCPIESLDYEISENDFFKQDWRTNSTVQIF  67

Query  318  QYVFLKWTLAFL  353
            QYVF+KW L FL
Sbjct  68   QYVFMKWLLCFL  79



>ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X2 [Citrus sinensis]
 gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
Length=794

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSS----PLAMVGAKVSHIESLDYEINENDLFKHDWRSRS  302
            +DPES  L  PLL  +    S S     +A+VGA V  IESLDYEI END FK DWR+R 
Sbjct  28   QDPES--LTVPLLSHQRSRSSISNSTSQVALVGADVCPIESLDYEIAENDFFKEDWRTRG  85

Query  303  RTQVLQYVFLKWTLAFL  353
            R Q++QY+F+KW+L FL
Sbjct  86   RNQMIQYIFMKWSLCFL  102



>ref|XP_006385193.1| Chloride channel protein CLC-c [Populus trichocarpa]
 gb|ERP62990.1| Chloride channel protein CLC-c [Populus trichocarpa]
Length=769

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +P L+ RN+  ++S +A+VGA    IESLDYEI +N+LF+ DWRSR + ++ QYV LK
Sbjct  28   LREPFLV-RNIKNNTSQIAIVGANTCPIESLDYEIADNELFRQDWRSRKKVEIYQYVVLK  86

Query  336  WTLAFL  353
            WTLA L
Sbjct  87   WTLALL  92



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +3

Query  138  DPESNSLHQPLLL---KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRT  308
            + +  SL +PLLL   +R+ + ++S +A+VG+ V  IESLDYEI+END FK DWR   + 
Sbjct  22   EADEESLTRPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDWRRGEKI  81

Query  309  QVLQYVFLKWTLAFL  353
            Q LQY+F+KW + F 
Sbjct  82   QTLQYIFMKWMMCFF  96



>ref|XP_011003711.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  156  LHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLK  335
            L +P L+ RN+  ++S +A+VG     IESLDYEI +N+LFK DWRSR + ++ QYV LK
Sbjct  27   LREPFLV-RNIKNNTSQIAIVGVNTCPIESLDYEITDNELFKQDWRSRKKVEIYQYVVLK  85

Query  336  WTLAFL  353
            WTLA L
Sbjct  86   WTLALL  91



>gb|KJB40520.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=746

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            +D E     QPLL KR  T  +S +A+VGA    +ESLDYEI EN+LFK DWRSR   Q+
Sbjct  20   KDMEDRIYSQPLLTKRYNT--TSQIAIVGANACPVESLDYEIIENELFKQDWRSRRTIQI  77

Query  315  LQYVFLKWTLAFL  353
             QYV LKW  A +
Sbjct  78   FQYVLLKWAFALI  90



>gb|KJB40519.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=767

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            +D E     QPLL KR  T  +S +A+VGA    +ESLDYEI EN+LFK DWRSR   Q+
Sbjct  20   KDMEDRIYSQPLLTKRYNT--TSQIAIVGANACPVESLDYEIIENELFKQDWRSRRTIQI  77

Query  315  LQYVFLKWTLAFL  353
             QYV LKW  A +
Sbjct  78   FQYVLLKWAFALI  90



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  156  LHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            L +PLL  +R++  S+S +A+VG+ VS IESLDYEI EN+ FKHDWRSR + Q+ Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  333  KWTLAFL  353
            KW L  L
Sbjct  75   KWLLCLL  81



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  156  LHQPLLL-KRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            L +PLL  +R++  S+S +A+VG+ VS IESLDYEI EN+ FKHDWRSR + Q+ Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  333  KWTLAFL  353
            KW L  L
Sbjct  75   KWLLCLL  81



>gb|AIY56605.1| CLC [Arachis hypogaea]
Length=788

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = +3

Query  153  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            S  +PLL+KR  T ++S +A++GA +S IESLDYEI EN++F  DWRSR + Q++QYV L
Sbjct  45   SYAEPLLVKR--TNTTSQIAIIGANLSPIESLDYEIFENEIFNQDWRSRKKIQIIQYVIL  102

Query  333  KWTLAFL  353
            KW  A +
Sbjct  103  KWGFALI  109



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  138  DPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVL  317
            D E   +  PLL +     ++S LA+VGA V  IESLDYE+ END++K DWRSR + Q+ 
Sbjct  31   DDEEMGIRDPLL-RWQTGNTTSQLAVVGANVCPIESLDYEVVENDIYKEDWRSRKKEQIF  89

Query  318  QYVFLKWTLAFL  353
            QYV LKWT A L
Sbjct  90   QYVLLKWTFALL  101



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  RDPESNSLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQV  314
            R+P    LH  + L+R+   S+S +A++G+ +  IESLDYE+ ENDLF  DWRSR R  +
Sbjct  21   REPLLEHLHS-INLRRHAPNSTSQVAIIGSNLCPIESLDYEMIENDLFNQDWRSRGRAAI  79

Query  315  LQYVFLKWTLAFL  353
            LQY+ LKWTL FL
Sbjct  80   LQYISLKWTLCFL  92



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +3

Query  153  SLHQPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFL  332
            +  +PLL+KR  T  +S +A+VG+ V  IESLDYEI EN+LFK DWRSR + Q+ QY+ L
Sbjct  40   TFREPLLVKRVNT--TSQIAIVGSNVCPIESLDYEIVENELFKQDWRSRKKIQIFQYILL  97

Query  333  KWTLAFL  353
            KW  A +
Sbjct  98   KWAFALI  104



>ref|XP_004975701.1| PREDICTED: chloride channel protein CLC-c-like isoform X4 [Setaria 
italica]
 ref|XP_004975702.1| PREDICTED: chloride channel protein CLC-c-like isoform X5 [Setaria 
italica]
Length=834

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR    ++S +A+VGA V  IESLDYEI ENDL K DWRSR + Q+ QY+ LKW+
Sbjct  54   EPLLRKRTRN-TTSQIAIVGANVCPIESLDYEIVENDLIKQDWRSRKKQQIFQYIVLKWS  112

Query  342  LAFL  353
            L  L
Sbjct  113  LVLL  116



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  162  QPLLLKRNLTLSSSPLAMVGAKVSHIESLDYEINENDLFKHDWRSRSRTQVLQYVFLKWT  341
            +PLL KR    ++S +A+VGA V  IESLDYEI ENDL K DWRSR + Q+ QY+ LKW+
Sbjct  104  EPLLRKRTRN-TTSQIAIVGANVCPIESLDYEIVENDLIKQDWRSRKKQQIFQYIVLKWS  162

Query  342  LAFL  353
            L  L
Sbjct  163  LVLL  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395