BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF001B09

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...  54.3    1e-06   Nicotiana tomentosiformis
ref|NP_001274969.1|  pectin methyl esterase                           52.8    4e-06   Solanum tuberosum [potatoes]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                   47.8    2e-04   
gb|AJH66132.1|  pectin methylesterase                                 47.8    2e-04   Malus domestica [apple tree]
ref|XP_008368265.1|  PREDICTED: pectinesterase 3-like                 47.0    4e-04   
ref|XP_006389477.1|  hypothetical protein POPTR_0022s002001g          46.2    5e-04   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...  46.6    6e-04   
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...  46.2    0.001   
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                 46.2    0.001   
ref|XP_002265171.1|  PREDICTED: pectinesterase                        46.2    0.001   Vitis vinifera



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  85   SKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGERA  201
            SK KKK+FLAV AS LL A VIGVV GVKSR NNS + A
Sbjct  21   SKGKKKLFLAVVASVLLVAAVIGVVAGVKSRSNNSNDHA  59



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGERA  201
            M   G     SK KKKI+LA+ AS LL A VIGVV GVKSR NNS + A
Sbjct  1    MLDSGKQIDFSKRKKKIYLAIVASVLLVAAVIGVVAGVKSRSNNSDDDA  49



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGER  198
            M+  G   + +K  KK+F+++FA+ LL   VIG+V GVKS KNNS + 
Sbjct  11   MSESGKKLSTNKKNKKLFISLFATILLVGAVIGIVTGVKSSKNNSDDE  58



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGER  198
            M+  G   + +K  KK+F+++FA+ LL   VIG+V GVKS KNNS + 
Sbjct  11   MSESGKKLSTNKKNKKLFISLFATILLVGAVIGIVTGVKSSKNNSDDE  58



>ref|XP_008368265.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=375

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGER  198
            M+  G   + +K  KK+F+++FA+ LL   ++G+V GVKS KNNS + 
Sbjct  11   MSESGKQISTNKKHKKLFISLFATILLVGAIVGIVTGVKSSKNNSDDE  58



>ref|XP_006389477.1| hypothetical protein POPTR_0022s002001g, partial [Populus trichocarpa]
 gb|ERP48391.1| hypothetical protein POPTR_0022s002001g, partial [Populus trichocarpa]
Length=286

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGERA  201
            M + G  T+ SK  K++ LA+FAS LL AT+I + +GV S KN++   A
Sbjct  1    MTQAGQYTSMSKKNKRLVLAIFASFLLVATIIAIAIGVNSHKNSTKNDA  49



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  88   KAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGERA  201
            K KKKI+LA+ AS LL A VIGVV GVKS   NS + A
Sbjct  16   KRKKKIYLAIVASVLLVAAVIGVVAGVKSHSKNSDDHA  53



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGERA  201
            M + G   + SK  K++ LA+FAS LL AT+I + +GV SRKN++   A
Sbjct  1    MTQAGQYISMSKKNKRLVLAIFASFLLVATIIAIAIGVNSRKNSTKNEA  49



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGER  198
            M+  G   + +K  KK+F ++FA+ LL    +G+V GVKS KNNS + 
Sbjct  11   MSESGKQISTNKKHKKLFJSLFATILLVGAXVGIVTGVKSSKNNSDDE  58



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  55   MARLGDPTAHSKAKKKIFLAVFASCLLAATVIGVVVGVKSRKNNSGE  195
            M+  G  T+ SK  KK+FL VF+S LL A V+G+V GV SRK+++ +
Sbjct  41   MSDSGKHTSISKRNKKLFLLVFSSVLLIAAVVGIVAGVHSRKSSTND  87



Lambda      K        H        a         alpha
   0.317    0.128    0.347    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563261113660