BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001B20

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082187.1|  PREDICTED: ABC transporter E family member 2       115   9e-28   Sesamum indicum [beniseed]
ref|XP_009770922.1|  PREDICTED: ABC transporter E family member 2       113   7e-27   Nicotiana sylvestris
ref|XP_009602236.1|  PREDICTED: ABC transporter E family member 2...    113   7e-27   Nicotiana tomentosiformis
emb|CDP07208.1|  unnamed protein product                                113   7e-27   Coffea canephora [robusta coffee]
gb|EPS64099.1|  hypothetical protein M569_10682                         112   1e-26   Genlisea aurea
ref|XP_006858622.1|  hypothetical protein AMTR_s00066p00025940          111   3e-26   Amborella trichopoda
ref|XP_006430899.1|  hypothetical protein CICLE_v10011325mg             110   5e-26   Citrus clementina [clementine]
gb|KDO72263.1|  hypothetical protein CISIN_1g040300mg                   110   6e-26   Citrus sinensis [apfelsine]
ref|XP_008783223.1|  PREDICTED: ABC transporter E family member 2...    108   3e-25   Phoenix dactylifera
ref|XP_008783221.1|  PREDICTED: ABC transporter E family member 2...    108   3e-25   Phoenix dactylifera
ref|XP_010915915.1|  PREDICTED: ABC transporter E family member 2...    108   3e-25   Elaeis guineensis
ref|XP_008805333.1|  PREDICTED: ABC transporter E family member 2...    108   3e-25   Phoenix dactylifera
ref|XP_010917851.1|  PREDICTED: ABC transporter E family member 2       108   4e-25   Elaeis guineensis
ref|XP_010925920.1|  PREDICTED: ABC transporter E family member 2...    108   4e-25   
ref|XP_009409469.1|  PREDICTED: ABC transporter E family member 2...    108   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380578.1|  PREDICTED: ABC transporter E family member 2       107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006430898.1|  hypothetical protein CICLE_v10011325mg             106   1e-24   
ref|XP_006430901.1|  hypothetical protein CICLE_v10011325mg             106   2e-24   
ref|XP_008387873.1|  PREDICTED: ABC transporter E family member 2...    105   4e-24   Malus domestica [apple tree]
gb|KJB25122.1|  hypothetical protein B456_004G177600                    103   4e-24   Gossypium raimondii
ref|XP_008387874.1|  PREDICTED: ABC transporter E family member 2...    105   4e-24   
ref|XP_004150248.1|  PREDICTED: ABC transporter E family member 2...    105   4e-24   Cucumis sativus [cucumbers]
ref|XP_003589457.1|  RNase L inhibitor protein-like protein             105   4e-24   
ref|XP_008377063.1|  PREDICTED: ABC transporter E family member 2...    103   5e-24   
gb|EWC48374.1|  translation initiation factor RLI1                      104   9e-24   Drechslerella stenobrocha 248
ref|XP_010925922.1|  PREDICTED: ABC transporter E family member 2...    104   1e-23   
ref|XP_011395697.1|  ABC transporter E family member 2                  104   1e-23   Auxenochlorella protothecoides
ref|XP_007040863.1|  RNAse l inhibitor protein 2 isoform 2              103   1e-23   
ref|XP_011028506.1|  PREDICTED: ABC transporter E family member 2       104   1e-23   Populus euphratica
ref|XP_006385159.1|  RNase L inhibitor family protein                   104   1e-23   
ref|XP_008801480.1|  PREDICTED: ABC transporter E family member 2       104   1e-23   
ref|XP_007040862.1|  RNAse l inhibitor protein 2 isoform 1              104   1e-23   
ref|XP_007782779.1|  translation initiation factor RLI1                 104   1e-23   Coniosporium apollinis CBS 100218
ref|XP_009409466.1|  PREDICTED: ABC transporter E family member 2...    104   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB25123.1|  hypothetical protein B456_004G177600                    104   1e-23   Gossypium raimondii
emb|CAN65893.1|  hypothetical protein VITISV_021090                     104   1e-23   Vitis vinifera
gb|KJB25121.1|  hypothetical protein B456_004G177600                    104   1e-23   Gossypium raimondii
ref|XP_008221272.1|  PREDICTED: ABC transporter E family member 2       104   1e-23   Prunus mume [ume]
gb|AIU41641.1|  ABC transporter family protein                          104   1e-23   Hevea brasiliensis [jebe]
ref|XP_002271392.1|  PREDICTED: ABC transporter E family member 2       104   1e-23   Vitis vinifera
gb|KJB25125.1|  hypothetical protein B456_004G177600                    104   1e-23   Gossypium raimondii
ref|XP_010099717.1|  ABC transporter E family member 2                  104   1e-23   
ref|XP_008444234.1|  PREDICTED: ABC transporter E family member 2       104   1e-23   Cucumis melo [Oriental melon]
emb|CBI29193.3|  unnamed protein product                                104   1e-23   Vitis vinifera
ref|XP_010275149.1|  PREDICTED: ABC transporter E family member 2...    104   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_007222049.1|  hypothetical protein PRUPE_ppa003094mg             104   1e-23   Prunus persica
ref|XP_008783222.1|  PREDICTED: ABC transporter E family member 2...    104   1e-23   
gb|KDP42075.1|  hypothetical protein JCGZ_01863                         103   1e-23   Jatropha curcas
ref|XP_010272250.1|  PREDICTED: ABC transporter E family member 2       103   1e-23   Nelumbo nucifera [Indian lotus]
gb|KJB25124.1|  hypothetical protein B456_004G177600                    103   1e-23   Gossypium raimondii
ref|XP_002380500.1|  RNase L inhibitor of the ABC superfamily, pu...    103   2e-23   Aspergillus flavus NRRL3357
ref|XP_658860.1|  hypothetical protein AN1256.2                         103   2e-23   Aspergillus nidulans FGSC A4
dbj|GAM41412.1|  iron-sulfur protein                                    103   2e-23   Talaromyces cellulolyticus
ref|XP_002151573.1|  RNase L inhibitor of the ABC superfamily, pu...    103   2e-23   Talaromyces marneffei ATCC 18224
ref|XP_010529268.1|  PREDICTED: ABC transporter E family member 2...    103   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010536040.1|  PREDICTED: ABC transporter E family member 2       103   2e-23   Tarenaya hassleriana [spider flower]
gb|KIV88308.1|  translation initiation factor RLI1                      103   2e-23   Exophiala mesophila
dbj|GAD96595.1|  ATP-binding cassette sub-family E member 1             103   2e-23   Byssochlamys spectabilis No. 5
ref|XP_002795389.1|  translation initiation factor RLI1                 103   2e-23   
gb|EAS27709.3|  translation initiation factor RLI1                      103   2e-23   Coccidioides immitis RS
gb|EFW19199.1|  ABC transporter                                         103   2e-23   Coccidioides posadasii str. Silveira
gb|EAY81246.1|  hypothetical protein OsI_36424                          102   2e-23   Oryza sativa Indica Group [Indian rice]
gb|KEY76156.1|  RNase L inhibitor of the ABC                            103   2e-23   Aspergillus fumigatus var. RP-2014
ref|XP_002528281.1|  rnase l inhibitor, putative                        103   3e-23   
gb|EMT25832.1|  ABC transporter E family member 2                       102   4e-23   
ref|XP_010054013.1|  PREDICTED: ABC transporter E family member 2       102   4e-23   Eucalyptus grandis [rose gum]
ref|XP_003577489.1|  PREDICTED: ABC transporter E family member 2       102   4e-23   Brachypodium distachyon [annual false brome]
gb|EMS47523.1|  ABC transporter E family member 2                       102   4e-23   Triticum urartu
ref|XP_011117798.1|  hypothetical protein AOL_s00006g187                102   4e-23   Arthrobotrys oligospora ATCC 24927
dbj|BAJ90466.1|  predicted protein                                      102   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIW46344.1|  translation initiation factor RLI1                      102   5e-23   Exophiala oligosperma
ref|XP_006662991.1|  PREDICTED: ABC transporter E family member 2...    102   5e-23   Oryza brachyantha
ref|XP_002560831.1|  Pc16g04800                                         103   5e-23   Penicillium rubens Wisconsin 54-1255
gb|AAM19067.1|  RNase L inhibitor-like protein                          102   5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EMT28710.1|  ABC transporter E family member 2                     95.9    5e-23   
gb|KIW18553.1|  translation initiation factor RLI1                      102   5e-23   Exophiala spinifera
ref|NP_001068062.1|  Os11g0546000                                       102   5e-23   
gb|EAZ18673.1|  hypothetical protein OsJ_34194                          102   5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KIW67851.1|  translation initiation factor RLI1                      102   6e-23   Phialophora americana
ref|XP_008728415.1|  translation initiation factor RLI1                 102   7e-23   Cladophialophora carrionii CBS 160.54
ref|XP_009156620.1|  translation initiation factor RLI1                 102   7e-23   Exophiala dermatitidis NIH/UT8656
ref|XP_010690817.1|  PREDICTED: ABC transporter E family member 2       102   7e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836109.1|  hypothetical protein AMTR_s00226p00014390          102   7e-23   Amborella trichopoda
dbj|GAM87745.1|  hypothetical protein ANO11243_057720                   102   7e-23   fungal sp. No.11243
gb|EZF29954.1|  translation initiation factor RLI1                      102   8e-23   Trichophyton interdigitale H6
ref|XP_002835993.1|  hypothetical protein                               101   8e-23   Tuber melanosporum Mel28
ref|XP_004512327.1|  PREDICTED: ABC transporter E family member 2...    102   9e-23   Cicer arietinum [garbanzo]
gb|KEH40227.1|  RNase L inhibitor ABC superfamily protein, putative     101   9e-23   Medicago truncatula
gb|EZF74246.1|  translation initiation factor RLI1                      101   1e-22   Trichophyton soudanense CBS 452.61
gb|EZF23483.1|  translation initiation factor RLI1                      101   1e-22   Trichophyton rubrum MR850
ref|XP_007922289.1|  ABC transporter domain-containing protein          101   1e-22   Pseudocercospora fijiensis CIRAD86
ref|XP_004291224.1|  PREDICTED: ABC transporter E family member 2       101   1e-22   Fragaria vesca subsp. vesca
gb|KGO47620.1|  ABC transporter, ABCE                                   101   1e-22   Penicillium expansum
gb|EZG06784.1|  translation initiation factor RLI1                      101   1e-22   Trichophyton rubrum CBS 735.88
ref|XP_011013966.1|  PREDICTED: ABC transporter E family member 2...    101   1e-22   Populus euphratica
gb|EZF95736.1|  translation initiation factor RLI1                      101   1e-22   Trichophyton rubrum MR1459
emb|CDX82529.1|  BnaA03g32920D                                          100   1e-22   
ref|XP_009349643.1|  PREDICTED: ABC transporter E family member 2...    101   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_008080558.1|  P-loop containing nucleoside triphosphate hy...    101   1e-22   Glarea lozoyensis ATCC 20868
ref|XP_007758868.1|  translation initiation factor RLI1                 101   2e-22   Cladophialophora yegresii CBS 114405
gb|KIW82669.1|  translation initiation factor RLI1                      101   2e-22   Fonsecaea pedrosoi CBS 271.37
gb|KGO78102.1|  ABC transporter, ABCE                                   101   2e-22   Penicillium italicum
gb|KGO54733.1|  ABC transporter, ABCE                                   101   2e-22   Penicillium expansum
ref|XP_007727229.1|  translation initiation factor RLI1                 100   2e-22   Capronia coronata CBS 617.96
gb|KIV79017.1|  translation initiation factor RLI1                      100   2e-22   Exophiala sideris
emb|CDX75723.1|  BnaC03g38060D                                          100   2e-22   
gb|EQL30489.1|  translation initiation factor RLI1                      100   2e-22   Blastomyces dermatitidis ATCC 26199
ref|XP_009135315.1|  PREDICTED: ABC transporter E family member 1...    100   2e-22   Brassica rapa
ref|XP_006385402.1|  hypothetical protein POPTR_0003s03960g             100   2e-22   Populus trichocarpa [western balsam poplar]
gb|KIW52261.1|  translation initiation factor RLI1                      100   2e-22   Exophiala xenobiotica
gb|AAL26702.1|  68 kDa protein HP68                                     100   2e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007918325.1|  putative translation initiation factor rli1 ...    100   2e-22   Phaeoacremonium minimum UCRPA7
ref|XP_003537713.1|  PREDICTED: ABC transporter E family member 2...    100   2e-22   Glycine max [soybeans]
ref|XP_001483595.1|  hypothetical protein PGUG_04324                    100   2e-22   Meyerozyma guilliermondii ATCC 6260
gb|EDK40226.2|  hypothetical protein PGUG_04324                         100   2e-22   Meyerozyma guilliermondii ATCC 6260
ref|XP_010692184.1|  PREDICTED: ABC transporter E family member 2...    100   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303221.1|  RNase L inhibitor family protein                   100   2e-22   
ref|XP_007158074.1|  hypothetical protein PHAVU_002G121800g             100   2e-22   Phaseolus vulgaris [French bean]
emb|CDM30323.1|  Translation initiation factor RLI1                     100   2e-22   Penicillium roqueforti FM164
gb|EMR81784.1|  putative translation initiation factor rli1 protein     100   2e-22   Botrytis cinerea BcDW1
ref|XP_003579496.1|  PREDICTED: ABC transporter E family member 2...    100   2e-22   Brachypodium distachyon [annual false brome]
emb|CDR38495.1|  CYFA0S02e02322g1_1                                     100   2e-22   Cyberlindnera fabianii
gb|EYU37486.1|  hypothetical protein MIMGU_mgv1a003146mg                100   2e-22   Erythranthe guttata [common monkey flower]
gb|ABR18176.1|  unknown                                                 100   3e-22   Picea sitchensis
ref|XP_002623806.1|  ATP-binding cassette sub-family E member 1         100   3e-22   Blastomyces gilchristii SLH14081
gb|EPS32191.1|  hypothetical protein PDE_07151                          100   3e-22   Penicillium oxalicum 114-2
gb|KFA62559.1|  hypothetical protein S40285_05691                       100   3e-22   Stachybotrys chlorohalonata IBT 40285
gb|KIX95155.1|  translation initiation factor RLI1                      100   3e-22   Fonsecaea multimorphosa CBS 102226
gb|KIW31282.1|  translation initiation factor RLI1                      100   4e-22   Cladophialophora immunda
gb|AGC70150.1|  ABC transporter E family member 2 protein               100   4e-22   Cardamine hirsuta
gb|KHN05542.1|  ABC transporter E family member 2                       100   4e-22   Glycine soja [wild soybean]
gb|KDD74545.1|  hypothetical protein H632_c1239p0                     99.8    4e-22   Helicosporidium sp. ATCC 50920
ref|XP_006366958.1|  PREDICTED: ABC transporter E family member 2...  99.8    5e-22   Solanum tuberosum [potatoes]
ref|XP_007216970.1|  hypothetical protein PRUPE_ppa003087mg           99.8    5e-22   Prunus persica
gb|KIW91070.1|  translation initiation factor RLI1                    99.8    5e-22   Cladophialophora bantiana CBS 173.52
ref|XP_010323314.1|  PREDICTED: ABC transporter E family member 2     99.8    5e-22   
ref|XP_009333973.1|  PREDICTED: ABC transporter E family member 2     99.8    6e-22   Pyrus x bretschneideri [bai li]
gb|AGV54379.1|  ABC transporter E family member 2-like protein        99.4    6e-22   Phaseolus vulgaris [French bean]
ref|XP_007838632.1|  Translation initiation factor RLI1               99.4    7e-22   Pestalotiopsis fici W106-1
ref|XP_008660181.1|  PREDICTED: ABC transporter E family member 2...  99.4    7e-22   Zea mays [maize]
ref|XP_008655346.1|  PREDICTED: ABC transporter E family member 2...  99.4    7e-22   Zea mays [maize]
ref|XP_002468219.1|  hypothetical protein SORBIDRAFT_01g042020        99.4    8e-22   Sorghum bicolor [broomcorn]
ref|XP_004979432.1|  PREDICTED: ABC transporter E family member 2...  99.4    8e-22   Setaria italica
gb|KIW01313.1|  translation initiation factor RLI1                    99.0    9e-22   Verruconis gallopava
gb|KEY70632.1|  hypothetical protein S7711_02235                      99.0    1e-21   Stachybotrys chartarum IBT 7711
dbj|GAN01144.1|  translation initiation factor RLI1                   98.6    1e-21   Mucor ambiguus
gb|EWM23870.1|  rnase l inhibitor-like protein                        98.2    1e-21   Nannochloropsis gaditana
gb|EWM23869.1|  rnase l inhibitor-like protein                        99.0    1e-21   Nannochloropsis gaditana
dbj|GAC99212.1|  RNase L inhibitor                                    98.6    1e-21   Pseudozyma hubeiensis SY62
gb|EPB83194.1|  translation initiation factor RLI1                    98.6    1e-21   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004347570.2|  ATP-binding cassette sub-family E member 1       98.6    1e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_003856882.1|  ABC transporter domain-containing protein        98.2    2e-21   Zymoseptoria tritici IPO323
emb|CDX99388.1|  BnaC01g11640D                                        98.2    2e-21   
emb|CDY09282.1|  BnaC03g63120D                                        98.2    2e-21   Brassica napus [oilseed rape]
emb|CBQ73757.1|  probable RLI1-Protein promoting preinitiation co...  98.2    2e-21   Sporisorium reilianum SRZ2
ref|XP_002848303.1|  translation initiation factor RLI1               98.2    2e-21   Microsporum canis CBS 113480
ref|XP_010419025.1|  PREDICTED: putative F-box protein At3g13624      98.2    2e-21   
emb|CAX73008.1|  ATP-binding cassette, sub-family E (OABP), member 1  92.4    2e-21   Schistosoma japonicum
ref|XP_007882292.1|  hypothetical protein PFL1_06558                  97.8    2e-21   Anthracocystis flocculosa PF-1
gb|EEH21097.2|  translation initiation factor RLI1                    98.2    2e-21   Paracoccidioides brasiliensis Pb03
ref|XP_009108421.1|  PREDICTED: ABC transporter E family member 2     97.8    2e-21   
emb|CAA16710.1|  RNase L inhibitor-like protein                       97.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76485.1|  BnaA08g09150D                                        97.8    2e-21   
emb|CDX98609.1|  BnaA03g43940D                                        97.8    2e-21   
emb|CDY01588.1|  BnaC07g35780D                                        97.8    3e-21   
ref|NP_193656.2|  RNAse l inhibitor protein 2                         97.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436484.1|  PREDICTED: ABC transporter E family member 2...  97.4    3e-21   
ref|XP_010439735.1|  PREDICTED: ABC transporter E family member 2...  97.8    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009137000.1|  PREDICTED: ABC transporter E family member 2...  97.8    3e-21   Brassica rapa
ref|XP_006286029.1|  hypothetical protein CARUB_v10007560mg           97.8    3e-21   Capsella rubella
ref|XP_006299034.1|  hypothetical protein CARUB_v10015171mg           97.8    3e-21   Capsella rubella
ref|XP_010757114.1|  translation initiation factor RLI1               98.2    3e-21   Paracoccidioides brasiliensis Pb18
gb|AAX26766.2|  SJCHGC05773 protein                                   94.4    3e-21   Schistosoma japonicum
gb|KFH72616.1|  ABC transporter E family member 2                     97.4    3e-21   Mortierella verticillata NRRL 6337
ref|XP_003678680.1|  hypothetical protein TDEL_0A01370                97.4    3e-21   Torulaspora delbrueckii
ref|XP_963869.3|  translation initiation factor RLI1                  97.4    3e-21   Neurospora crassa OR74A
ref|XP_003004835.1|  ATP-binding cassette sub-family E member 1       95.1    3e-21   Verticillium alfalfae VaMs.102
ref|XP_003746536.1|  PREDICTED: ATP-binding cassette sub-family E...  97.4    3e-21   Galendromus occidentalis
dbj|BAJ93642.1|  predicted protein                                    97.4    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007580477.1|  putative translation initiation factor rli1 ...  97.4    4e-21   
gb|ETS59925.1|  hypothetical protein PaG_05898                        97.4    4e-21   Moesziomyces aphidis DSM 70725
dbj|GAC75056.1|  RNAse L inhibitor                                    97.4    4e-21   Moesziomyces antarcticus T-34
ref|XP_006413992.1|  hypothetical protein EUTSA_v10024707mg           97.4    4e-21   Eutrema salsugineum [saltwater cress]
dbj|GAK64634.1|  RNAse l inhibitor-type atp binding cassette protein  97.4    4e-21   Moesziomyces antarcticus
emb|CDY05197.1|  BnaC05g46060D                                        97.1    4e-21   
ref|XP_011389740.1|  putative protein promoting preinitiation com...  97.1    4e-21   Ustilago maydis 521
gb|EWY99002.1|  translation initiation factor RLI1                    97.4    4e-21   Fusarium oxysporum FOSC 3-a
ref|XP_002174795.1|  iron-sulfur protein                              97.1    4e-21   Schizosaccharomyces japonicus yFS275
dbj|GAA55212.1|  ATP-binding cassette sub-family E member 1           97.4    5e-21   Clonorchis sinensis [oriental liver fluke]
emb|CDY60809.1|  BnaA01g37290D                                        97.1    5e-21   Brassica napus [oilseed rape]
ref|XP_009117623.1|  PREDICTED: ABC transporter E family member 1     97.1    5e-21   Brassica rapa
gb|EXA50356.1|  translation initiation factor RLI1                    97.1    5e-21   Fusarium oxysporum f. sp. pisi HDV247
ref|XP_452984.1|  hypothetical protein                                97.1    5e-21   Kluyveromyces lactis
emb|CEG63656.1|  Putative YALI0A17941p                                96.7    5e-21   Rhizopus microsporus
emb|CCF52067.1|  probable RLI1-Protein promoting preinitiation co...  96.7    5e-21   Ustilago hordei
gb|KIR83840.1|  ATP-binding cassette, sub-family E, member 1          96.7    6e-21   Cryptococcus gattii VGIV IND107
ref|XP_003592706.1|  RNase L inhibitor-like protein                   96.7    6e-21   Medicago truncatula
ref|XP_003191722.1|  iron-sulfur protein required for ribosome bi...  96.7    6e-21   Cryptococcus gattii WM276
gb|ELQ37080.1|  hypothetical protein OOU_Y34scaffold00619g54          97.8    6e-21   Magnaporthe oryzae Y34
gb|EST04914.1|  RNAse L inhibitor                                     96.7    6e-21   Kalmanozyma brasiliensis GHG001
emb|CDI54172.1|  probable RLI1-Protein promoting preinitiation co...  96.3    8e-21   Melanopsichium pennsylvanicum 4
gb|KFH47898.1|  Translation initiation factor-like protein            96.3    8e-21   Acremonium chrysogenum ATCC 11550
gb|KIW99622.1|  translation initiation factor RLI1                    96.3    8e-21   Rhinocladiella mackenziei CBS 650.93
gb|KFK38664.1|  hypothetical protein AALP_AA3G144000                  95.9    9e-21   Arabis alpina [alpine rockcress]
ref|XP_003580843.1|  PREDICTED: ABC transporter E family member 2...  96.3    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_003348295.1|  hypothetical protein SMAC_02792                  96.3    1e-20   Sordaria macrospora k-hell
emb|CCD59622.1|  ATP-binding cassette, sub-family E (oabp),member...  95.9    1e-20   Schistosoma mansoni
ref|XP_009649388.1|  translation initiation factor RLI1               95.9    1e-20   Verticillium dahliae VdLs.17
ref|XP_011326803.1|  translation initiation factor RLI1               95.9    1e-20   Fusarium graminearum PH-1
ref|XP_009254074.1|  hypothetical protein FPSE_02680                  95.9    1e-20   Fusarium pseudograminearum CS3096
ref|XP_008380283.1|  PREDICTED: ABC transporter E family member 2...  95.9    1e-20   
ref|XP_006418725.1|  hypothetical protein EUTSA_v10002453mg           95.9    1e-20   Eutrema salsugineum [saltwater cress]
gb|KGK34284.1|  hypothetical protein JL09_g6569                       89.7    1e-20   Pichia kudriavzevii
emb|CDH54417.1|  translation initiation factor rli1                   95.5    1e-20   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS10188.1|  Putative Translation initiation factor RLI1          95.5    1e-20   Lichtheimia ramosa
emb|CDP23571.1|  Putative protein similar to translation initiati...  95.5    1e-20   Podospora anserina S mat+
ref|XP_567049.1|  hypothetical protein CNA07330                       95.5    1e-20   Cryptococcus neoformans var. neoformans JEC21
gb|KGB75338.1|  ABC transporter                                       95.5    1e-20   Cryptococcus gattii VGII R265
gb|KIR45264.1|  ATP-binding cassette, sub-family E, member 1          95.5    1e-20   Cryptococcus gattii CA1280
gb|KIR35782.1|  ATP-binding cassette, sub-family E, member 1          95.5    1e-20   Cryptococcus gattii VGII MMRL2647
ref|XP_010487122.1|  PREDICTED: ABC transporter E family member 1...  95.5    1e-20   Camelina sativa [gold-of-pleasure]
gb|AFR92884.1|  ATP-binding cassette, sub-family E, member 1          95.5    1e-20   Cryptococcus neoformans var. grubii H99
gb|KIR69006.1|  ATP-binding cassette, sub-family E, member 1          95.5    2e-20   Cryptococcus gattii CA1873
gb|EGE80736.1|  ATP-binding cassette sub-family E member 1            95.9    2e-20   
emb|CEJ95089.1|  Putative ATP-binding cassette sub-family E member 1  95.5    2e-20   Torrubiella hemipterigena
gb|KGQ10400.1|  Translation initiation factor RLI1                    95.5    2e-20   Beauveria bassiana D1-5
ref|XP_010500834.1|  PREDICTED: ABC transporter E family member 1...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001080761.1|  ATP-binding cassette, sub-family E (OABP), m...  95.5    2e-20   Xenopus laevis [clawed frog]
ref|XP_008594495.1|  ABC transporter                                  95.5    2e-20   Beauveria bassiana ARSEF 2860
ref|XP_011449756.1|  PREDICTED: ATP-binding cassette sub-family E...  95.5    2e-20   Crassostrea gigas
ref|XP_010500812.1|  PREDICTED: ABC transporter E family member 1...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009518050.1|  abc transporter                                  95.5    2e-20   Phytophthora sojae
gb|KDN69856.1|  putative ABC transporter                              95.1    2e-20   Colletotrichum sublineola
gb|EXX58362.1|  Rli1p                                                 95.1    2e-20   Rhizophagus irregularis DAOM 197198w
ref|XP_006815890.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    2e-20   Saccoglossus kowalevskii
ref|XP_005327610.1|  PREDICTED: ATP-binding cassette sub-family E...  95.1    2e-20   Ictidomys tridecemlineatus
gb|KEZ44645.1|  hypothetical protein SAPIO_CDS3689                    94.7    3e-20   Scedosporium apiospermum
dbj|BAE89880.1|  unnamed protein product                              94.7    3e-20   Macaca fascicularis [crab eating macaque]
ref|XP_001182876.2|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   
ref|XP_006131844.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007070201.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   Chelonia mydas [green seaturtle]
dbj|BAE39748.1|  unnamed protein product                              94.7    3e-20   Mus musculus [mouse]
ref|XP_006872330.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   Chrysochloris asiatica
ref|XP_004645502.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   
ref|XP_003417547.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   Loxodonta africana [African bush elephant]
ref|XP_005284350.1|  PREDICTED: ATP-binding cassette sub-family E...  94.7    3e-20   Chrysemys picta bellii
gb|ERE79301.1|  ATP-binding cassette sub-family E member 1            94.7    3e-20   Cricetulus griseus [Chinese hamsters]
ref|XP_004336916.1|  ribonuclease L inhibitor family protein          94.7    4e-20   Acanthamoeba castellanii str. Neff
ref|XP_007797301.1|  putative translation initiation factor rli1 ...  94.7    4e-20   
gb|AHK05659.1|  ATP-binding cassette transporter sub-family E mem...  94.4    4e-20   Tigriopus japonicus
ref|XP_004708755.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004655905.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Jaculus jaculus
gb|ETK89054.1|  ABC transporter E family member 2                     94.7    4e-20   Phytophthora parasitica
ref|XP_008903480.1|  ABC transporter E family member 2                94.7    4e-20   Phytophthora parasitica INRA-310
ref|XP_008142077.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Eptesicus fuscus
ref|XP_002916281.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Ailuropoda melanoleuca
ref|XP_004485045.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...  94.4    4e-20   Dasypus novemcinctus
ref|XP_007666625.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003773213.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Sarcophilus harrisii
gb|AAS07031.1|  RNase L inhibitor                                     94.4    4e-20   Chlorocebus aethiops [African green monkey]
gb|ENH77045.1|  translation initiation factor rli1                    94.4    4e-20   
gb|EHN03190.1|  Rli1p                                                 94.4    4e-20   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_005105418.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   
gb|AAC24730.1|  RNAse L inhibitor                                     94.4    4e-20   Mus musculus [mouse]
ref|XP_004606253.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Sorex araneus [Eurasian shrew]
ref|XP_004420936.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Ceratotherium simum simum [southern square-lipped rhinoceros]
dbj|BAE39466.1|  unnamed protein product                              94.4    4e-20   Mus musculus [mouse]
ref|NP_001101916.1|  ATP-binding cassette sub-family E member 1       94.4    4e-20   Rattus norvegicus [brown rat]
ref|NP_002931.2|  ATP-binding cassette sub-family E member 1          94.4    4e-20   Homo sapiens [man]
ref|XP_003129218.3|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   
ref|XP_003500814.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Cricetulus griseus [Chinese hamsters]
ref|XP_003205467.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Meleagris gallopavo [common turkey]
ref|XP_001501999.1|  PREDICTED: ATP-binding cassette sub-family E...  94.4    4e-20   Equus caballus [domestic horse]
ref|XP_009205905.1|  PREDICTED: ATP-binding cassette sub-family E...  94.0    4e-20   
ref|XP_009265862.1|  Translation initiation factor RLI1               94.4    5e-20   Wallemia ichthyophaga EXF-994
gb|EKC18713.1|  ATP-binding cassette sub-family E member 1            94.7    5e-20   Crassostrea gigas
gb|ESX03551.1|  Translation initiation factor RLI1                    94.4    5e-20   Ogataea parapolymorpha DL-1
ref|XP_007596669.1|  translation initiation factor RLI1               94.4    5e-20   
emb|CAF92703.1|  unnamed protein product                              94.4    5e-20   Tetraodon nigroviridis
ref|XP_005105420.1|  PREDICTED: ATP-binding cassette sub-family E...  94.0    5e-20   
gb|KFG80922.1|  translation initiation factor RLI1                    94.0    6e-20   
ref|XP_002616799.1|  hypothetical protein CLUG_04040                  94.0    6e-20   
ref|XP_006887102.1|  PREDICTED: ATP-binding cassette sub-family E...  94.0    6e-20   
gb|EFQ28814.1|  ABC transporter                                       94.0    6e-20   
gb|AGO13983.1|  AaceriAGR125Wp                                        94.0    6e-20   
gb|KIE03457.1|  translation initiation factor RLI1                    94.0    6e-20   
gb|KID66435.1|  translation initiation factor RLI1                    94.0    6e-20   
gb|KID90356.1|  translation initiation factor RLI1                    94.0    6e-20   
ref|XP_002121964.1|  PREDICTED: ATP-binding cassette sub-family E...  94.0    6e-20   
emb|CCF38800.1|  translation initiation factor RLI1                   94.0    6e-20   
ref|XP_007272504.1|  translation initiation factor rli1               94.0    7e-20   
ref|XP_007820587.2|  ABC transporter, ABCE                            94.0    7e-20   
gb|EMS24018.1|  ATP-binding cassette, sub-family E, member 1          93.6    7e-20   
ref|NP_986791.1|  AGR125Wp                                            93.6    7e-20   
emb|CAY78598.1|  Rli1p                                                93.6    7e-20   
ref|NP_010376.3|  Rli1p                                               93.6    7e-20   
gb|EIW11297.1|  Rli1p                                                 93.6    7e-20   
ref|NP_187973.1|  ABC transporter E family member 1                   93.6    7e-20   
gb|KFY14130.1|  hypothetical protein V492_02841                       94.0    7e-20   
gb|KID76816.1|  translation initiation factor RLI1                    94.0    7e-20   
ref|XP_006299795.1|  hypothetical protein CARUB_v10015991mg           93.6    7e-20   
gb|EPY50378.1|  iron-sulfur protein                                   93.6    7e-20   
gb|EPQ06893.1|  ATP-binding cassette sub-family E member 1            94.0    8e-20   
gb|EGA83587.1|  Rli1p                                                 93.6    8e-20   
ref|XP_006296689.1|  hypothetical protein CARUB_v10013264mg           93.6    8e-20   
ref|XP_004316570.1|  PREDICTED: ATP-binding cassette sub-family E...  93.2    9e-20   
ref|XP_011300503.1|  PREDICTED: ATP-binding cassette sub-family E...  93.6    9e-20   
ref|XP_002184067.1|  phosphatase                                      93.6    9e-20   
ref|XP_004181430.1|  hypothetical protein TBLA_0F03760                93.2    9e-20   
emb|CDJ05529.1|  ATP binding cassette sub family E                    93.2    1e-19   
ref|XP_002555663.1|  KLTH0G14520p                                     93.2    1e-19   
dbj|BAO39596.1|  translation initiation factor RLI1                   93.2    1e-19   
emb|CDS17762.1|  ATP binding cassette sub family E                    93.2    1e-19   
gb|KIL84174.1|  hypothetical protein FAVG1_12602                      93.2    1e-19   
gb|ELK17524.1|  ATP-binding cassette sub-family E member 1            93.2    1e-19   
ref|XP_009226282.1|  translation initiation factor RLI1               92.8    1e-19   
ref|XP_005864931.1|  PREDICTED: ATP-binding cassette sub-family E...  93.2    1e-19   
emb|CCK71712.1|  hypothetical protein KNAG_0H02970                    92.8    1e-19   
ref|XP_004202772.1|  Piso0_001629                                     92.8    1e-19   
gb|EPE05580.1|  translation initiation factor rli1                    93.2    1e-19   
ref|XP_003713614.1|  translation initiation factor RLI1               92.8    1e-19   
ref|XP_752397.1|  RNase L inhibitor of the ABC superfamily            93.2    1e-19   
ref|XP_002997210.1|  ATP-binding cassette sub-family E member 1       92.8    2e-19   
emb|CEP07445.1|  hypothetical protein                                 92.8    2e-19   
ref|XP_006670777.1|  RNase L inhibitor of the ABC superfamily, pu...  92.8    2e-19   
ref|XP_011271910.1|  Translation initiation factor RLI1               92.4    2e-19   
emb|CEG00217.1|  ABC transporter, ABCE                                92.4    2e-19   
ref|XP_011163484.1|  PREDICTED: ATP-binding cassette sub-family E...  92.4    2e-19   
ref|XP_462080.1|  DEHA2G12518p                                        92.4    2e-19   
emb|CCA19671.1|  hypothetical protein ALNC14_058140                   92.8    2e-19   
emb|CCU81929.1|  ABC Transporter                                      92.4    2e-19   
emb|CCE33376.1|  probable RNase L inhibitor                           92.4    2e-19   
gb|KIY92619.1|  ATP-binding cassette sub-family E member 1            89.0    2e-19   
ref|XP_003394142.1|  PREDICTED: ATP-binding cassette sub-family E...  92.4    2e-19   
ref|XP_003487517.1|  PREDICTED: ATP-binding cassette sub-family E...  92.4    2e-19   
ref|XP_500182.1|  YALI0A17941p                                        92.4    2e-19   
emb|CDO93335.1|  unnamed protein product                              92.0    2e-19   
ref|XP_010007234.1|  PREDICTED: ATP-binding cassette sub-family E...  92.0    2e-19   
gb|KDO32655.1|  ABC transporter E family member 2                     92.4    2e-19   
ref|XP_010465884.1|  PREDICTED: ABC transporter E family member 1...  92.0    2e-19   
ref|XP_004990715.1|  ABC transporter ABCE1                            92.0    3e-19   
gb|EIE87499.1|  translation initiation factor RLI1                    92.0    3e-19   
ref|XP_004202149.1|  Piso0_001629                                     92.0    3e-19   
dbj|BAE64192.1|  unnamed protein product                              92.0    3e-19   
ref|XP_011102953.1|  rli1p                                            92.0    3e-19   
emb|CCT65774.1|  probable RNase L inhibitor                           92.0    3e-19   
gb|EGU74916.1|  hypothetical protein FOXB_14557                       92.0    3e-19   
gb|KHC40377.1|  translation initiation factor RLI1                    92.0    3e-19   
ref|XP_721532.1|  RNAse L inhibitor-type ATP binding cassette pro...  92.0    3e-19   
emb|CDK24261.1|  unnamed protein product                              91.7    3e-19   
gb|EIF45876.1|  translation initiation factor rli1                    86.7    3e-19   
ref|XP_003336598.2|  ABC transporter E family member 2                91.7    3e-19   
ref|XP_002495447.1|  ZYRO0B11616p                                     91.7    4e-19   
ref|XP_003082761.1|  68 kDa protein HP68 (ISS)                        92.4    4e-19   
ref|XP_001646312.1|  hypothetical protein Kpol_1032p48                91.7    4e-19   
dbj|GAA99602.1|  hypothetical protein E5Q_06303                       91.7    4e-19   
emb|CEI99061.1|  Putative Translation initiation factor RLI1          90.1    4e-19   
ref|XP_004246016.1|  PREDICTED: ABC transporter E family member 2     91.7    4e-19   
ref|XP_003647117.1|  hypothetical protein Ecym_5560                   91.7    4e-19   
ref|XP_002506706.1|  predicted protein                                91.7    4e-19   
ref|XP_003773214.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    5e-19   
emb|CCJ29670.1|  unnamed protein product                              91.3    5e-19   
ref|XP_003868123.1|  Rli1 protein                                     91.3    5e-19   
ref|XP_004758181.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    5e-19   
emb|CCE40837.1|  hypothetical protein CPAR2_108760                    91.3    5e-19   
ref|XP_003674860.1|  hypothetical protein NCAS_0B04030                91.3    5e-19   
ref|XP_003683714.1|  hypothetical protein TPHA_0A01980                91.3    5e-19   
gb|EPX73136.1|  iron-sulfur protein                                   91.3    5e-19   
gb|KFX90037.1|  hypothetical protein V490_06681                       91.3    5e-19   
gb|KFX92752.1|  hypothetical protein O988_07144                       91.3    5e-19   
ref|XP_001421010.1|  predicted protein                                91.3    6e-19   
emb|CCI47858.1|  unnamed protein product                              91.7    6e-19   
ref|XP_446712.1|  hypothetical protein                                91.3    6e-19   
emb|CDH14615.1|  Translation initiation factor RLI1                   90.9    6e-19   
ref|NP_001077154.1|  ATP-binding cassette sub-family E member 1       90.9    6e-19   
emb|CDF88506.1|  BN860_11826g1_1                                      90.9    6e-19   
ref|XP_003572083.1|  PREDICTED: ABC transporter E family member 2...  90.9    7e-19   
gb|EZA47104.1|  ATP-binding cassette sub-family E member              90.9    7e-19   
ref|XP_001608142.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
gb|KFO20588.1|  ATP-binding cassette sub-family E member 1            90.9    7e-19   
ref|XP_011350337.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
ref|XP_011263099.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
ref|XP_011066035.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
ref|XP_011350339.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
gb|EFB29665.1|  hypothetical protein PANDA_004343                     90.9    7e-19   
gb|EHH26220.1|  hypothetical protein EGK_16133                        90.9    7e-19   
ref|XP_011498090.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    7e-19   
emb|CAA53972.1|  RNase L inhibitor                                    90.9    7e-19   
ref|NP_596732.1|  iron-sulfur ATPase involved in ribosome biogene...  90.5    8e-19   
ref|XP_009278535.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    8e-19   
ref|XP_005666905.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    8e-19   
ref|XP_005327611.1|  PREDICTED: ATP-binding cassette sub-family E...  90.9    8e-19   
ref|XP_006169559.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    8e-19   
ref|XP_004040499.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...  90.5    8e-19   
ref|XP_010465207.1|  PREDICTED: ABC transporter E family member 1...  90.5    9e-19   
ref|XP_003701716.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    9e-19   
ref|XP_011135124.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    9e-19   
ref|XP_003690922.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    9e-19   
gb|EGI58223.1|  ATP-binding cassette sub-family E member 1            90.5    9e-19   
gb|EFX01682.1|  rnase l inhibitor of the ABC                          90.5    1e-18   
dbj|BAE01051.1|  unnamed protein product                              90.5    1e-18   
ref|XP_002416987.1|  ABC-family memebr, APTPase, iron-sulfur prot...  90.5    1e-18   
ref|XP_002550495.1|  ATP-binding cassette sub-family E member 1       90.5    1e-18   
ref|XP_001526720.1|  ATP-binding cassette sub-family E member 1       90.5    1e-18   
ref|XP_008560191.1|  PREDICTED: ATP-binding cassette sub-family E...  90.5    1e-18   
gb|KFY94314.1|  hypothetical protein V500_03330                       90.5    1e-18   
ref|XP_006187279.1|  PREDICTED: ATP-binding cassette sub-family E...  90.1    1e-18   
ref|XP_007243514.1|  PREDICTED: ATP-binding cassette sub-family E...  84.7    1e-18   
gb|KFY22932.1|  hypothetical protein V493_06226                       90.1    1e-18   
ref|XP_002153953.1|  PREDICTED: ATP-binding cassette sub-family E...  90.1    1e-18   
gb|KFU86169.1|  ATP-binding cassette sub-family E member 1            90.1    1e-18   
ref|XP_968009.1|  PREDICTED: ATP-binding cassette sub-family E me...  90.1    1e-18   
gb|ABJ98595.1|  ATP-binding cassette sub-family E member 1            85.1    1e-18   
gb|KDR23332.1|  ATP-binding cassette sub-family E member 1            89.7    2e-18   
gb|AEE62378.1|  unknown                                               89.7    2e-18   
ref|XP_007544792.1|  PREDICTED: ATP-binding cassette sub-family E...  84.0    2e-18   
gb|KFM79460.1|  ATP-binding cassette sub-family E member 1            89.7    2e-18   
gb|EQK98827.1|  translation initiation factor RLI1                    89.7    2e-18   
ref|XP_006359955.1|  PREDICTED: ABC transporter E family member 2...  89.7    2e-18   
gb|KFQ10304.1|  ATP-binding cassette sub-family E member 1            89.7    2e-18   
ref|XP_002009032.1|  GI11489                                          89.7    2e-18   
ref|XP_009692002.1|  RNase L inhibitor protein                        90.5    2e-18   
ref|XP_001984558.1|  GH14962                                          89.7    2e-18   
ref|XP_007874108.1|  hypothetical protein PNEG_02127                  89.7    2e-18   
ref|XP_010465883.1|  PREDICTED: ABC transporter E family member 1...  89.7    2e-18   
ref|XP_006906351.1|  PREDICTED: ATP-binding cassette sub-family E...  89.4    2e-18   
ref|XP_011201626.1|  PREDICTED: ATP-binding cassette sub-family E...  89.7    2e-18   
emb|CEP63304.1|  LALA0S07e07096g1_1                                   89.4    2e-18   
ref|XP_002047872.1|  GJ13683                                          89.4    2e-18   
ref|XP_003954816.1|  hypothetical protein KAFR_0A02430                89.4    2e-18   
ref|XP_011196211.1|  PREDICTED: ATP-binding cassette sub-family E...  89.4    2e-18   
ref|XP_001956850.1|  GF10137                                          89.4    2e-18   
dbj|BAM18097.1|  pixie                                                89.4    2e-18   
ref|XP_009834701.1|  ABC transporter E family member 2                89.4    2e-18   
gb|EFA85500.1|  RNaseL inhibitor-like protein                         89.4    2e-18   
ref|XP_004525604.1|  PREDICTED: ATP-binding cassette sub-family E...  89.4    2e-18   
gb|ADO33033.1|  pixie                                                 89.4    3e-18   
gb|ELR07755.1|  translation initiation factor RLI1                    89.4    3e-18   
ref|XP_005183309.1|  PREDICTED: ATP-binding cassette sub-family E...  89.4    3e-18   
gb|KIA75717.1|  RNase L inhibitor of the ABC superfamily              89.4    3e-18   
ref|XP_002069035.1|  GK12286                                          89.4    3e-18   
ref|XP_008301422.1|  PREDICTED: ATP-binding cassette sub-family E...  88.2    3e-18   
emb|CDH13052.1|  Translation initiation factor RLI1                   89.4    3e-18   
ref|XP_006756018.1|  PREDICTED: ATP-binding cassette sub-family E...  89.0    3e-18   
gb|EHJ73926.1|  ribonuclease L inhibitor-like protein                 89.0    3e-18   
ref|XP_005704280.1|  ABC transporter, sub-family E, substrate-bin...  89.0    3e-18   
gb|KFW96353.1|  ATP-binding cassette sub-family E member 1            89.0    3e-18   
ref|NP_001036911.1|  ribonuclease L inhibitor homolog                 89.0    3e-18   
ref|NP_001005628.1|  ATP-binding cassette, sub-family E (OABP), m...  89.0    4e-18   
gb|KFV64493.1|  ATP-binding cassette sub-family E member 1            89.0    4e-18   
ref|XP_003978457.1|  PREDICTED: ATP-binding cassette sub-family E...  89.0    4e-18   
gb|KFQ26608.1|  ATP-binding cassette sub-family E member 1            89.0    4e-18   
ref|XP_008614115.1|  ABC transporter E family member 2                89.0    4e-18   
gb|KEH28590.1|  RNase L inhibitor ABC domain protein                  88.6    4e-18   
emb|CDS33919.1|  ATP binding cassette sub family E                    88.6    4e-18   
ref|XP_007897363.1|  PREDICTED: ATP-binding cassette sub-family E...  88.6    4e-18   
ref|XP_008434241.1|  PREDICTED: ATP-binding cassette sub-family E...  86.7    4e-18   
gb|KGL97849.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
gb|KFP68620.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
gb|KFV08643.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
gb|KFP79450.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
ref|XP_008864766.1|  ABC transporter E family member 2                88.6    5e-18   
gb|KFW74048.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
ref|XP_003667744.1|  hypothetical protein NDAI_0A03440                88.6    5e-18   
gb|KFP19938.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
gb|KFO64898.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
gb|KFO03636.1|  ATP-binding cassette sub-family E member 1            88.6    5e-18   
ref|XP_001264741.1|  RNase L inhibitor of the ABC superfamily, pu...  88.6    6e-18   
gb|KFV99662.1|  ATP-binding cassette sub-family E member 1            88.2    6e-18   
gb|KGG51205.1|  hypothetical protein DI09_41p170                      88.2    6e-18   
gb|EOB04954.1|  ATP-binding cassette sub-family E member 1            88.2    7e-18   
gb|KFX47844.1|  Translation initiation factor RLI1                    88.2    7e-18   
ref|XP_010511564.1|  PREDICTED: ABC transporter E family member 1...  87.8    7e-18   
ref|XP_010749699.1|  PREDICTED: ATP-binding cassette sub-family E...  87.8    8e-18   
dbj|GAA89537.1|  RNase L inhibitor of the ABC superfamily             87.8    9e-18   
ref|NP_648272.1|  pixie, isoform A                                    87.8    9e-18   
ref|XP_010159708.1|  PREDICTED: ATP-binding cassette sub-family E...  87.0    9e-18   
ref|XP_002093378.1|  GE21271                                          87.8    9e-18   
emb|CAJ15800.1|  RNase L inhibitor                                    87.0    9e-18   
ref|XP_002424051.1|  ATP-binding cassette subfamily E, member 1       87.8    1e-17   
gb|KDE07666.1|  translation initiation factor RLI1                    87.4    1e-17   
ref|XP_009327022.1|  PREDICTED: ATP-binding cassette sub-family E...  87.4    1e-17   
ref|XP_001731175.1|  hypothetical protein MGL_1358                    87.4    1e-17   
ref|XP_006023793.1|  PREDICTED: ATP-binding cassette sub-family E...  87.4    1e-17   
ref|XP_001210306.1|  ATP-binding cassette sub-family E member 1       87.4    1e-17   
ref|XP_764492.1|  RNAse L inhibitor                                   87.8    1e-17   
ref|XP_006262799.1|  PREDICTED: ATP-binding cassette sub-family E...  87.4    1e-17   
emb|CCJ28163.1|  unnamed protein product                              85.1    1e-17   
gb|KFO91191.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   
gb|KFV91778.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   
gb|KFP36487.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   
ref|XP_001269233.1|  RNase L inhibitor of the ABC superfamily, pu...  87.4    1e-17   
ref|XP_005995611.1|  PREDICTED: ATP-binding cassette sub-family E...  87.4    1e-17   
emb|CAJ18353.1|  RNase L inhibitor                                    87.4    1e-17   
gb|EMS65569.1|  ABC transporter E family member 2                     87.4    1e-17   
gb|KFM08216.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   
gb|EMC81758.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   
ref|XP_009687570.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...  87.4    1e-17   
ref|NP_001006440.1|  ATP-binding cassette sub-family E member 1       87.4    1e-17   
gb|KFP70085.1|  ATP-binding cassette sub-family E member 1            87.4    1e-17   



>ref|XP_011082187.1| PREDICTED: ABC transporter E family member 2 [Sesamum indicum]
Length=606

 Score =   115 bits (289),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+DQ+LTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MADQKLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  57



>ref|XP_009770922.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
 ref|XP_009770923.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
Length=606

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSDQRLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSDQRLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  57



>ref|XP_009602236.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602237.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602238.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=606

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSDQRLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSDQRLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  57



>emb|CDP07208.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  57



>gb|EPS64099.1| hypothetical protein M569_10682, partial [Genlisea aurea]
Length=608

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  117  EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +M+DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVT A  IAFIS ELCI
Sbjct  2    KMADQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTAADKIAFISEELCI  59



>ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
 gb|ERN20089.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
Length=606

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+DQRLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEV+PA+ IA+IS ELCI
Sbjct  1    MADQRLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVSPASKIAYISEELCI  57



>ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006430900.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006482353.1| PREDICTED: ABC transporter E family member 2-like [Citrus sinensis]
 gb|ESR44139.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44140.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=605

 Score =   110 bits (276),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>gb|KDO72263.1| hypothetical protein CISIN_1g040300mg [Citrus sinensis]
Length=605

 Score =   110 bits (276),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>ref|XP_008783223.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Phoenix dactylifera]
Length=605

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008783221.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Phoenix dactylifera]
Length=632

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010915915.1| PREDICTED: ABC transporter E family member 2-like [Elaeis guineensis]
Length=605

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008805333.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
 ref|XP_008805406.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
Length=605

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010917851.1| PREDICTED: ABC transporter E family member 2 [Elaeis guineensis]
Length=605

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010925920.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010925921.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
Length=605

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_009409469.1| PREDICTED: ABC transporter E family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_009380578.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380579.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44138.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=584

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>ref|XP_006430901.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44141.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=583

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>ref|XP_008387873.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Malus 
domestica]
Length=622

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>gb|KJB25122.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=439

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008387874.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Malus 
domestica]
Length=605

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>ref|XP_004150248.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 ref|XP_004162070.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 gb|KGN54000.1| hypothetical protein Csa_4G252930 [Cucumis sativus]
Length=605

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAA IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  56



>ref|XP_003589457.1| RNase L inhibitor protein-like protein, partial [Medicago truncatula]
Length=670

 Score =   105 bits (263),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+RLTRIAIV++DKCKPKKCRQECKKSCPVV TGKLC+EVT A+ IA+IS ELCI
Sbjct  1    MSDERLTRIAIVNNDKCKPKKCRQECKKSCPVVGTGKLCVEVTSASKIAYISEELCI  57



>ref|XP_008377063.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
 ref|XP_008377064.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
Length=335

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|EWC48374.1| translation initiation factor RLI1 [Drechslerella stenobrocha 
248]
Length=607

 Score =   104 bits (260),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSDKCKPKKCRQEC+KSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MAD-RLTRIAIVSSDKCKPKKCRQECRKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_010925922.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
 ref|XP_010925923.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
Length=599

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_011395697.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
 gb|KFM22831.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
Length=631

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            S+Q LTRIAIVSSDKCKPKKCRQECKKSCPVVK GKLC+EV P + IA+IS ELCI
Sbjct  12   SEQTLTRIAIVSSDKCKPKKCRQECKKSCPVVKVGKLCVEVVPTSKIAWISEELCI  67



>ref|XP_007040863.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao]
 gb|EOY25364.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao]
Length=515

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_011028506.1| PREDICTED: ABC transporter E family member 2 [Populus euphratica]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_006385159.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|ERP62956.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=603

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008801480.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801482.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801483.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801484.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_007040862.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
 gb|EOY25363.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_007782779.1| translation initiation factor RLI1 [Coniosporium apollinis CBS 
100218]
 gb|EON67462.1| translation initiation factor RLI1 [Coniosporium apollinis CBS 
100218]
Length=604

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MAD-RLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_009409466.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KJB25123.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=573

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>emb|CAN65893.1| hypothetical protein VITISV_021090 [Vitis vinifera]
Length=599

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KJB25121.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008221272.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221273.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221274.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|AIU41641.1| ABC transporter family protein [Hevea brasiliensis]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_002271392.1| PREDICTED: ABC transporter E family member 2 [Vitis vinifera]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KJB25125.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=614

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010099717.1| ABC transporter E family member 2 [Morus notabilis]
 gb|EXB80294.1| ABC transporter E family member 2 [Morus notabilis]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008444234.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
 ref|XP_008444235.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>emb|CBI29193.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  21   MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  76



>ref|XP_010275149.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275150.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275151.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_007222049.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
 gb|EMJ23248.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
Length=605

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008783222.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Phoenix dactylifera]
Length=628

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KDP42075.1| hypothetical protein JCGZ_01863 [Jatropha curcas]
Length=605

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010272250.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
 ref|XP_010272251.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
Length=605

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KJB25124.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=588

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_002380500.1| RNase L inhibitor of the ABC superfamily, putative [Aspergillus 
flavus NRRL3357]
 ref|XP_001825325.2| translation initiation factor RLI1 [Aspergillus oryzae RIB40]
 gb|EED50119.1| RNase L inhibitor of the ABC superfamily, putative [Aspergillus 
flavus NRRL3357]
 gb|EIT74663.1| RNAse L inhibitor, ABC superfamily [Aspergillus oryzae 3.042]
 gb|KDE75380.1| RNAse L inhibitor, ABC [Aspergillus oryzae 100-8]
Length=604

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_658860.1| hypothetical protein AN1256.2 [Aspergillus nidulans FGSC A4]
 gb|EAA65849.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
Length=657

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>dbj|GAM41412.1| iron-sulfur protein [Talaromyces cellulolyticus]
Length=604

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_002151573.1| RNase L inhibitor of the ABC superfamily, putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20573.1| RNase L inhibitor of the ABC superfamily, putative [Talaromyces 
marneffei ATCC 18224]
Length=604

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_010529268.1| PREDICTED: ABC transporter E family member 2-like [Tarenaya hassleriana]
Length=605

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQEC+KSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECRKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>ref|XP_010536040.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
 ref|XP_010536048.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
Length=605

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQEC+KSCPVVKTGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECRKSCPVVKTGKLCIEVTPASKIAFISEELCI  56



>gb|KIV88308.1| translation initiation factor RLI1 [Exophiala mesophila]
Length=604

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>dbj|GAD96595.1| ATP-binding cassette sub-family E member 1 [Byssochlamys spectabilis 
No. 5]
Length=677

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRVAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_002795389.1| translation initiation factor RLI1 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=623

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>gb|EAS27709.3| translation initiation factor RLI1 [Coccidioides immitis RS]
Length=604

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>gb|EFW19199.1| ABC transporter [Coccidioides posadasii str. Silveira]
Length=604

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>gb|EAY81246.1| hypothetical protein OsI_36424 [Oryza sativa Indica Group]
Length=474

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>gb|KEY76156.1| RNase L inhibitor of the ABC [Aspergillus fumigatus var. RP-2014]
Length=699

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communis]
 gb|EEF34119.1| rnase l inhibitor, putative [Ricinus communis]
Length=591

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTG+LCIEVTPA+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGRLCIEVTPASKIAFISEELCI  56



>gb|EMT25832.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=539

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAA +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCI  56



>ref|XP_010054013.1| PREDICTED: ABC transporter E family member 2 [Eucalyptus grandis]
 gb|KCW78398.1| hypothetical protein EUGRSUZ_D02563 [Eucalyptus grandis]
Length=605

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTTQSRIAFISEELCI  56



>ref|XP_003577489.1| PREDICTED: ABC transporter E family member 2 [Brachypodium distachyon]
Length=604

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAA +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCI  56



>gb|EMS47523.1| ABC transporter E family member 2 [Triticum urartu]
Length=552

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAA +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCI  56



>ref|XP_011117798.1| hypothetical protein AOL_s00006g187 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53321.1| hypothetical protein AOL_s00006g187 [Arthrobotrys oligospora 
ATCC 24927]
Length=614

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIVSSDKCKPKKCRQEC+KSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MAD-KLTRIAIVSSDKCKPKKCRQECRKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>dbj|BAJ90466.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91099.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86517.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAA +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCI  56



>gb|KIW46344.1| translation initiation factor RLI1 [Exophiala oligosperma]
Length=604

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>ref|XP_006662991.1| PREDICTED: ABC transporter E family member 2-like [Oryza brachyantha]
Length=604

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>ref|XP_002560831.1| Pc16g04800 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP93150.1| Pc16g04800 [Penicillium rubens Wisconsin 54-1255]
Length=715

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEV P++ IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPSSKIAFISERLCI  56



>gb|AAM19067.1| RNase L inhibitor-like protein [Oryza sativa Japonica Group]
Length=604

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>gb|EMT28710.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=103

 Score = 95.9 bits (237),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKK CPVVKTGKLCIEV+PAA +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKRCPVVKTGKLCIEVSPAAKLAFISEELCI  56



>gb|KIW18553.1| translation initiation factor RLI1 [Exophiala spinifera]
Length=604

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>ref|NP_001068062.1| Os11g0546000 [Oryza sativa Japonica Group]
 gb|ABA94220.1| ATP-binding cassette sub-family E member 1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28425.1| Os11g0546000 [Oryza sativa Japonica Group]
Length=604

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>gb|EAZ18673.1| hypothetical protein OsJ_34194 [Oryza sativa Japonica Group]
Length=628

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCI  56



>gb|KIW67851.1| translation initiation factor RLI1 [Capronia semiimmersa]
Length=604

 Score =   102 bits (254),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>ref|XP_008728415.1| translation initiation factor RLI1 [Cladophialophora carrionii 
CBS 160.54]
 gb|ETI21798.1| translation initiation factor RLI1 [Cladophialophora carrionii 
CBS 160.54]
Length=604

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>ref|XP_009156620.1| translation initiation factor RLI1 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY56159.1| translation initiation factor RLI1 [Exophiala dermatitidis NIH/UT8656]
Length=603

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>ref|XP_010690817.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690818.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT AA +AFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTSAAKLAFISEELCI  56



>ref|XP_006836109.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
 gb|ERM98962.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
Length=605

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+DQRL RIAIV++D+CKPK+CRQECKKSCPVV+TGKLCIEV+PA+ IA+IS ELCI
Sbjct  1    MADQRLNRIAIVNADRCKPKECRQECKKSCPVVRTGKLCIEVSPASKIAYISEELCI  57



>dbj|GAM87745.1| hypothetical protein ANO11243_057720 [fungal sp. No.11243]
Length=606

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MAD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>gb|EZF29954.1| translation initiation factor RLI1 [Trichophyton interdigitale 
H6]
 gb|KDB25362.1| translation initiation factor RLI1 [Trichophyton interdigitale 
MR816]
Length=678

 Score =   102 bits (254),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAPDSKIAFISERLCI  56



>ref|XP_002835993.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ80150.1| unnamed protein product [Tuber melanosporum]
Length=568

 Score =   101 bits (252),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIVS+DKCKPKKCRQECKKSCPVV+TG+LCIEVTP + IAFIS +LCI
Sbjct  1    MAD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRTGRLCIEVTPESRIAFISEQLCI  56



>ref|XP_004512327.1| PREDICTED: ABC transporter E family member 2-like [Cicer arietinum]
Length=606

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+ IA+IS ELCI
Sbjct  1    MSD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCI  56



>gb|KEH40227.1| RNase L inhibitor ABC superfamily protein, putative [Medicago 
truncatula]
Length=607

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+RLTRIAIV++DKCKPKKCRQECKKSCPVV TGKLC+EVT A+ IA+IS ELCI
Sbjct  1    MSDERLTRIAIVNNDKCKPKKCRQECKKSCPVVGTGKLCVEVTSASKIAYISEELCI  57



>gb|EZF74246.1| translation initiation factor RLI1 [Trichophyton soudanense CBS 
452.61]
 gb|EZG06786.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 735.88]
Length=604

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAPDSKIAFISERLCI  56



>gb|EZF23483.1| translation initiation factor RLI1 [Trichophyton rubrum MR850]
 gb|EZF42440.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 100081]
 gb|EZF53258.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 288.86]
 gb|EZF63642.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 289.86]
 gb|EZF84995.1| translation initiation factor RLI1 [Trichophyton rubrum MR1448]
 gb|EZF95738.1| translation initiation factor RLI1 [Trichophyton rubrum MR1459]
 gb|EZG17354.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 202.88]
 gb|KDB34198.1| translation initiation factor RLI1 [Trichophyton rubrum D6]
 gb|KFL61892.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 118892]
Length=604

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAPDSKIAFISERLCI  56



>ref|XP_007922289.1| ABC transporter domain-containing protein [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME89801.1| ABC transporter domain-containing protein [Pseudocercospora fijiensis 
CIRAD86]
Length=606

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPTSKIAFISERLCI  56



>ref|XP_004291224.1| PREDICTED: ABC transporter E family member 2 [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT A+ IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTTASKIAFISEELCI  56



>gb|KGO47620.1| ABC transporter, ABCE [Penicillium expansum]
Length=712

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPTSKIAFISERLCI  56



>gb|EZG06784.1| translation initiation factor RLI1 [Trichophyton rubrum CBS 735.88]
Length=701

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAPDSKIAFISERLCI  56



>ref|XP_011013966.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
 ref|XP_011013967.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
Length=605

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP + IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPVSKIAFISEELCI  56



>gb|EZF95736.1| translation initiation factor RLI1 [Trichophyton rubrum MR1459]
 gb|EGD89008.2| translation initiation factor RLI1 [Trichophyton rubrum CBS 118892]
Length=701

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAPDSKIAFISERLCI  56



>emb|CDX82529.1| BnaA03g32920D [Brassica napus]
Length=556

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+  AF+S ELCI
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCI  56



>ref|XP_009349643.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349644.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349645.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349646.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
Length=605

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLCIEVTPA+ IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCIEVTPASKIAFISEELCI  56



>ref|XP_008080558.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis 
ATCC 20868]
 gb|EPE32546.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis 
ATCC 20868]
Length=656

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI+S+DKCKPKKCRQECKKSCPVV++G+LCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIISTDKCKPKKCRQECKKSCPVVRSGRLCIEVTPESKIAFISENLCI  56



>ref|XP_007758868.1| translation initiation factor RLI1 [Cladophialophora yegresii 
CBS 114405]
 gb|EXJ59245.1| translation initiation factor RLI1 [Cladophialophora yegresii 
CBS 114405]
Length=604

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>gb|KIW82669.1| translation initiation factor RLI1 [Fonsecaea pedrosoi CBS 271.37]
Length=604

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISEMLCI  56



>gb|KGO78102.1| ABC transporter, ABCE [Penicillium italicum]
Length=712

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPTSKIAFISERLCI  56



>gb|KGO54733.1| ABC transporter, ABCE [Penicillium expansum]
 gb|KGO60716.1| ABC transporter, ABCE [Penicillium expansum]
Length=712

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPTSKIAFISERLCI  56



>ref|XP_007727229.1| translation initiation factor RLI1 [Capronia coronata CBS 617.96]
 gb|EXJ82108.1| translation initiation factor RLI1 [Capronia coronata CBS 617.96]
Length=603

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>gb|KIV79017.1| translation initiation factor RLI1 [Exophiala sideris]
Length=605

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>emb|CDX75723.1| BnaC03g38060D [Brassica napus]
Length=603

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+  AF+S ELCI
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCI  56



>gb|EQL30489.1| translation initiation factor RLI1 [Blastomyces dermatitidis 
ATCC 26199]
Length=604

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV++DKCKPKKCRQECKKSCPVV++GKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNADKCKPKKCRQECKKSCPVVRSGKLCIEVTPESKIAFISERLCI  56



>ref|XP_009135315.1| PREDICTED: ABC transporter E family member 1-like [Brassica rapa]
Length=603

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+  AF+S ELCI
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCI  56



>ref|XP_006385402.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
 gb|ERP63199.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
Length=605

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP + IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPISKIAFISEELCI  56



>gb|KIW52261.1| translation initiation factor RLI1 [Exophiala xenobiotica]
Length=604

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>gb|AAL26702.1| 68 kDa protein HP68 [Triticum aestivum]
Length=604

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+P A +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPVAKLAFISEELCI  56



>ref|XP_007918325.1| putative translation initiation factor rli1 protein [Togninia 
minima UCRPA7]
 gb|EON96824.1| putative translation initiation factor rli1 protein [Togninia 
minima UCRPA7]
Length=607

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV++GKLCIEVTP + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVTPDSRLAFISESLCI  56



>ref|XP_003537713.1| PREDICTED: ABC transporter E family member 2-like [Glycine max]
Length=606

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT ++ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSSSKIAFISEELCI  56



>ref|XP_001483595.1| hypothetical protein PGUG_04324 [Meyerozyma guilliermondii ATCC 
6260]
Length=607

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+  TRIAIVS+D+CKPKKC+QEC+KSCPVVKTGKLCIEVTPA+ IAFIS  LCI
Sbjct  1    MSDKN-TRIAIVSTDRCKPKKCKQECRKSCPVVKTGKLCIEVTPASKIAFISETLCI  56



>gb|EDK40226.2| hypothetical protein PGUG_04324 [Meyerozyma guilliermondii ATCC 
6260]
Length=607

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+  TRIAIVS+D+CKPKKC+QEC+KSCPVVKTGKLCIEVTPA+ IAFIS  LCI
Sbjct  1    MSDKN-TRIAIVSTDRCKPKKCKQECRKSCPVVKTGKLCIEVTPASKIAFISETLCI  56



>ref|XP_010692184.1| PREDICTED: ABC transporter E family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEV+ AA +AFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVSSAAKLAFISEELCI  56



>ref|XP_002303221.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|EEE78200.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=611

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 1/55 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXEL  284
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP + IAFIS EL
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPISKIAFISEEL  54



>ref|XP_007158074.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
 gb|ESW30068.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
Length=606

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+ IA+IS ELCI
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCI  56



>emb|CDM30323.1| Translation initiation factor RLI1 [Penicillium roqueforti FM164]
Length=684

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI++SDKCKPKKCRQECKK+CPVV+TGKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINSDKCKPKKCRQECKKACPVVRTGKLCIEVDPTSKIAFISERLCI  56



>gb|EMR81784.1| putative translation initiation factor rli1 protein [Botrytis 
cinerea BcDW1]
Length=609

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI+S+DKCKPKKCRQECKKSCPVV++G+LCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIISTDKCKPKKCRQECKKSCPVVRSGRLCIEVTPESKIAFISENLCI  56



>ref|XP_003579496.1| PREDICTED: ABC transporter E family member 2-like [Brachypodium 
distachyon]
Length=604

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+ +RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTG+LCIEV+PA+ +AFIS ELCI
Sbjct  1    MAAERLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGRLCIEVSPASKVAFISEELCI  57



>emb|CDR38495.1| CYFA0S02e02322g1_1 [Cyberlindnera fabianii]
Length=614

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +3

Query  111  KREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            K+E SD++  RIAI+S DKCKPKKCRQECKKSCPVVKTGKLCIEVTP + IAFIS  LCI
Sbjct  6    KKESSDKQ-QRIAIISEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPMSKIAFISETLCI  64



>gb|EYU37486.1| hypothetical protein MIMGU_mgv1a003146mg [Erythranthe guttata]
Length=605

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++LTRIAIVSSDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS ELCI
Sbjct  3    EKLTRIAIVSSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPLSKIAFISEELCI  56



>gb|ABR18176.1| unknown [Picea sitchensis]
Length=605

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEV+ A+ IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVSSASKIAFISEELCI  56



>ref|XP_002623806.1| ATP-binding cassette sub-family E member 1 [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ70987.1| ATP-binding cassette sub-family E member 1 [Blastomyces dermatitidis 
SLH14081]
Length=704

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV++DKCKPKKCRQECKKSCPVV++GKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNADKCKPKKCRQECKKSCPVVRSGKLCIEVTPESKIAFISERLCI  56



>gb|EPS32191.1| hypothetical protein PDE_07151 [Penicillium oxalicum 114-2]
Length=604

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVT  + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTSDSKIAFISESLCI  56



>gb|KFA62559.1| hypothetical protein S40285_05691 [Stachybotrys chlorohalonata 
IBT 40285]
Length=671

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEVTP + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVTPESRLAFISESLCI  56



>gb|KIX95155.1| translation initiation factor RLI1 [Fonsecaea multimorphosa CBS 
102226]
Length=604

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISEMLCI  56



>gb|KIW31282.1| translation initiation factor RLI1 [Cladophialophora immunda]
Length=604

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISEMLCI  56



>gb|AGC70150.1| ABC transporter E family member 2 protein [Cardamine hirsuta]
Length=605

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT A+ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVASKIAFISEELCI  56



>gb|KHN05542.1| ABC transporter E family member 2 [Glycine soja]
Length=684

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT ++ IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSSSKIAFISEELCI  56



>gb|KDD74545.1| hypothetical protein H632_c1239p0 [Helicosporidium sp. ATCC 50920]
Length=612

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            SD+  TRIAIVS+DKCKPKKC+QECKKSCPVVK GKLCIEVTP +  +FIS ELCI
Sbjct  11   SDETPTRIAIVSADKCKPKKCKQECKKSCPVVKIGKLCIEVTPTSKSSFISEELCI  66



>ref|XP_006366958.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006366959.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Solanum tuberosum]
 ref|XP_006366960.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Solanum tuberosum]
Length=605

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVT  + IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCI  56



>ref|XP_007216970.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
 ref|XP_008227942.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 ref|XP_008227943.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 gb|EMJ18169.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
Length=605

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVV TG+LCIEVTPA+ IA+IS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVMTGRLCIEVTPASKIAYISEELCI  56



>gb|KIW91070.1| translation initiation factor RLI1 [Cladophialophora bantiana 
CBS 173.52]
Length=604

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISELLCI  56



>ref|XP_010323314.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
 ref|XP_010323315.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
Length=605

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT  + IAFIS ELCI
Sbjct  1    MSD-RLTRIAIVSDDKCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCI  56



>ref|XP_009333973.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
 ref|XP_009333974.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
Length=605

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLC+EVTPA+ IAFIS ELCI
Sbjct  1    MTD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCVEVTPASKIAFISEELCI  56



>gb|AGV54379.1| ABC transporter E family member 2-like protein [Phaseolus vulgaris]
Length=606

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+ IA+IS ELCI
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCI  56



>ref|XP_007838632.1| Translation initiation factor RLI1 [Pestalotiopsis fici W106-1]
 gb|ETS76473.1| Translation initiation factor RLI1 [Pestalotiopsis fici W106-1]
Length=610

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTR+AIVSSDKCKPKKC+QEC+KSCPVV++GKLCIEV+PA+ +AFIS  LC+
Sbjct  1    MAD-KLTRVAIVSSDKCKPKKCKQECRKSCPVVRSGKLCIEVSPASSLAFISESLCV  56



>ref|XP_008660181.1| PREDICTED: ABC transporter E family member 2-like [Zea mays]
 gb|AFW88470.1| hypothetical protein ZEAMMB73_854523 [Zea mays]
Length=604

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCI  56



>ref|XP_008655346.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Zea 
mays]
 tpg|DAA45212.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
 tpg|DAA45213.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
Length=604

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCI  56



>ref|XP_002468219.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
 gb|EER95217.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
Length=604

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCI  56



>ref|XP_004979432.1| PREDICTED: ABC transporter E family member 2-like [Setaria italica]
Length=604

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+ +AFIS ELCI
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCI  56



>gb|KIW01313.1| translation initiation factor RLI1 [Verruconis gallopava]
Length=604

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVT  + IAFIS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTADSKIAFISESLCI  56



>gb|KEY70632.1| hypothetical protein S7711_02235 [Stachybotrys chartarum IBT 
7711]
 gb|KFA53099.1| hypothetical protein S40293_05328 [Stachybotrys chartarum IBT 
40293]
 gb|KFA78384.1| hypothetical protein S40288_04927 [Stachybotrys chartarum IBT 
40288]
Length=657

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV+P + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVSPESRLAFISESLCI  56



>dbj|GAN01144.1| translation initiation factor RLI1 [Mucor ambiguus]
Length=599

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P + IAFIS ELCI
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKIAFISEELCI  56



>gb|EWM23870.1| rnase l inhibitor-like protein [Nannochloropsis gaditana]
Length=518

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            RLTRIAIV+ DKCKPKKCRQECK++CPVV+ GKLCIEVTP + IAF+S ELCI
Sbjct  14   RLTRIAIVNKDKCKPKKCRQECKRNCPVVRQGKLCIEVTPTSKIAFLSEELCI  66



>gb|EWM23869.1| rnase l inhibitor-like protein [Nannochloropsis gaditana]
Length=657

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            RLTRIAIV+ DKCKPKKCRQECK++CPVV+ GKLCIEVTP + IAF+S ELCI
Sbjct  14   RLTRIAIVNKDKCKPKKCRQECKRNCPVVRQGKLCIEVTPTSKIAFLSEELCI  66



>dbj|GAC99212.1| RNase L inhibitor [Pseudozyma hubeiensis SY62]
Length=606

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            Q+ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP++ IAFIS  LCI
Sbjct  7    QKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPSSKIAFISESLCI  60



>gb|EPB83194.1| translation initiation factor RLI1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=599

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P + IAFIS ELCI
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKIAFISEELCI  56



>ref|XP_004347570.2| ATP-binding cassette sub-family E member 1 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE94134.1| ATP-binding cassette sub-family E member 1 [Capsaspora owczarzaki 
ATCC 30864]
Length=621

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
             D+RLTRIAIVSSDKCKPKKCRQECKKSCPVV+ GKLCIEV P   I++IS ELCI
Sbjct  22   DDERLTRIAIVSSDKCKPKKCRQECKKSCPVVRMGKLCIEVAPTDKISYISEELCI  77



>ref|XP_003856882.1| ABC transporter domain-containing protein [Zymoseptoria tritici 
IPO323]
 gb|EGP91858.1| ABC transporter domain-containing protein [Zymoseptoria tritici 
IPO323]
Length=606

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV++GKLCIEV  A+ IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVDAASKIAFISERLCI  56



>emb|CDX99388.1| BnaC01g11640D [Brassica napus]
Length=605

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKVAFISEELCI  56



>emb|CDY09282.1| BnaC03g63120D [Brassica napus]
Length=595

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>emb|CBQ73757.1| probable RLI1-Protein promoting preinitiation complex assembly 
[Sporisorium reilianum SRZ2]
Length=606

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            Q+ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP + IAFIS  LCI
Sbjct  7    QKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPTSKIAFISESLCI  60



>ref|XP_002848303.1| translation initiation factor RLI1 [Arthroderma otae CBS 113480]
 gb|EEQ30990.1| translation initiation factor RLI1 [Arthroderma otae CBS 113480]
Length=604

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEV   + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVAADSKIAFISERLCI  56



>ref|XP_010419025.1| PREDICTED: putative F-box protein At3g13624 [Camelina sativa]
Length=679

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTG+LCIEV+P++  +F+S ELCI
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGRLCIEVSPSSKTSFLSEELCI  56



>emb|CAX73008.1| ATP-binding cassette, sub-family E (OABP), member 1 [Schistosoma 
japonicum]
Length=134

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            + ++LTRIAIVSSDKCKPKKCRQECK+SCPVV+ GKLCIEVTP   IAF+S ELCI
Sbjct  6    TQEKLTRIAIVSSDKCKPKKCRQECKRSCPVVRMGKLCIEVTPNDKIAFLSEELCI  61



>ref|XP_007882292.1| hypothetical protein PFL1_06558 [Pseudozyma flocculosa PF-1]
 gb|EPQ25884.1| hypothetical protein PFL1_06558 [Pseudozyma flocculosa PF-1]
Length=608

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            + Q+ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP + IAFIS  LCI
Sbjct  7    AQQKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPTSKIAFISESLCI  62



>gb|EEH21097.2| translation initiation factor RLI1 [Paracoccidioides brasiliensis 
Pb03]
Length=703

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>ref|XP_009108421.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108422.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108424.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
Length=605

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>emb|CAA16710.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 emb|CAB78923.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
Length=600

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>emb|CDX76485.1| BnaA08g09150D [Brassica napus]
Length=605

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>emb|CDX98609.1| BnaA03g43940D [Brassica napus]
Length=605

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>emb|CDY01588.1| BnaC07g35780D [Brassica napus]
Length=605

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|NP_193656.2| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
 sp|Q8LPJ4.1|AB2E_ARATH RecName: Full=ABC transporter E family member 2; Short=ABC transporter 
ABCE.2; Short=AtABCE2; AltName: Full=RNase L inhibitor-like 
protein 2; Short=AtRLI2; Short=AthaRLI2 [Arabidopsis 
thaliana]
 gb|AAM20548.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AAN15617.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 dbj|BAE99009.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE84160.1| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
Length=605

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|XP_010436484.1| PREDICTED: ABC transporter E family member 2-like [Camelina sativa]
Length=566

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|XP_010439735.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010439736.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449372.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010449373.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449374.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
Length=605

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|XP_009137000.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137001.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137002.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137003.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
Length=605

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|XP_006286029.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
 gb|EOA18927.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
Length=605

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCI  56



>ref|XP_006299034.1| hypothetical protein CARUB_v10015171mg [Capsella rubella]
 gb|EOA31932.1| hypothetical protein CARUB_v10015171mg [Capsella rubella]
Length=604

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RL RIAI+++D+CKP KCRQECKKSCPVVKTGKLCIEVTPA+  AF+S ELCI
Sbjct  1    MAD-RLARIAILNNDRCKPNKCRQECKKSCPVVKTGKLCIEVTPASKAAFLSEELCI  56



>ref|XP_010757114.1| translation initiation factor RLI1 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH45741.2| translation initiation factor RLI1 [Paracoccidioides brasiliensis 
Pb18]
Length=753

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCI  56



>gb|AAX26766.2| SJCHGC05773 protein [Schistosoma japonicum]
Length=229

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            + ++LTRIAIVSSDKCKPKKCRQECK+SCPVV+ GKLCIEVTP   IAF+S ELCI
Sbjct  15   TQEKLTRIAIVSSDKCKPKKCRQECKRSCPVVRMGKLCIEVTPNDKIAFLSEELCI  70



>gb|KFH72616.1| ABC transporter E family member 2 [Mortierella verticillata NRRL 
6337]
Length=600

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD  LTRIAIV+SDKCKPKKCRQECKKSCPVVK GK+CIEV+PA+ IAFIS +LCI
Sbjct  1    MSDD-LTRIAIVNSDKCKPKKCRQECKKSCPVVKMGKMCIEVSPASKIAFISEDLCI  56



>ref|XP_003678680.1| hypothetical protein TDEL_0A01370 [Torulaspora delbrueckii]
 emb|CCE89469.1| hypothetical protein TDEL_0A01370 [Torulaspora delbrueckii]
Length=607

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+   RIAIVS+DKCKPKKCRQEC++SCPVVKTGKLCIEVTP + IAFIS  LCI
Sbjct  1    MSDKN-ARIAIVSADKCKPKKCRQECRRSCPVVKTGKLCIEVTPTSKIAFISEILCI  56



>ref|XP_963869.3| translation initiation factor RLI1 [Neurospora crassa OR74A]
 gb|EAA34633.3| translation initiation factor RLI1 [Neurospora crassa OR74A]
Length=607

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVSSDKCKPKKCRQECKKSCPVV++GKLCIEV+P + IAFIS +LCI
Sbjct  1    MSD-KLTRIAIVSSDKCKPKKCRQECKKSCPVVRSGKLCIEVSPESRIAFISEQLCI  56



>ref|XP_003004835.1| ATP-binding cassette sub-family E member 1 [Verticillium alfalfae 
VaMs.102]
 gb|EEY18332.1| ATP-binding cassette sub-family E member 1 [Verticillium alfalfae 
VaMs.102]
Length=335

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AIV+SDKCKPKKCRQECKKSCPVV++GKLCIEV+PA+ IAF+S  LCI
Sbjct  1    MSD-KLTRVAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVSPASRIAFLSESLCI  56



>ref|XP_003746536.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Metaseiulus 
occidentalis]
Length=608

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  102  RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXE  281
            R +K+E    +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEVTP   IA IS  
Sbjct  3    RNLKKEDLQDKLTRIAIVSTDKCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIAEISEN  62

Query  282  LCI  290
            LCI
Sbjct  63   LCI  65



>dbj|BAJ93642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTGKLCIEV PA+ ++FIS ELCI
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGKLCIEVGPASKVSFISEELCI  56



>ref|XP_007580477.1| putative translation initiation factor rli1 protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD52074.1| putative translation initiation factor rli1 protein [Neofusicoccum 
parvum UCRNP2]
Length=604

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAI++SDKCKPKKCRQECKKSCPVV+TGKLCIEV   + IAFIS  LCI
Sbjct  1    MTD-KLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDSTSKIAFISERLCI  56



>gb|ETS59925.1| hypothetical protein PaG_05898 [Pseudozyma aphidis DSM 70725]
Length=606

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP++ IAFIS  LCI
Sbjct  7    EKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPSSKIAFISESLCI  60



>dbj|GAC75056.1| RNAse L inhibitor [Pseudozyma antarctica T-34]
Length=606

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP++ IAFIS  LCI
Sbjct  7    EKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPSSKIAFISESLCI  60



>ref|XP_006413992.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
 gb|ESQ55445.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
Length=605

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTGKLCIEVT  + IAFIS ELCI
Sbjct  1    MAD-RLTRIAIVSQDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCI  56



>dbj|GAK64634.1| RNAse l inhibitor-type atp binding cassette protein [Pseudozyma 
antarctica]
Length=606

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP++ IAFIS  LCI
Sbjct  7    EKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPSSKIAFISESLCI  60



>emb|CDY05197.1| BnaC05g46060D [Brassica napus]
 emb|CDX78930.1| BnaA01g09970D [Brassica napus]
Length=605

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVVKTGKLCIEVT  + +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVSADRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKVAFISEELCI  56



>ref|XP_011389740.1| putative protein promoting preinitiation complex assembly [Ustilago 
maydis 521]
 gb|KIS68785.1| putative protein promoting preinitiation complex assembly [Ustilago 
maydis 521]
Length=606

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP++ IAFIS  LCI
Sbjct  7    EKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPSSKIAFISESLCI  60



>gb|EWY99002.1| translation initiation factor RLI1 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ45077.1| translation initiation factor RLI1 [Fusarium oxysporum Fo47]
 gb|EWZ98037.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
lycopersici MN25]
 gb|EXK42456.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
melonis 26406]
 gb|EXL62408.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
radicis-lycopersici 26381]
 gb|EXM08243.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
cubense tropical race 4 54006]
Length=674

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVQPDSKLAFISESLCI  56



>ref|XP_002174795.1| iron-sulfur protein [Schizosaccharomyces japonicus yFS275]
 gb|EEB08502.1| iron-sulfur protein [Schizosaccharomyces japonicus yFS275]
Length=594

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MS   LTRIAIVSSDKC+PKKCRQEC+KSCPVV+TGKLCIEVTP   IAFIS  LCI
Sbjct  1    MSSNSLTRIAIVSSDKCRPKKCRQECRKSCPVVRTGKLCIEVTPNDRIAFISETLCI  57



>dbj|GAA55212.1| ATP-binding cassette sub-family E member 1 [Clonorchis sinensis]
Length=752

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  99   YRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISX  278
            Y  + +  +  RLTRIAIVS+DKCKPKKCRQECKKSCPVV+ G++CIEVTP   IAFIS 
Sbjct  146  YNTMSKPPTQDRLTRIAIVSNDKCKPKKCRQECKKSCPVVRMGRMCIEVTPNDKIAFISE  205

Query  279  ELCI  290
            ELCI
Sbjct  206  ELCI  209



>emb|CDY60809.1| BnaA01g37290D [Brassica napus]
Length=603

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCI  56



>ref|XP_009117623.1| PREDICTED: ABC transporter E family member 1 [Brassica rapa]
Length=603

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCI  56



>gb|EXA50356.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
pisi HDV247]
 gb|EXL00198.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
raphani 54005]
 gb|EXL77825.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
conglutinans race 2 54008]
 gb|EXM36210.1| translation initiation factor RLI1 [Fusarium oxysporum f. sp. 
vasinfectum 25433]
Length=674

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVQPDSKLAFISESLCI  56



>ref|XP_452984.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH01835.1| KLLA0C17556p [Kluyveromyces lactis]
Length=607

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  138  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            TRIAIVS DKCKPKKCRQECK+SCPVVKTGKLCIEV P + IAFIS  LCI
Sbjct  6    TRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCI  56



>emb|CEG63656.1| Putative YALI0A17941p [Rhizopus microsporus]
Length=599

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P + I++IS ELCI
Sbjct  1    MSD-RLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKISWISEELCI  56



>emb|CCF52067.1| probable RLI1-Protein promoting preinitiation complex assembly 
[Ustilago hordei]
Length=606

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +  ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP + IAFIS  LCI
Sbjct  4    VQQEKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPTSKIAFISESLCI  60



>gb|KIR83840.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
IND107]
Length=603

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P+   AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPSDKKAFISEELCI  56



>ref|XP_003592706.1| RNase L inhibitor-like protein [Medicago truncatula]
 ref|XP_003636730.1| RNase L inhibitor-like protein [Medicago truncatula]
 gb|AES62957.1| RNase L inhibitor ABC domain protein [Medicago truncatula]
Length=606

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LC+EVT A+ IA+IS ELCI
Sbjct  1    MSD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCVEVTSASKIAYISEELCI  56



>ref|XP_003191722.1| iron-sulfur protein required for ribosome biogenesis and translation 
initiation; Rli1p [Cryptococcus gattii WM276]
 gb|ADV19935.1| Iron-sulfur protein required for ribosome biogenesis and translation 
initiation, putative; Rli1p [Cryptococcus gattii WM276]
 gb|KIR51482.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
Ru294]
 gb|KIR79384.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
EJB2]
 gb|KIY37330.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
E566]
 gb|KJE02616.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
NT-10]
Length=603

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P+   AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPSDKKAFISEELCI  56



>gb|ELQ37080.1| hypothetical protein OOU_Y34scaffold00619g54 [Magnaporthe oryzae 
Y34]
 gb|ELQ59451.1| hypothetical protein OOW_P131scaffold01358g92 [Magnaporthe oryzae 
P131]
Length=1738

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+SDKCKPKKCRQECKKSCPVV++GKLCIEV+P + IA++S  LCI
Sbjct  1    MSD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVSPDSRIAYLSETLCI  56



>gb|EST04914.1| RNAse L inhibitor [Pseudozyma brasiliensis GHG001]
Length=606

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP + IAFIS  LCI
Sbjct  7    EKETRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPTSKIAFISESLCI  60



>emb|CDI54172.1| probable RLI1-Protein promoting preinitiation complex assembly 
[Melanopsichium pennsylvanicum 4]
Length=606

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  138  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            TRIAIV+SDKCKPKKCRQECKKSCPVV+ G+LCIEVTP + IAFIS  LCI
Sbjct  10   TRIAIVNSDKCKPKKCRQECKKSCPVVRMGRLCIEVTPTSKIAFISESLCI  60



>gb|KFH47898.1| Translation initiation factor-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=608

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKC+P+KCRQECKKSCPVV++GKLCIEV+P + IAFIS  LCI
Sbjct  1    MTD-KLTRIAIVNDDKCRPRKCRQECKKSCPVVRSGKLCIEVSPTSRIAFISESLCI  56



>gb|KIW99622.1| translation initiation factor RLI1 [Rhinocladiella mackenziei 
CBS 650.93]
Length=605

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCI  56



>gb|KFK38664.1| hypothetical protein AALP_AA3G144000, partial [Arabis alpina]
Length=551

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +3

Query  102  RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXE  281
            R  + EM+D RLTRIAIV  D+CKPKKCRQECK+SCPVVKTGKLCIEVTPA+  A +S E
Sbjct  1    RTHRPEMAD-RLTRIAIVDQDRCKPKKCRQECKRSCPVVKTGKLCIEVTPASSTASLSEE  59

Query  282  L  284
            L
Sbjct  60   L  60



>ref|XP_003580843.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Brachypodium distachyon]
Length=604

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTGKLCIEV+ A+ +AFIS ELCI
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGKLCIEVSSASKVAFISEELCI  56



>ref|XP_003348295.1| hypothetical protein SMAC_02792 [Sordaria macrospora k-hell]
 emb|CCC10215.1| unnamed protein product [Sordaria macrospora k-hell]
Length=607

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVSSDKCKPKKCRQECKKSCPVV++GKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVSSDKCKPKKCRQECKKSCPVVRSGKLCIEVAPESRIAFISESLCI  56



>emb|CCD59622.1| ATP-binding cassette, sub-family E (oabp),member, putative [Schistosoma 
mansoni]
Length=552

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            + ++LTRIAIVSSDKCKPKKCRQECK+SCPVV+ GKLCIEVTP   IAF+S ELCI
Sbjct  6    TQEKLTRIAIVSSDKCKPKKCRQECKRSCPVVRMGKLCIEVTPNDKIAFLSEELCI  61



>ref|XP_009649388.1| translation initiation factor RLI1 [Verticillium dahliae VdLs.17]
 gb|EGY18442.1| translation initiation factor RLI1 [Verticillium dahliae VdLs.17]
Length=607

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AIV+SDKCKPKKCRQECKKSCPVV++GKLCIEV+PA+ IAF+S  LCI
Sbjct  1    MSD-KLTRVAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVSPASRIAFLSESLCI  56



>ref|XP_011326803.1| translation initiation factor RLI1 [Fusarium graminearum PH-1]
 gb|ESU13296.1| translation initiation factor RLI1 [Fusarium graminearum PH-1]
 gb|EYB27662.1| hypothetical protein FG05_07101 [Fusarium graminearum]
 emb|CEF83077.1| unnamed protein product [Fusarium graminearum]
Length=607

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  4    KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVQPESKLAFISESLCI  56



>ref|XP_009254074.1| hypothetical protein FPSE_02680 [Fusarium pseudograminearum CS3096]
 gb|EKJ77036.1| hypothetical protein FPSE_02680 [Fusarium pseudograminearum CS3096]
Length=607

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  4    KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVQPESKLAFISESLCI  56



>ref|XP_008380283.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
 ref|XP_008380284.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
Length=605

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLC+EVT A+ IAFIS ELCI
Sbjct  1    MTD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCVEVTXASKIAFISEELCI  56



>ref|XP_006418725.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
 gb|ESQ37161.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
Length=599

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAIV++D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIVNNDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCI  56



>gb|KGK34284.1| hypothetical protein JL09_g6569, partial [Pichia kudriavzevii]
 gb|KGK34287.1| hypothetical protein JL09_g6566, partial [Pichia kudriavzevii]
Length=109

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD+  TRIAIVS DKCKPKKCRQEC+KSCPVVKTGKLCIEV P + IAFIS  LCI
Sbjct  1    MSDKN-TRIAIVSEDKCKPKKCRQECRKSCPVVKTGKLCIEVQPNSKIAFISETLCI  56



>emb|CDH54417.1| translation initiation factor rli1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=599

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI+++DKCKPKKCRQECKKSCPV + GK CIEV+P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINADKCKPKKCRQECKKSCPVNRMGKFCIEVSPTSKIAFISETLCI  56



>emb|CDS10188.1| Putative Translation initiation factor RLI1 [Absidia idahoensis 
var. thermophila]
Length=599

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAI+++DKCKPKKCRQECKKSCPV + GK CIEV+P + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIINADKCKPKKCRQECKKSCPVNRMGKFCIEVSPTSKIAFISETLCI  56



>emb|CDP23571.1| Putative protein similar to translation initiation factor RLI1 
of S. cerevisiae [Podospora anserina S mat+]
Length=606

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AIVSSDKCKPKKCRQECKKSCPVV++GKLCIEV P + IAFIS  LCI
Sbjct  1    MSD-KLTRVAIVSSDKCKPKKCRQECKKSCPVVRSGKLCIEVAPESRIAFISESLCI  56



>ref|XP_567049.1| hypothetical protein CNA07330 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_777594.1| hypothetical protein CNBA7150 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22947.1| hypothetical protein CNBA7150 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41230.1| hypothetical protein CNA07330 [Cryptococcus neoformans var. neoformans 
JEC21]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>gb|KGB75338.1| ABC transporter [Cryptococcus gattii R265]
 gb|KIR30752.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
LA55]
 gb|KIR42512.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
Ram5]
 gb|KIR72662.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
CA1014]
 gb|KIR95156.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
CBS 10090]
 gb|KIS00322.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
2001/935-1]
 gb|KIY56082.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
99/473]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>gb|KIR45264.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
CA1280]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>gb|KIR35782.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
MMRL2647]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>ref|XP_010487122.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010487123.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCI  56



>gb|AFR92884.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus neoformans 
var. grubii H99]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>gb|KIR69006.1| ATP-binding cassette, sub-family E, member 1 [Cryptococcus gattii 
CA1873]
Length=603

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AI+S DKCKPK+CRQECK+SCPVVK GKLCIEV P    AFIS ELCI
Sbjct  1    MSD-KLTRVAIISDDKCKPKRCRQECKRSCPVVKMGKLCIEVNPNDKKAFISEELCI  56



>gb|EGE80736.1| ATP-binding cassette sub-family E member 1 [Blastomyces dermatitidis 
ATCC 18188]
Length=703

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV++DKCKPKKCRQECKKSCPVV++GKLCIEVTP + IAFIS  LCI
Sbjct  1    MSD-KLTRIAIVNADKCKPKKCRQECKKSCPVVRSGKLCIEVTPESKIAFISERLCI  56



>emb|CEJ95089.1| Putative ATP-binding cassette sub-family E member 1 [Torrubiella 
hemipterigena]
Length=608

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIV+ DKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  1    MSD-KLTRIAIVNDDKCRPRKCRQECKKSCPVVRSGKLCIEVAPDSRLAFISESLCI  56



>gb|KGQ10400.1| Translation initiation factor RLI1 [Beauveria bassiana D1-5]
Length=651

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  4    KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVAPDSRLAFISESLCI  56



>ref|XP_010500834.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
 ref|XP_010500842.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
Length=603

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCI  56



>ref|NP_001080761.1| ATP-binding cassette, sub-family E (OABP), member 1 [Xenopus 
laevis]
 gb|AAH46573.1| Abce1-prov protein [Xenopus laevis]
Length=599

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIVS DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVSHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_008594495.1| ABC transporter [Beauveria bassiana ARSEF 2860]
 gb|EJP70307.1| ABC transporter [Beauveria bassiana ARSEF 2860]
Length=651

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIV+SDKC+P+KCRQECKKSCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  4    KLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVAPDSRLAFISESLCI  56



>ref|XP_011449756.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Crassostrea 
gigas]
 ref|XP_011449757.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Crassostrea 
gigas]
Length=611

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
             +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEV+PA  IAFIS ELCI
Sbjct  15   DKLTRIAIVSNDKCKPKRCRQECKKSCPVVRMGKLCIEVSPADKIAFISEELCI  68



>ref|XP_010500812.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500818.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500826.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
Length=629

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +  AF+S ELCI
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCI  56



>ref|XP_009518050.1| abc transporter, partial [Phytophthora sojae]
 gb|EGZ30775.1| abc transporter [Phytophthora sojae]
Length=626

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV+P + +AFIS +LCI
Sbjct  1    MSD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRMGKLCIEVSPKSKVAFISEQLCI  56



>gb|KDN69856.1| putative ABC transporter [Colletotrichum sublineola]
Length=608

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MSD +LTR+AIV+SDKCKPKKCRQECKKSCPVV++GKLCIEVTP + IAF+S  LCI
Sbjct  1    MSD-KLTRVAIVNSDKCKPKKCRQECKKSCPVVRSGKLCIEVTPESRIAFLSESLCI  56



>gb|EXX58362.1| Rli1p [Rhizophagus irregularis DAOM 197198w]
Length=602

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            ++ TRIAIVSSDKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS ELCI
Sbjct  3    EKHTRIAIVSSDKCKPKKCRQECKKSCPVVRMGKLCIEVTPESKIAYISEELCI  56



>ref|XP_006815890.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Saccoglossus 
kowalevskii]
Length=493

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            MS  +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEVT    IA+IS ELCI
Sbjct  1    MSQDKLTRIAIVSTDKCKPKRCRQECKKSCPVVRMGKLCIEVTSNDKIAYISEELCI  57



>ref|XP_005327610.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Ictidomys tridecemlineatus]
Length=682

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  48   CVHHTLHNLLFFNRNLCYRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTG  227
            C  H  H  + F+R   Y      M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ G
Sbjct  62   CTPH--HKGIAFSRRAGYSYFVTIMAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMG  118

Query  228  KLCIEVTPAAXIAFISXELCI  290
            KLCIEVTP + IA+IS  LCI
Sbjct  119  KLCIEVTPQSKIAWISETLCI  139



>gb|KEZ44645.1| hypothetical protein SAPIO_CDS3689 [Scedosporium apiospermum]
Length=607

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTR+AIV+SDKCKPKKCRQECKKSCPVVK+GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRVAIVNSDKCKPKKCRQECKKSCPVVKSGKLCIEVTPESRIAYISEPLCI  56



>dbj|BAE89880.1| unnamed protein product [Macaca fascicularis]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_001182876.2| PREDICTED: ATP-binding cassette sub-family E member 1-like [Strongylocentrotus 
purpuratus]
Length=602

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            + ++LTRIAIV++DKCKPKKCRQEC+KSCPVV+ GKLCIEVTPA+ IA+IS +LCI
Sbjct  3    TSEKLTRIAIVNADKCKPKKCRQECRKSCPVVRMGKLCIEVTPASKIAYISEQLCI  58



>ref|XP_006131844.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Pelodiscus sinensis]
 ref|XP_006131845.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Pelodiscus sinensis]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_007070201.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chelonia 
mydas]
 gb|EMP25917.1| ATP-binding cassette sub-family E member 1, partial [Chelonia 
mydas]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV P + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVSNDKCKPKKCRQECKKSCPVVRMGKLCIEVVPQSKIAWISETLCI  56



>dbj|BAE39748.1| unnamed protein product [Mus musculus]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_006872330.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chrysochloris 
asiatica]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_004645502.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Octodon 
degus]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_003417547.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Loxodonta africana]
 ref|XP_010595523.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Loxodonta africana]
 ref|XP_010595524.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Loxodonta africana]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>ref|XP_005284350.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chrysemys 
picta bellii]
Length=599

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  56



>gb|ERE79301.1| ATP-binding cassette sub-family E member 1 [Cricetulus griseus]
Length=654

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +3

Query  120  MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP + IA+IS  LCI
Sbjct  56   MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCI  111



>ref|XP_004336916.1| ribonuclease L inhibitor family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14903.1| ribonuclease L inhibitor family protein [Acanthamoeba castellanii 
str. Neff]
Length=613

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIVSSDKCKPKKCRQECK+SCPVVK GKLCIEVT    +A IS ELCI
Sbjct  12   KLTRIAIVSSDKCKPKKCRQECKRSCPVVKMGKLCIEVTEKDKLATISEELCI  64



>ref|XP_007797301.1| putative translation initiation factor rli1 protein [Eutypa lata 
UCREL1]
 gb|EMR63611.1| putative translation initiation factor rli1 protein [Eutypa lata 
UCREL1]
Length=633

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  132  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXELCI  290
            +LTRIAIV+ DKCKPKKCRQECK+SCPVV++GKLCIEV P + +AFIS  LCI
Sbjct  4    KLTRIAIVNDDKCKPKKCRQECKRSCPVVRSGKLCIEVAPDSKLAFISESLCI  56



>gb|AHK05659.1| ATP-binding cassette transporter sub-family E member 1 [Tigriopus 
japonicus]
Length=611

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 2/62 (3%)
 Frame = +3

Query  111  KREMSDQ--RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAXIAFISXEL  284
            KR+ +D+   LTRIAIV++D+CKPK+CRQECKKSCPVV+ GKLCIEVTP + IA IS EL
Sbjct  6    KRKEADEGDTLTRIAIVNNDRCKPKRCRQECKKSCPVVRMGKLCIEVTPNSKIANISEEL  65

Query  285  CI  290
            CI
Sbjct  66   CI  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570625233910