BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS169H06

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   313   4e-104   Nicotiana sylvestris
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   312   1e-103   Nicotiana tomentosiformis
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 311   5e-103   Nicotiana tabacum [American tobacco]
gb|AAB18227.1|  MipC                                                    309   2e-102   Mesembryanthemum crystallinum
gb|ABB13430.2|  plasma membrane intrinsic protein                       306   2e-101   Olea europaea
gb|AFQ23186.1|  aquaporin PIP2;1                                        303   4e-100   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   303   6e-100   Tarenaya hassleriana [spider flower]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   301   1e-99    Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             301   1e-99    
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          301   3e-99    Solanum tuberosum [potatoes]
gb|AFH36337.1|  aquaporin PIP2;2                                        301   3e-99    Quercus petraea [durmast oak]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             301   4e-99    Citrus clementina [clementine]
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     298   4e-99    Eucalyptus grandis [rose gum]
ref|NP_001275065.1|  major intrinsic protein 2                          300   6e-99    Solanum tuberosum [potatoes]
gb|AIA83106.1|  putative aquaporin PIP2                                 300   1e-98    Citrus trifoliata [hardy orange]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         298   4e-98    Ricinus communis
gb|AEC45513.1|  plasma membrane intrinsic protein                       297   9e-98    Hevea brasiliensis [jebe]
ref|NP_001289846.1|  probable aquaporin PIP2-1                          297   1e-97    
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   296   2e-97    Nicotiana sylvestris
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   296   3e-97    Eucalyptus grandis [rose gum]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         296   3e-97    Jatropha curcas
gb|KJB56129.1|  hypothetical protein B456_009G107200                    294   3e-97    Gossypium raimondii
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             296   4e-97    Phaseolus vulgaris [French bean]
gb|AFK47400.1|  unknown                                                 295   8e-97    Lotus japonicus
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   295   9e-97    Nicotiana tomentosiformis
gb|AGD98714.1|  aquaporin protein 11                                    295   1e-96    Camellia sinensis [black tea]
gb|AIA83104.1|  putative aquaporin PIP2                                 294   1e-96    Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             292   2e-96    Elaeis guineensis
gb|KHG00060.1|  putative aquaporin PIP2-2                               294   2e-96    Gossypium arboreum [tree cotton]
gb|KHG29841.1|  putative aquaporin PIP2-2                               294   2e-96    Gossypium arboreum [tree cotton]
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        294   3e-96    Brachypodium distachyon [annual false brome]
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               293   3e-96    Beta vulgaris [beet]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    293   3e-96    Gossypium raimondii
emb|CDP07111.1|  unnamed protein product                                293   5e-96    Coffea canephora [robusta coffee]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   293   6e-96    Elaeis guineensis
gb|AIG92831.1|  aquaporin PIP2                                          293   7e-96    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   293   7e-96    Setaria italica
dbj|BAE02729.1|  PIP aquaporin                                          292   7e-96    Hordeum vulgare [barley]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         292   9e-96    
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             292   1e-95    Elaeis guineensis
gb|AEO13898.1|  aquaporin 7                                             292   1e-95    Triticum aestivum [Canadian hard winter wheat]
gb|ABU94631.1|  putative aquaporin PIP2;3                               291   2e-95    Phaseolus vulgaris [French bean]
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 291   2e-95    Gossypium hirsutum [American cotton]
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   291   2e-95    Gossypium raimondii
ref|NP_001105026.1|  aquaporin PIP2-4                                   291   2e-95    Zea mays [maize]
gb|AAC17529.1|  aquaporin 2                                             291   2e-95    Samanea saman [cow-tamarind]
gb|ABK60195.2|  PIP2 protein                                            291   2e-95    Gossypium hirsutum [American cotton]
gb|KJB62460.1|  hypothetical protein B456_009G418100                    288   2e-95    Gossypium raimondii
gb|AIK66515.1|  putative aquaporin                                      291   3e-95    Vitis vinifera
ref|NP_001047491.1|  Os02g0629200                                       291   3e-95    
gb|KJB36606.1|  hypothetical protein B456_006G166800                    288   3e-95    Gossypium raimondii
gb|EAY86778.1|  hypothetical protein OsI_08158                          291   3e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   291   3e-95    Nelumbo nucifera [Indian lotus]
dbj|BAA23744.1|  HvPIP2;1                                               290   4e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC69040.1|  aquaporin PIP2-1                                        290   5e-95    Rhododendron catawbiense [Catawba rosebay]
gb|ACG33001.1|  aquaporin PIP2.2                                        290   5e-95    Zea mays [maize]
ref|NP_001105025.1|  aquaporin PIP2-3                                   290   5e-95    Zea mays [maize]
gb|EMT09900.1|  Putative aquaporin PIP2-2                               291   5e-95    
ref|NP_001240039.1|  uncharacterized protein LOC100782155               290   5e-95    Glycine max [soybeans]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         290   6e-95    Ricinus communis
gb|ACX37450.1|  plasma membrane intrinsic protein                       290   6e-95    Hevea brasiliensis [jebe]
ref|NP_001289999.1|  aquaporin PIP2-1                                   290   7e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN00691.1|  Aquaporin PIP2-2                                        290   7e-95    Glycine soja [wild soybean]
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             290   7e-95    
gb|AAO39008.1|  plasma intrinsic protein 2,2                            290   1e-94    Juglans regia
ref|NP_001240223.1|  prolactin-inducible protein                        290   1e-94    Glycine max [soybeans]
gb|ADK25057.1|  plasma membrane intrinsic protein                       290   1e-94    Glycine max [soybeans]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        290   1e-94    Phoenix dactylifera
gb|KJB20285.1|  hypothetical protein B456_003G141600                    290   1e-94    Gossypium raimondii
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   289   1e-94    Glycine max [soybeans]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   289   1e-94    Glycine max [soybeans]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            289   1e-94    Juglans regia
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                289   1e-94    Erythranthe guttata [common monkey flower]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          289   1e-94    Gossypium arboreum [tree cotton]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   289   2e-94    Phoenix dactylifera
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               289   2e-94    Elaeis guineensis
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        289   2e-94    Glycine max [soybeans]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          289   2e-94    Sorghum bicolor [broomcorn]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                288   2e-94    Erythranthe guttata [common monkey flower]
gb|ABH09326.1|  putative aquaporin                                      288   3e-94    Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                     288   3e-94    Vitis vinifera
gb|AAV69744.1|  aquaporin                                               288   3e-94    Vitis vinifera
gb|KJB62459.1|  hypothetical protein B456_009G418100                    288   3e-94    Gossypium raimondii
gb|ABB88840.1|  aquaporin                                               288   4e-94    Stevia rebaudiana
gb|ACU20229.1|  unknown                                                 288   4e-94    Glycine max [soybeans]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     288   4e-94    Vitis vinifera
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         288   4e-94    Jatropha curcas
gb|ABK60196.1|  PIP2 protein                                            288   4e-94    Gossypium hirsutum [American cotton]
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     288   5e-94    Vitis cinerea var. helleri x Vitis rupestris
ref|NP_001268056.1|  aquaporin PIP2                                     288   5e-94    Vitis vinifera
gb|KHN05685.1|  Aquaporin PIP2-7                                        288   5e-94    Glycine soja [wild soybean]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          288   6e-94    Gossypium arboreum [tree cotton]
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        288   6e-94    Camelina sativa [gold-of-pleasure]
gb|KHN38765.1|  Aquaporin PIP2-7                                        287   6e-94    Glycine soja [wild soybean]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             287   7e-94    Phaseolus vulgaris [French bean]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             287   1e-93    Phaseolus vulgaris [French bean]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  287   1e-93    Pyrus communis
gb|KHG08488.1|  putative aquaporin PIP2-2                               287   1e-93    Gossypium arboreum [tree cotton]
ref|NP_181254.1|  aquaporin PIP2-2                                      287   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              287   1e-93    
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   287   1e-93    Populus euphratica
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    287   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               286   1e-93    Pyrus x bretschneideri [bai li]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                286   1e-93    Hevea brasiliensis [jebe]
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   286   1e-93    Cicer arietinum [garbanzo]
ref|NP_001237286.1|  PIP2,2                                             286   1e-93    
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             286   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             286   2e-93    Populus trichocarpa [western balsam poplar]
ref|NP_001234625.1|  aquaporin                                          286   2e-93    Solanum lycopersicum
ref|NP_190910.1|  aquaporin PIP2-1                                      286   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   286   2e-93    Camelina sativa [gold-of-pleasure]
ref|NP_001105639.1|  aquaporin PIP2-7                                   286   2e-93    
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               286   2e-93    Nicotiana tomentosiformis
ref|NP_001280185.1|  aquaporin PIP2-2                                   286   2e-93    Prunus mume [ume]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    286   2e-93    Gossypium raimondii
emb|CAB45651.1|  putative plasma membrane intrinsic protein             286   2e-93    Pisum sativum [garden pea]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   286   3e-93    Populus euphratica
gb|ABO69705.2|  aquaporin PIP2                                          285   3e-93    Prunus humilis
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        286   4e-93    
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             285   4e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               285   5e-93    Camelina sativa [gold-of-pleasure]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                285   5e-93    Theobroma cacao [chocolate]
gb|ACU19125.1|  unknown                                                 285   5e-93    Glycine max [soybeans]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               285   5e-93    
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                285   5e-93    Populus trichocarpa x Populus deltoides
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               285   6e-93    Brassica rapa
ref|XP_003606384.1|  Aquaporin PIP2-7                                   282   6e-93    
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             285   8e-93    Capsella rubella
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   285   9e-93    Phoenix dactylifera
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   284   1e-92    Populus euphratica
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     283   1e-92    Eucalyptus grandis [rose gum]
gb|AGD98708.1|  aquaporin protein 5                                     284   1e-92    Camellia sinensis [black tea]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         284   1e-92    Jatropha curcas
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   284   1e-92    Tarenaya hassleriana [spider flower]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             284   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             284   2e-92    Capsella rubella
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               284   2e-92    Populus euphratica
gb|AHG32324.1|  PIP2-3                                                  284   2e-92    Pisum sativum [garden pea]
emb|CDY56697.1|  BnaCnng31040D                                          284   2e-92    Brassica napus [oilseed rape]
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             283   2e-92    Populus trichocarpa [western balsam poplar]
gb|EMS56715.1|  putative aquaporin PIP2-2                               285   2e-92    Triticum urartu
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               283   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             283   4e-92    Phaseolus vulgaris [French bean]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   283   4e-92    Glycine max [soybeans]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               283   4e-92    Eucalyptus grandis [rose gum]
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               283   5e-92    Eucalyptus grandis [rose gum]
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   283   5e-92    Setaria italica
dbj|BAE06148.1|  PIP aquaporin isoform                                  283   5e-92    Hordeum vulgare [barley]
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   282   6e-92    Arabidopsis thaliana [mouse-ear cress]
gb|ACZ06859.1|  plasma membrane intrinsic protein                       282   7e-92    Glycine soja [wild soybean]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   282   7e-92    Nelumbo nucifera [Indian lotus]
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        282   7e-92    Brassica rapa
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        282   8e-92    Camelina sativa [gold-of-pleasure]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             283   8e-92    
dbj|BAF33069.1|  aquaporin                                              282   8e-92    Hordeum vulgare [barley]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          282   8e-92    Gossypium arboreum [tree cotton]
ref|NP_001105616.1|  aquaporin PIP2-5                                   282   9e-92    Zea mays [maize]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               282   9e-92    Brassica rapa
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               282   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   281   1e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   282   1e-91    Medicago truncatula
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               282   1e-91    Phaseolus vulgaris [French bean]
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             281   1e-91    Arabidopsis lyrata subsp. lyrata
gb|ACU21481.1|  unknown                                                 281   1e-91    Glycine max [soybeans]
emb|CDX74983.1|  BnaA05g07290D                                          278   1e-91    
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    281   2e-91    Brassica rapa
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   281   2e-91    Nicotiana tomentosiformis
ref|XP_003625627.1|  Aquaporin PIP2-1                                   281   2e-91    Medicago truncatula
emb|CAH60724.1|  putative plasma membrane intrinsic protein             281   2e-91    Populus tremula x Populus tremuloides
gb|AFK33316.1|  unknown                                                 281   2e-91    Medicago truncatula
gb|ACU24483.1|  unknown                                                 281   2e-91    Glycine max [soybeans]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       281   2e-91    Raphanus sativus
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   281   2e-91    Camelina sativa [gold-of-pleasure]
gb|ACJ85211.1|  unknown                                                 280   2e-91    Medicago truncatula
gb|AAD31846.1|AF133530_1  water channel protein MipH                    281   3e-91    Mesembryanthemum crystallinum
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             281   3e-91    Eutrema salsugineum [saltwater cress]
gb|AHA84284.1|  prolactin-inducible protein                             281   3e-91    Phaseolus vulgaris [French bean]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             281   3e-91    Phaseolus vulgaris [French bean]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               280   3e-91    Populus euphratica
gb|ABU94630.1|  putative aquaporin PIP2;2                               280   4e-91    Phaseolus vulgaris [French bean]
ref|NP_001235204.1|  Pip1 protein                                       280   4e-91    
gb|AGG39693.1|  aquaporin protein AQU15                                 280   4e-91    Camellia sinensis [black tea]
gb|AEQ29857.1|  aquaporin PIP2                                          280   5e-91    Malus prunifolia
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               280   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY13298.1|  BnaC06g14590D                                          280   6e-91    Brassica napus [oilseed rape]
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        280   7e-91    Malus domestica [apple tree]
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    280   8e-91    Nicotiana sylvestris
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     280   8e-91    Lilium hybrid cultivar
gb|AGD98707.1|  aquaporin protein 4                                     280   8e-91    Camellia sinensis [black tea]
gb|ADJ67992.1|  aquaporin                                               280   8e-91    Fragaria x ananassa
emb|CDP06739.1|  unnamed protein product                                280   9e-91    Coffea canephora [robusta coffee]
gb|AEY75244.1|  plasma membrane intrinsic protein                       279   9e-91    Malus hupehensis
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               280   9e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             279   1e-90    Prunus persica
gb|ABI96813.1|  plasma membrane intrinsic protein                       279   1e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AFK47442.1|  unknown                                                 279   1e-90    Medicago truncatula
ref|XP_002316367.1|  putative aquaporin family protein                  279   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   279   2e-90    Morus notabilis
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             279   2e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               278   2e-90    Prunus mume [ume]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   278   2e-90    Setaria italica
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   278   2e-90    Nicotiana sylvestris
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             278   2e-90    Eutrema salsugineum [saltwater cress]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  278   3e-90    Mimosa pudica [sensitive-plant]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            278   3e-90    Cucumis sativus [cucumbers]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               278   3e-90    Pyrus x bretschneideri [bai li]
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        286   3e-90    Cloning vector pBullet-pm-n
ref|NP_181255.1|  aquaporin PIP2-3                                      278   3e-90    Arabidopsis thaliana [mouse-ear cress]
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    278   3e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          278   5e-90    Sorghum bicolor [broomcorn]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            278   5e-90    Juglans regia
gb|AEQ20672.1|  PIP2;1                                                  278   5e-90    Karelinia caspia
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        277   6e-90    Cucumis melo [Oriental melon]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               277   6e-90    
emb|CDX91341.1|  BnaC04g08090D                                          277   6e-90    
emb|CAB46351.1|  major intrinsic protein 2                              277   7e-90    Solanum tuberosum [potatoes]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   277   7e-90    
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         277   7e-90    Helianthemum almeriense
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             274   1e-89    
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  277   1e-89    Pyrus communis
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   276   1e-89    Camelina sativa [gold-of-pleasure]
gb|AAV80229.1|  aquaporin 2                                             276   1e-89    Aegiceras corniculatum
gb|ACU87558.1|  PIP protein                                             276   1e-89    Gossypium hirsutum [American cotton]
gb|ABK93567.1|  unknown                                                 276   2e-89    Populus trichocarpa [western balsam poplar]
gb|ABI96814.1|  plasma membrane intrinsic protein                       276   2e-89    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        276   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        276   2e-89    Brassica rapa
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               276   2e-89    Brachypodium distachyon [annual false brome]
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          276   3e-89    Sorghum bicolor [broomcorn]
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        275   3e-89    Fragaria vesca subsp. vesca
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   276   3e-89    Fragaria vesca subsp. vesca
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   276   3e-89    Cicer arietinum [garbanzo]
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  275   3e-89    Citrus sinensis [apfelsine]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        276   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               275   3e-89    Eucalyptus grandis [rose gum]
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   275   3e-89    
gb|AAY22203.1|  putative aquaporin                                      275   3e-89    Phaseolus vulgaris [French bean]
ref|NP_200874.1|  putative aquaporin PIP2-4                             276   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             275   4e-89    Citrus clementina [clementine]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          275   4e-89    Amborella trichopoda
gb|EMS51072.1|  Aquaporin PIP2-5                                        275   4e-89    Triticum urartu
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   275   4e-89    Brassica rapa
gb|KJB26182.1|  hypothetical protein B456_004G229000                    275   4e-89    Gossypium raimondii
gb|ACJ85173.1|  unknown                                                 275   5e-89    Medicago truncatula
gb|AAW80918.1|  putative plasma membrane intrinsic protein              275   5e-89    Astragalus membranaceus
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               275   6e-89    Populus euphratica
gb|AFH36338.1|  aquaporin PIP2;3                                        275   7e-89    Quercus petraea [durmast oak]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   275   7e-89    Camelina sativa [gold-of-pleasure]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           275   7e-89    Raphanus sativus
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   274   8e-89    Nicotiana sylvestris
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              274   9e-89    Populus trichocarpa [western balsam poplar]
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  274   1e-88    Mimosa pudica [sensitive-plant]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           274   1e-88    Raphanus sativus
gb|ABX83874.1|  plasma membrane intrinsic protein                       274   1e-88    Rhododendron catawbiense [Catawba rosebay]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               274   1e-88    Malus domestica [apple tree]
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   274   1e-88    Camelina sativa [gold-of-pleasure]
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  274   1e-88    Nicotiana tabacum [American tobacco]
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               274   1e-88    
ref|NP_001274397.1|  aquaporin PIP2-1-like                              274   1e-88    Cucumis sativus [cucumbers]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   274   1e-88    Brassica rapa
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    273   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          274   1e-88    Cicer arietinum [garbanzo]
emb|CAH60723.1|  putative plasma membrane intrinsic protein             274   2e-88    Populus tremula x Populus tremuloides
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   274   2e-88    Nicotiana tomentosiformis
emb|CDX91340.1|  BnaC04g08100D                                          273   2e-88    
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               273   2e-88    Pyrus x bretschneideri [bai li]
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   273   3e-88    Setaria italica
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           272   3e-88    Triticum aestivum [Canadian hard winter wheat]
emb|CDX10333.1|  aquaporin                                              273   3e-88    Coffea arabica [arabica coffee]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   273   3e-88    Fragaria vesca subsp. vesca
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        273   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             271   3e-88    
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   270   4e-88    
gb|ADG03686.1|  aquaporin                                               273   4e-88    Hordeum vulgare [barley]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      273   4e-88    Hordeum vulgare [barley]
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   273   4e-88    Citrus sinensis [apfelsine]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             273   5e-88    Citrus clementina [clementine]
ref|NP_001053335.1|  Os04g0521100                                       273   5e-88    
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  272   6e-88    Nicotiana tabacum [American tobacco]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   272   6e-88    
ref|XP_010100853.1|  Aquaporin PIP2-1                                   272   6e-88    
emb|CDX74984.1|  BnaA05g07300D                                          273   6e-88    
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        272   7e-88    
gb|AEY75242.1|  plasma membrane intrinsic protein                       272   7e-88    
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    272   8e-88    
gb|ACV70050.1|  aquaporin PIP2;1                                        270   8e-88    
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                272   9e-88    
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    272   1e-87    
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  273   1e-87    
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    271   1e-87    
ref|XP_002322877.1|  major intrinsic protein 1                          271   1e-87    
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        271   1e-87    
gb|AHG32323.1|  PIP2-2                                                  271   1e-87    
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         271   2e-87    
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               271   2e-87    
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   271   2e-87    
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   271   2e-87    
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             271   2e-87    
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   271   2e-87    
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   271   2e-87    
gb|ABN11917.1|  aquaporin                                               271   3e-87    
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   271   3e-87    
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               271   3e-87    
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                270   3e-87    
ref|XP_003597235.1|  Aquaporin PIP2-7                                   270   3e-87    
ref|NP_001268058.1|  aquaporin-like                                     270   3e-87    
gb|AAF65845.1|AF255795_1  aquaporin 1                                   270   4e-87    
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        270   4e-87    
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                270   4e-87    
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   270   4e-87    
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        270   5e-87    
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        270   5e-87    
gb|ACV70051.1|  aquaporin PIP2;1                                        268   6e-87    
emb|CDX67611.1|  BnaA07g16510D                                          270   6e-87    
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  270   6e-87    
ref|NP_001059542.1|  Os07g0448100                                       270   7e-87    
gb|ACV70049.1|  aquaporin PIP2;1                                        267   7e-87    
emb|CDY46759.1|  BnaA03g17030D                                          269   8e-87    
ref|NP_001105027.1|  aquaporin PIP2-6                                   269   9e-87    
gb|EAZ03711.1|  hypothetical protein OsI_25843                          269   9e-87    
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               269   1e-86    
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        269   1e-86    
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   269   1e-86    
gb|AAL32127.1|  aquaporin                                               269   2e-86    
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   268   2e-86    
emb|CDY07519.1|  BnaC06g15450D                                          268   2e-86    
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        268   2e-86    
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             268   2e-86    
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          268   3e-86    
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     270   3e-86    
ref|NP_001059545.1|  Os07g0448800                                       268   3e-86    
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          268   4e-86    
gb|ACR38689.1|  unknown                                                 266   5e-86    
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   265   5e-86    
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   267   7e-86    
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          267   7e-86    
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               267   7e-86    
emb|CDX73446.1|  BnaC08g25570D                                          267   8e-86    
gb|ACV70048.1|  aquaporin PIP2;1                                        265   8e-86    
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               266   1e-85    
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                265   1e-85    
ref|NP_001267957.1|  aquaporin PIP2;2                                   266   1e-85    
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               266   1e-85    
gb|EAZ03714.1|  hypothetical protein OsI_25847                          266   2e-85    
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        266   2e-85    
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             266   2e-85    
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   265   2e-85    
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    266   3e-85    
gb|ABH09327.1|  putative aquaporin                                      265   3e-85    
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               266   3e-85    
gb|ACV70052.1|  aquaporin PIP2;1                                        263   3e-85    
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          265   3e-85    
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        265   3e-85    
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             265   3e-85    
gb|ACM50914.1|  aquaporin                                               265   4e-85    
gb|AGD98705.1|  aquaporin                                               265   4e-85    
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     268   4e-85    
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    265   4e-85    
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     265   4e-85    
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             265   5e-85    
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             265   5e-85    
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                263   6e-85    
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             265   6e-85    
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                265   7e-85    
dbj|BAF32042.1|  putative aquaporin                                     264   7e-85    
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             264   7e-85    
ref|NP_001274308.1|  aquaporin PIP2-1-like                              264   9e-85    
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   263   9e-85    
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               264   1e-84    
ref|NP_001105024.1|  aquaporin PIP2-1                                   264   1e-84    
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                265   1e-84    
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               264   1e-84    
ref|NP_001274381.1|  aquaporin PIP2-7-like                              263   1e-84    
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          264   2e-84    
emb|CAC82712.1|  major intrinsic protein 1                              263   2e-84    
ref|NP_001274386.1|  aquaporin PIP2-1-like                              263   2e-84    
ref|NP_191042.1|  putative aquaporin PIP2-5                             263   3e-84    
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          263   3e-84    
gb|AAO86707.1|  aquaporin                                               263   3e-84    
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               263   3e-84    
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               263   3e-84    
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   262   5e-84    
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             262   5e-84    
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         262   5e-84    
ref|NP_001105638.1|  aquaporin PIP2-2                                   262   6e-84    
gb|AAC16545.1|  aquaporin                                               262   6e-84    
gb|ACV70056.1|  aquaporin PIP2;3                                        259   7e-84    
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        261   9e-84    
dbj|BAF32141.1|  putative aquaporin                                     261   9e-84    
gb|KJB73581.1|  hypothetical protein B456_011G239500                    260   1e-83    
gb|ACF79873.1|  unknown                                                 261   1e-83    
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        261   1e-83    
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               262   2e-83    
gb|ACV70053.1|  aquaporin PIP2;2                                        259   2e-83    
gb|ACG39551.1|  aquaporin PIP2.1                                        261   2e-83    
gb|ACV70057.1|  aquaporin PIP2;3                                        258   3e-83    
gb|AFQ23181.1|  aquaporin PIP2;2                                        260   3e-83    
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          257   3e-83    
gb|ACV70054.1|  aquaporin PIP2;3                                        258   4e-83    
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  260   5e-83    
gb|ABH09328.1|  putative aquaporin                                      260   5e-83    
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   259   5e-83    
ref|XP_002876271.1|  PIP2_5/PIP2D                                       259   5e-83    
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             257   5e-83    
ref|NP_001289823.1|  aquaporin PIP2-1-like                              259   6e-83    
gb|AGD98712.1|  aquaporin protein 9                                     259   8e-83    
dbj|BAG68661.1|  plasma membrane intrinsic protein                      259   8e-83    
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          259   9e-83    
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    259   1e-82    
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   259   1e-82    
gb|KJB73580.1|  hypothetical protein B456_011G239500                    258   1e-82    
gb|ACG32567.1|  aquaporin PIP2.1                                        259   1e-82    
gb|ACB87734.1|  aquaporin                                               258   1e-82    
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          258   1e-82    
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    258   2e-82    
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 258   2e-82    
gb|ABM54183.1|  aquaporin                                               258   2e-82    
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               258   2e-82    
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               258   2e-82    
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     259   2e-82    
gb|ACV70047.1|  aquaporin PIP2;1                                        256   2e-82    
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 258   3e-82    
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      254   4e-82    
ref|XP_002879778.1|  PIP2_6/PIP2E                                       258   4e-82    
gb|ABK21046.1|  unknown                                                 257   4e-82    
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  258   4e-82    
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               257   5e-82    
gb|AFH36336.1|  aquaporin PIP2;1                                        257   5e-82    
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     259   5e-82    
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   257   6e-82    
gb|AFQ23567.1|  aquaporin PIP2;2                                        257   6e-82    
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               256   7e-82    
gb|EPS68613.1|  hypothetical protein M569_06155                         256   8e-82    
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   256   8e-82    
gb|ACV70055.1|  aquaporin PIP2;3                                        254   1e-81    
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             256   1e-81    
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   256   1e-81    
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   256   2e-81    
gb|ABK22146.1|  unknown                                                 256   2e-81    
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        255   2e-81    
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        255   2e-81    
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             252   3e-81    
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               255   4e-81    
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                254   4e-81    
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   254   7e-81    
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     254   7e-81    
gb|ACB71281.1|  plasma membrane intrinsic protein                       254   7e-81    
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     254   7e-81    
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    254   9e-81    
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    254   1e-80    
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               253   1e-80    
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               253   1e-80    
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               253   1e-80    
emb|CDY09192.1|  BnaA02g06180D                                          253   1e-80    
gb|AFO63679.1|  plasma intrinsic protein 2                              253   1e-80    
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        253   2e-80    
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               253   2e-80    
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               253   2e-80    
emb|CDX88767.1|  BnaA03g08820D                                          252   2e-80    
gb|AAG44947.1|AF290620_1  putative PIP2                                 253   2e-80    
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        253   2e-80    
ref|XP_010107541.1|  Aquaporin PIP2-2                                   253   3e-80    
gb|ACE60220.1|  plasma membrane aquaporin                               252   3e-80    
gb|ACU87555.1|  PIP protein                                             252   3e-80    
emb|CDY53629.1|  BnaC09g53920D                                          251   3e-80    
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 252   4e-80    
gb|ABK22504.1|  unknown                                                 252   4e-80    
gb|ACV66986.1|  plasma membrane aquaporin 2                             252   5e-80    
ref|NP_179277.1|  putative aquaporin PIP2-8                             252   5e-80    
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               252   5e-80    
gb|ABK24173.1|  unknown                                                 251   5e-80    
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               252   5e-80    
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   251   7e-80    
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             251   9e-80    
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        251   1e-79    
gb|ABL76066.1|  aquaporin 2                                             251   1e-79    
ref|XP_002306187.1|  membrane intrinsic family protein                  251   1e-79    
emb|CDY14415.1|  BnaC03g21800D                                          251   1e-79    
ref|NP_001288933.1|  probable aquaporin PIP2-6                          251   1e-79    
emb|CDY31523.1|  BnaA10g13480D                                          250   1e-79    
gb|KJB15839.1|  hypothetical protein B456_002G198900                    248   1e-79    
gb|KJB12139.1|  hypothetical protein B456_002G002500                    251   1e-79    
gb|AAC32107.1|  probable aquaporin                                      251   1e-79    
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        251   1e-79    
gb|ADL16407.1|  aquaporin                                               251   1e-79    
gb|ACU87556.1|  PIP protein                                             251   1e-79    
gb|ABK24624.1|  unknown                                                 251   2e-79    
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               251   2e-79    
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                250   2e-79    
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    251   2e-79    
gb|KHN33668.1|  Aquaporin PIP2-7                                        250   2e-79    
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   250   2e-79    
emb|CDX71032.1|  BnaC03g11160D                                          249   2e-79    
gb|ACU14125.1|  unknown                                                 249   2e-79    
gb|KJB15836.1|  hypothetical protein B456_002G198900                    248   2e-79    
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               250   2e-79    
gb|ABK23750.1|  unknown                                                 250   2e-79    
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        251   2e-79    
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             249   2e-79    
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    250   3e-79    



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   313 bits (803),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM++QCLGAICGVGLVKAFQK++YNRYGGG N MA G+NKG GLGAEIIGT
Sbjct  121  KVSLMRAVLYMVSQCLGAICGVGLVKAFQKAYYNRYGGGVNVMAGGHNKGVGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM++QCLGAICGVGLVKAFQK++YNRYGGG N MA G+NKG GLGAEIIGT
Sbjct  121  KVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYYNRYGGGVNVMAGGHNKGVGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   311 bits (796),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM++QCLGAICGVGLVKAFQK+++NRYGGG N MA G+NKG GLGAEIIGT
Sbjct  121  KVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYFNRYGGGVNVMAGGHNKGVGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE   +Q  EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L +AVLYM+AQCLGAICGVG VKAFQK++Y RYGGGANEMA+GY KGTGLGAEIIGT
Sbjct  121  KVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVF+
Sbjct  181  FVLVYTVFA  189



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE+  E   E+SAKDYHDPPP+PLIDFDEL+ WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  61   VIGYKSQIDPAHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQKS+Y++YGGGANE+A GYNKG GLGAEIIGT
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNKGVGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+VE V EQP E+SAKDYHDPPP+   D DELTKWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQP-EYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQTDP AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKHQTDPDAGGADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRA  YM+AQCLGAICGVGLVKAFQ+S+Y+RY GGAN +A GY KG GL AEIIGT
Sbjct  120  KVSLPRAFFYMVAQCLGAICGVGLVKAFQRSYYHRYEGGANMVAPGYTKGVGLSAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V E   EF+AKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKVQSDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+YNRYGGGAN +A+GYNKGTGLGAEIIGT
Sbjct  120  KVSLVRALLYMVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVF+
Sbjct  180  FVLVYTVFA  188



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  214  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA+LYM+AQCLGAICG G VKAFQKS+YNRYGGGANE+A GYNKGTGLGAEII
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  214  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA+LYM+AQCLGAICG G VKAFQKS+YNRYGGGANE+A GYNKGTGLGAEII
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VE+V E+  EFSAKDY DPPP+PL+DF+ELT+WSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVESVTER-GEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY+HQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYQHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++YNRYGGG N MAAG+NKG GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAAGHNKGVGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  E+SAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPLKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQKS Y RYGGGANE+AAGYNKGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  214  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA+LYM+AQCLGAICG G VKAFQKS+YNRYGGGANE+A GYNKGTGLGAEII
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM+AQCLGAICG GLVKAFQK++Y RYGGGANE+  GY+KGT LGAEIIGT
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   300 bits (769),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VEAV EQ AE+SAKDY DPPP+PLIDF+ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ D  AGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVDAGGDVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++YNRYGGG N MA G+ KG GL AEIIGT
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAPGHTKGVGLAAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVY VFS
Sbjct  181  FVLVYVVFS  189



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 169/194 (87%), Gaps = 5/194 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPA-----EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllfly  204
            M KDVE   +Q       EFSAKDYHD PP+PLIDFDEL KWSFYRAVIAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  205  vtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  384
            VTVLTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG
Sbjct  61   VTVLTVIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  120

Query  385  LFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGA  564
            LFL RKV+L RA+LYM+AQCLGAICG G VKAFQKS+YNRYGGGANE+A GYNKGTGLGA
Sbjct  121  LFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGA  180

Query  565  EIIGTFVLVYTVFS  606
            EIIGTFVLVYTVFS
Sbjct  181  EIIGTFVLVYTVFS  194



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EFSAKDYHDPPP+PLID DEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQTDPDKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM+AQCLGAICG GLVKAFQK++YNRYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  121  KVSLIRALGYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   297 bits (760),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V E P EFSAKDYHDPPP+PLID +EL KWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVE-VAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  60   VIGYKSQTDPLKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQK++YNRYGGGANE++ GYNKGTGLGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELSDGYNKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VEA  EQ  E+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIATLLFLYITILT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ D KAGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVKAGGDICGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG VKAFQ ++YNRYGGG N MA G+ KG GL AEIIGT
Sbjct  121  KVSLIRAILYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAGGHTKGVGLAAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVY VFS
Sbjct  181  FVLVYVVFS  189



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VE   EQP EFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN MA G+ KG GL AEIIGT
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM+AQCLGAICG GLVKAFQK++Y RYGGGANE+  GY+KGT LGAEIIGT
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V E   EFS KDYHDPPP+PLID DEL +WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKSQTDPNKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YMIAQCLGAICG GLVKAFQK++YNRYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   294 bits (752),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVF+
Sbjct  181  GTFVLVYTVFA  191



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVT--ERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAFQKS+YNRYGGGAN +A GY+ GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   295 bits (755),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS+KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D K GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKVQSDVKNGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQKS YN+YGGGAN +  GY+ GTGLGAEIIGT
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQKSHYNKYGGGANSLNDGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VE   EQ AEFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVK FQ ++Y RYGGGAN MA G+ KG GL AEIIGT
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGLVKGFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+VE       EFSAKDYHDPPP+PL+D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPIKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICGVGLVKAFQ+++Y+RYGGGANE+A GYNKGT LGAEIIGT
Sbjct  121  KVSLIRALLYMVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE---FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  210
            M KDVE   +Q      FSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  211  vltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VLT IGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  61   VLTAIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  120

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            L RKV+L RA+LYM+AQCLGAICG G VKAFQKS+YNRYGGGANE+A GYNKGTGLGAEI
Sbjct  121  LGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEI  180

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  181  IGTFVLVYTVFS  192



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 171/191 (90%), Gaps = 6/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICGVGLVKAFQK++YNRYGGG NE+++GY+KGTGL AEII
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEII  176

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  177  GTFVLVYTVFS  187



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKD+E   ++  EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVF+
Sbjct  181  GTFVLVYTVFA  191



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 170/193 (88%), Gaps = 4/193 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            MTKD+E   EQ   AEFSAKDYHDPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  214  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  387
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  388  FLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAE  567
            F+ RKV+L RA+LYM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAE
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAE  180

Query  568  IIGTFVLVYTVFS  606
            IIGTFVLVYTVFS
Sbjct  181  IIGTFVLVYTVFS  193



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+P++DF+ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLY++AQCLGAICGVGLVK FQ ++Y RYGGGANE++AGY+KGTGL AEII
Sbjct  121  ARKVSLVRAVLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSAGYSKGTGLAAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 1/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+ YM+AQCLGAICGVG VKAFQ ++Y+RYGGGAN+MA GYNKGTGLGAEIIG
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMAHGYNKGTGLGAEIIG  180

Query  577  TFVLVYTVFS  606
            TFVLVYTVF+
Sbjct  181  TFVLVYTVFA  190



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  220  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVF+
Sbjct  181  GTFVLVYTVFA  191



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
 emb|CDX10334.1| aquaporin [Coffea arabica]
Length=288

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +1

Query  40   MTKDVE-AVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE  V  +  EFSAKDYHDPPP+   D DELTKWSF+RA+IAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLYVTVL  60

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYKHQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGYKHQTDATAGGDDCNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA  YM+AQCLGAICGVGLVKAFQKSFYNRYGGGAN +A GY  G GL AEIIG
Sbjct  121  RKVSLLRAFFYMVAQCLGAICGVGLVKAFQKSFYNRYGGGANVVAHGYTIGVGLAAEIIG  180

Query  577  TFVLVYTVFS  606
            TFVLVYTVF+
Sbjct  181  TFVLVYTVFA  190



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   293 bits (749),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 8/191 (4%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA      EF+AKDY DPPP+PLID +EL KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEA------EFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVAT  54

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  55   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  114

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICGVGLVK+FQK++YNRYGGGANE+++GY+KGTGL AEII
Sbjct  115  ARKVSLIRALLYMIAQCLGAICGVGLVKSFQKAYYNRYGGGANELSSGYSKGTGLAAEII  174

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  175  GTFVLVYTVFS  185



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 167/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDV   PEQ   FSAKDYHDPPP+PLID  EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDV---PEQ-GSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK  TDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSTTDPALNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAF KS YNRYGGGAN +A GYNKGTGLGAEIIGT
Sbjct  117  KVSLIRAIMYMVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLY+IAQCLGAICGVGLVK FQ +++ RYGGGANE++AGY+KGTGL AEII
Sbjct  121  ARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAYFVRYGGGANELSAGYSKGTGLAAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   292 bits (748),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 170/191 (89%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   292 bits (748),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--ERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAFQKS++N+YGGGAN +AAGY+ GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 171/191 (90%), Gaps = 6/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICGVGLVKAFQK++YNRYGGG NE+++GY+KGTGL AEII
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEII  176

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  177  GTFVLVYTVFS  187



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVT--ERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAFQKS+YNRYGGGAN +A GY+ GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  214  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  387
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  388  FLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAE  567
            F+ RKV+L RA+LYM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAE
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAE  180

Query  568  IIGTFVLVYTVFS  606
            IIGTFVLVYTVFS
Sbjct  181  IIGTFVLVYTVFS  193



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQKS+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AEII
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQK++Y+RYGGGAN ++ GY+ GTGLGAEIIGT
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIA LLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQKS+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   288 bits (737),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM AQCLGAICG GLVKAFQ S+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++YNRYGGGANE+A GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++ GY+KGTGLGAEII
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM AQCLGAICG GLVKAFQKS+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++ GY+KGTGLGAEII
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE+   + ++FSAKDYHDPPP+ LID DEL+KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVES--SEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD    G DCGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKRQTDSSHNGTDCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+Y+IAQCLGAICGVGLVK FQKS+Y RYGGGANE+A GY+KG GL AEIIGT
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVGLVKGFQKSYYVRYGGGANELADGYSKGVGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVG LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 10/191 (5%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+KDVE V EQPA +SAKDYHDPPP+ LID +EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MSKDVE-VAEQPA-YSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQT--DPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QT  DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKSQTTTDP------CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  112

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLYM+AQCLGAICGVGLVKAFQKS+++RYGGGANE+A+GYNKGT LGAEII
Sbjct  113  ARKVSLFRAVLYMVAQCLGAICGVGLVKAFQKSYFDRYGGGANEVASGYNKGTALGAEII  172

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  173  GTFVLVYTVFS  183



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PL+D +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY++AQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AEII
Sbjct  121  ARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  46   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvI  225
            +D+EA   +  EFSAKDY DPPP+PLID DELTKWS YRAVIAEFIATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  226  GYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            GYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  64   GYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  123

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LY+IAQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AEIIGT
Sbjct  124  KVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGT  183

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  184  FVLVYTVFS  192



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score =   291 bits (745),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V     EF AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQTDPAKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM AQCLGAICG GLVKAFQ+++YNRYGGGANE+A GY+ GTGLGAEIIGT
Sbjct  120  KVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVF+
Sbjct  180  FVLVYTVFA  188



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V  Q  EF AKDY+DPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKSQTDPAKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQK++YNRYGGGANE+A GY+KGTGLGAEIIGT
Sbjct  120  KVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   290 bits (742),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTIGLFLA  120

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+ YM+AQCLGAICGVG VKAFQ ++Y+RYGGGAN+M+ GYNKGTGLGAEIIG
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMSHGYNKGTGLGAEIIG  180

Query  577  TFVLVYTVFS  606
            TFVLVYTVF+
Sbjct  181  TFVLVYTVFA  190



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   290 bits (742),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>ref|XP_002877918.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54177.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   290 bits (742),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DYHDPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYHDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRA+LY++AQCLGAICGVG VKAFQ S+Y+RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRAILYIVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQCLGA+CG GLVKAFQK++Y++YGGGANE+A GY+KGTGL AEIIGT
Sbjct  119  KVSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICG GL K FQK++YNRYGGGAN +A GYN GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICG GL K FQK++YNRYGGGAN +A GYN GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 169/191 (88%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA  E   EF+AKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+D   GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICG GLVK FQK++Y RYGGGANE+++GY++GTGL AEII
Sbjct  120  ARKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSRGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  30   MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  89

Query  214  ltvIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  387
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  90   LTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  149

Query  388  FLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAE  567
            F+ RKV+L RA+LYM+AQCLGAICG GLVKAFQK++YN YGGGANE+  G+NKGTGLGAE
Sbjct  150  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAE  209

Query  568  IIGTFVLVYTVFS  606
            IIGTFVLVYTVFS
Sbjct  210  IIGTFVLVYTVFS  222



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGA+CGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             F+AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQCLGA+CG GLVKAFQK++Y++YGGGANE+A GY+KGTGL AEIIGT
Sbjct  119  KVSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+VE   E  AEF+AKDYHDPPP+PLID+DELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECA-EPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQSEY----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQKS YN++GGGAN +A GYNKGTGLGAEIIGT
Sbjct  116  KVSLIRAVLYMVAQCLGAICGVGFVKAFQKSHYNKFGGGANTLALGYNKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  G QDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQKS+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 168/191 (88%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA  E   EF+AKDY DPPP+PLID +ELT WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICG GLV+ FQK++Y RYGGGANE+++GY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 170/191 (89%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA  E   EF+AKDY DPPP+ LID +E+ KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEG-GEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICGVGLVK FQ+++Y+RYGGGANE+++GY+KGTGL AEII
Sbjct  120  ARKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICG GL K FQKS+YNRYGGGAN +A GYN GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKSYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA   +  EFSAKDY DPPP+PLID  ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AEII
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE   + PA FSAKDYHDPPP+PL D  ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVECA-DPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKVQSDAVHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQKS+Y RYGGGAN +A GYN G GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYVRYGGGANTLAHGYNTGVGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y+RYGGGANE++ GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y+RYGGGANE++ GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y+RYGGGANE++ GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM AQCLGAICG GLVKAFQ S+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +1

Query  91   KDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQDC  270
            KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYK QTDP      C
Sbjct  12   KDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLNTDQC  71

Query  271  GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLG  450
            GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLG
Sbjct  72   GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCLG  131

Query  451  AICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            AICGVGLVKAFQ S+YNRYGGGANE+A GYNKGTGLG EIIGTFVLVYTVFS
Sbjct  132  AICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFS  183



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y+RYGGGANE++ GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       +F AKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEG-----GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQTDPSKNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQK++Y RYGGGANE+A GY+KGTGLGAEIIGT
Sbjct  116  KVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM AQCLGAICG GLVKAFQ S+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y+RYGGGANE++ GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 167/189 (88%), Gaps = 7/189 (4%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDVE   +   EFS KDYHDPPP+PLID DELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVETSGQ---EFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQSDT----DPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YMIAQCLGA+CGVGLVKAFQ S YNRYGGGANE+A GYNKG GLGAEIIGT
Sbjct  114  KVSLVRALMYMIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGT  173

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  174  FVLVYTVFS  182



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICG GL K FQK++YNRYGGGAN +A GYN GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+ YM AQCLGAICG GLVKAFQKS+YN+YGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_010426989.1| PREDICTED: aquaporin PIP2-1 [Camelina sativa]
Length=287

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY+IAQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQC GAICG GL K FQK++YNRYGGGAN +A GYN GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   287 bits (735),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDAKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++Y RYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFS  185



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YN+YGGGANE++ GY+ G GLGAEIIGTFVLVYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTFVLVYTVFS  185



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y +YGGGANE++AGYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 169/191 (88%), Gaps = 5/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQ---VSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  220  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+ +G+NKGTGLGAEII
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEII  177

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  178  GTFVLVYTVFS  188



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y+RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+VE   +   EFSAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  220  vIGYKHQTD--PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTD        DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+  GYNKGTGLGAEII
Sbjct  121  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGYNKGTGLGAEII  180

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  181  GTFVLVYTVFS  191



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y  YGGGANE+A G++KGTGLGAEIIGT
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|AEH76326.1| plasma membrane intrinsic protein 2A [Camelina sativa]
Length=287

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGFDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY+IAQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y +YGGGANE++AGYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDV    EQ   F AKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVT---EQ-GSFPAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAI GVGLVKAFQ SFY RYGGGAN +AAGY+KG GLGAEIIGT
Sbjct  117  KVSLVRAVMYMVAQCLGAIAGVGLVKAFQSSFYKRYGGGANSLAAGYSKGVGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE   ++  EFSAKDY DPPP+PLIDFDELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQC GAI G GL K FQK++++RYGGGAN +  GYNKGT LGAEIIGT
Sbjct  119  KVSLLRAVFYMAAQCAGAISGTGLAKGFQKAYFDRYGGGANFVHDGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LYMIAQC GAICG GL K FQKSFYNRYGGG N ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV----RGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y +YGGGANE+A G++KGTGLGAEIIGT
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y +YGGG NE+A G++KGTGLGAEIIGT
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 167/189 (88%), Gaps = 7/189 (4%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+V        +FSAKDY DPPP+PL+DF+EL +WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MTKEVT-------DFSAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLYVTILT  53

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  54   VIGYKHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++YNRYGGG N MA G++KG GLGAEIIGT
Sbjct  114  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAGGHSKGVGLGAEIIGT  173

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  174  FVLVYTVFS  182



>ref|NP_190910.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 ref|NP_001030851.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 sp|P43286.1|PIP21_ARATH RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; Short=AtPIP2;1; AltName: Full=Plasma 
membrane intrinsic protein 2a; Short=PIP2a; Contains: RecName: 
Full=Aquaporin PIP2-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16195.1|AF428426_1 AT3g53420/F4P12_120 [Arabidopsis thaliana]
 emb|CAA53477.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 emb|CAB67649.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAK62634.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAK73268.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAL06973.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAL62366.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAM65406.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AEE79083.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 gb|AEE79084.1| aquaporin PIP2-1 [Arabidopsis thaliana]
Length=287

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRA+LY+IAQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010504105.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
 ref|XP_010515832.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
Length=287

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE VP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY+IAQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LYMIAQC GAICG GL K FQKSFYNRYGGG N ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTVLT
Sbjct  1    MGKDVEAA----TEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVG VKAFQ ++Y+RYGGGAN MAAG+ KG GL AEIIGT
Sbjct  117  KVSLIRALVYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANVMAAGHTKGVGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY+IAQ LGAICGVGLVKAFQK++Y  YGGGANE+AAGYNKGTGLGAEIIGT
Sbjct  115  KVSLPRAVLYIIAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 169/191 (88%), Gaps = 5/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQG---SGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  220  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RA++YM+AQCLGAICG GLVKAFQK++YN YGGGANE+ +G+NKGTGLGAEII
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEII  177

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  178  GTFVLVYTVFS  188



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE   ++  E+SAKDY DPPP+PLID DELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGY HQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQTDANAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQC GA+CG GL K FQKSF++RYGGGAN +  GYNKGT LGAEIIGT
Sbjct  119  KVSLLRAVFYMAAQCAGAVCGTGLAKGFQKSFFDRYGGGANFIHDGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF+AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y  YGGGANE+A G++KGTGLGAEIIGT
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY++AQ LGAICGVGLVKAFQK++Y  YGGGANE+AAGYNKGTGLGAEIIGT
Sbjct  115  KVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LYMIAQC GAICG GL K FQKS+YNRYGGG N ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAFQSSYYIRYGGGANSLAEGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD++ V E  A  +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       +F AKDYHDPPP+PL+D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDK--GGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG GLVKAFQKS+YNRYGGGAN +A GY+ GTGLGAEIIGT
Sbjct  115  KVSLVRAILYMAAQCLGAICGCGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LYMIAQC GAICG GL K FQKS+YNRYGGG N ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   285 bits (729),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 169/189 (89%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+ KDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y +YGGGANE++AGYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   285 bits (729),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y +YGGGANE+A G++KGTGLGAEIIGT
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   ++    +A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+YNRYGGGAN++A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   282 bits (722),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQ  GAICG GL K FQK++++RYGGGAN +  GYNKGT LGAEIIGT
Sbjct  119  KVSLIRAVFYMAAQSAGAICGTGLAKGFQKAYFDRYGGGANFVHDGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006291609.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
 gb|EOA24507.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
Length=287

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE VP +   F  +DY DPPP+P  D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKLQSDLKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY+IAQCLGAICGVG VKAFQ S Y +YGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAFQSSHYIKYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 168/191 (88%), Gaps = 5/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA     A F+AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MGKDMEA---GAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVAT  57

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMIAQCLGAICG GLVK FQK++Y RYGGGANE+++GY+KGTGL AEII
Sbjct  118  ARKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSKGTGLAAEII  177

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  178  GTFVLVYTVFS  188



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y  YGGGAN +A GY+KG GLGAEIIGT
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTSYGGGANGLAIGYSKGNGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            +V+L RA+LYM+AQCLGA+CG GLVKAFQ+++Y RYGGGAN + AGY+KGTGLGAEIIGT
Sbjct  121  RVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTV S
Sbjct  181  FVLVYTVLS  189



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+Y++AQCLGAICGV LVKAFQ+++Y+RYGGGANE+A GYNKGT LGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDV     +   FSAKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVA----EQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQ LGAICGVGLVKAFQ ++Y RYGGGAN +A GY+ G GLGAEIIGT
Sbjct  117  KVSLVRAVMYMVAQSLGAICGVGLVKAFQSAYYKRYGGGANTLADGYSTGVGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE        F A+DY DPPP+ L+D +ELT+WSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGGVAGEG-FPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  60   VIGYKSQTDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KVTL RA+LYM+AQCLGAICGVGLVKAFQ S+Y+RYGGGAN +A GY+KGTGL AEIIGT
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLAR
Sbjct  59   VIGYKAQTDASAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG G VKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E         + +DY DPPP+PLID +EL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVAEHGE---TVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP  G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPDKGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQKSFYN YGGGANE+  GYNKGTGLGAEIIGT
Sbjct  118  KVSLIRAVLYMVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTD KAGG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQ LGAICGVGLVKAFQKS++ RYGGGAN +  GY+ G GLGAEI+GT
Sbjct  119  KVSLIRAVMYMVAQSLGAICGVGLVKAFQKSYFVRYGGGANFLQPGYSTGVGLGAEIVGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E         + KDY DPPP+PLID +EL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVAEHGE---TVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP  G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPDKGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQKS+YN YGGGANE+  GYNKGTGLGAEIIGT
Sbjct  118  KVSLIRAVLYMVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>gb|EMS56715.1| putative aquaporin PIP2-2 [Triticum urartu]
Length=341

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P Q  EFS K Y  PPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKSYAAPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY+IAQCLGAICGVGLVK FQ S+Y RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD++ V E  A   ++DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  180  FVLVYTVFS  188



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 164/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LY++AQC GAI G GL KAFQKSFYNRYGGGAN ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAKAFQKSFYNRYGGGANTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 167/189 (88%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAFQKS++N+YGGGAN +A GY+ GTGLGAEIIGT
Sbjct  116  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            +V+L RA+LYM+AQCLGA+CG GLVKAFQ+++Y RYGGGAN + AGY+KGTGLGAEIIGT
Sbjct  121  RVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTV S
Sbjct  181  FVLVYTVLS  189



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    QP   +A+DY DPPP+PL+D +EL KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDLEG--AQP-PLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP   G DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTMNGSDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICG GLVKAFQ+++Y RYGGGANE+A GY+KG GLGAEI+GT
Sbjct  118  KVSLVRAVMYMVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   283 bits (724),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 169/193 (88%), Gaps = 5/193 (3%)
 Frame = +1

Query  40   MTKDVEAV--PEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  213
            M KD+EA   PE   E++AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV
Sbjct  1    MAKDIEAAAAPEG-GEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITV  59

Query  214  ltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  387
             TVIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGL  119

Query  388  FLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAE  567
            FLARKV+L RA+LY++AQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AE
Sbjct  120  FLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAE  179

Query  568  IIGTFVLVYTVFS  606
            IIGTFVLVYTVFS
Sbjct  180  IIGTFVLVYTVFS  192



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score =   283 bits (724),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 166/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            LARKV+L RAVLY+IAQCLGAICGVGLVK FQ +FY RYGGGANE++AGY+KGTGL AEI
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEI  179

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  180  IGTFVLVYTVFS  191



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG  ++FQ S+Y+RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFRQSFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 167/189 (88%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVGLVKAFQKS++N+YGGGAN +A GY+ GTGLGAEIIGT
Sbjct  116  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY+ QTD    G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYRSQTDQAHNGGDCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVK FQK++Y R GGGAN +A GY+KG GLGAEIIGT
Sbjct  119  KVSLIRAVMYMVAQCLGAICGVGLVKGFQKAYYMRSGGGANSLALGYSKGVGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAV  +   F  +DY DPPP+PL D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   283 bits (723),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   AMTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            AM KD++   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VL
Sbjct  12   AMAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVL  69

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA
Sbjct  70   TVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLA  129

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIG
Sbjct  130  RKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIG  189

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  190  TFVLVYTVFS  199



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 165/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P    E+ AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            LARKV+L RAVLY+IAQCLGAICGVGLVK FQ +FY RYGGGANE++AGY+KGTGL AEI
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEI  179

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  180  IGTFVLVYTVFS  191



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   282 bits (721),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = +1

Query  67   EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  246
            E   EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATL FLY+TVLTVIGYK QTD
Sbjct  6    EVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGYKTQTD  65

Query  247  PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVL  426
               GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ 
Sbjct  66   LAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIF  125

Query  427  YMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            YM AQCLGAICG GLVKAFQ S+YN+YGGGAN +A GY+ GTGL AEIIGTFVLVYTVFS
Sbjct  126  YMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFVLVYTVFS  185



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 166/191 (87%), Gaps = 6/191 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA     A    KDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA----AAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVAT  56

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQTD  A G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFL
Sbjct  57   VIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFL  116

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LY++AQCLGAICGVGLVK FQ +FY RYGGGANE++AGY+KGTGL AEII
Sbjct  117  ARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEII  176

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  177  GTFVLVYTVFS  187



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E V E  A   A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLE-VQEGRA---ARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKAQTDASAGGADCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+YNRYGGGAN++A GYNKGTGLGAEIIGT
Sbjct  117  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVY VF+
Sbjct  177  FVLVYPVFA  185



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD++   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  40   MTKDVEAVP-EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            MTKDVEAV  +Q  EF   DYHDPPP+PLID +EL KW FYRA+IAEF+ATLLFLYVT+L
Sbjct  1    MTKDVEAVSVQQQPEFLDIDYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLYVTIL  60

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIG+   +D  AGG+ CGGVGILGIAW FGGMIFILVYCTA ISGGHINPAVTFGLFLA
Sbjct  61   TVIGHSRNSDLGAGGKSCGGVGILGIAWTFGGMIFILVYCTAPISGGHINPAVTFGLFLA  120

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+ YM+AQCLGAICGVG VKAFQ ++Y+RYGGGAN+M+ GYNKGTGLGAEIIG
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMSHGYNKGTGLGAEIIG  180

Query  577  TFVLVYTVFS  606
            TFVLVYTVF+
Sbjct  181  TFVLVYTVFA  190



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV YM AQ  GAICG GL K FQK++++RYGGGAN +  GYNKGT LGAEIIGT
Sbjct  119  KVSLIRAVFYMAAQSAGAICGTGLAKGFQKAYFDRYGGGANFVHDGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 164/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LY++AQC GAI G GL +AFQKSFYNRYGGGAN ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAEAFQKSFYNRYGGGANTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDKTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E+SAKDYHDPPP+PLI  DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LYMIAQC GAICG GL K FQKSFYNRYGGG N ++ GYNK T LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKSTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   ++    +A+DY DPPP+PL+D +E  KWS YRAVIAEF+ TLLFLYV+VLT
Sbjct  1    MAKDLEV--QEGGATAARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLAR
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            K++L RAV+YMIAQCLGAICG GLVKAFQKS+Y RYGGGANE+A GY+ GTGL AEIIGT
Sbjct  119  KISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQK +YNRY GGAN ++AGY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD    G  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y +YGGGAN +A+G++KGT LGAEIIGT
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQK +YNRY GGAN ++AGY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCL AICGVGLVKAFQKS++N+YGGGAN +A GY+ GTGLGAEIIGT
Sbjct  116  KVSLIRAIMYMVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK +TD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIETDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVGLVKAFQK +YNRY GGAN ++AGY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD E    +  +  AKDY DPPPSPL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDFETGGGEVRDV-AKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP   G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARK++L RA++YM+AQCLGAICGVG VKAFQ ++YN+YGGGANE++ GY+KGTGL AEII
Sbjct  120  ARKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 163/189 (86%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG-----EGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKIQSDTAAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GYN GTGL AEIIGT
Sbjct  116  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LY++AQC GAICG GL K FQK++YNRYGGGAN +A GYNKGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LY++AQC GAICG GL K FQK++YNRYGGGAN +A GYNKGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y RYGGGAN +A G++ GTGLGAEIIGT
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT G FL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGSFLG  119

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LY++AQC GAI G GL KAFQKSFYNRYGGGAN ++ GYNKGT LGAEIIG
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAKAFQKSFYNRYGGGANTVSDGYNKGTALGAEIIG  179

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  180  TFVLVYTVFS  189



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  259  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  438
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  439  QCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            QCLGAICGVGLVKAFQK++YNRYGGGANE++ GY+ G GLGAEIIGT   VYTVFS
Sbjct  130  QCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTSGGVYTVFS  185



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+Y++AQCLGAICGV LVKAFQ S+Y  YGGGANE++ GY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +  EF++KDY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDIEGA--EHGEFASKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSEV----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY++AQCLGAICGVGLVKAFQKS+Y +YGGGANE+A GYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%), Gaps = 4/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E V EQ  E++AKDY DPPP+PL+D +ELTKWS YRA IAEFIAT+LFLYVTVLT
Sbjct  1    MAKDIE-VAEQ-GEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA LY++AQCLGAICGVGLVK FQK+++ RYGGGANE++ GY+KGTGLGAEII
Sbjct  119  ARKVSLVRAFLYIVAQCLGAICGVGLVKGFQKAYFVRYGGGANELSDGYSKGTGLGAEII  178

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVF+
Sbjct  179  GTFVLVYTVFA  189



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAV  +   F ++DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVAGE--GFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VI YK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VICYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICGVG V+AFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVQAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   280 bits (715),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +  EF+ KDY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDIEGA--EHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSEV----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY++AQCLGAICGVGLVKAFQKS+Y +YGGGANE+A GYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTV T
Sbjct  1    MGKDVEAA----TEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICGVG VKAFQ S Y+RYGGGANEMA G+ KG GL AEIIGT
Sbjct  117  KVSLIRALVYMVAQCLGAICGVGFVKAFQ-SXYDRYGGGANEMAPGHTKGVGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVY VFS
Sbjct  176  FVLVYVVFS  184



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 165/191 (86%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA      EF AKDY DPPP+P +   ELTKWSFYRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA-AGAGEFPAKDYTDPPPAPFLGIGELTKWSFYRALIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+D   G    DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RAVLYMIAQCLGAICGVGLVK FQK+FY RYGGGANE++AGY+KGTGL AEII
Sbjct  120  ARKVSLIRAVLYMIAQCLGAICGVGLVKGFQKAFYVRYGGGANELSAGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVF+
Sbjct  180  GTFVLVYTVFA  190



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA LYM+AQCLGAICGV LVKAFQ S+Y  YGGGANE++ GY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAGLYMVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDADLGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+Y++AQ LGAI GVGLVKAFQKS+Y +YGGGANE+A GY+ G GL AEIIGT
Sbjct  119  KVSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELADGYSTGVGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E        + AKDY DPPP+PL+D +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQSDTKANGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICG GLVKAFQ+++Y RYGGGAN ++ GY+ GTGLGAEIIGT
Sbjct  121  KVSLVRAVLYMVAQCLGAICGCGLVKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIGT  180

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  181  FVLVYTVFS  189



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   279 bits (714),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+ KDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVY TAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYYTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y ++GGGANE++AGYNKGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 164/191 (86%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA      E++ KDY DPPP+PL D++ELTKWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGH-GEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARKV+L RA+LYMI QCLGAICGVGLVK FQK+F+ RYGGGANE++ GY+KGTGL AEII
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGYSKGTGLAAEII  179

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  180  GTFVLVYTVFS  190



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTTVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQ LGAI GV LVKAFQ+S+Y +YGGGANE++ GY+KG GLGAEIIGT
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQESYYTKYGGGANELSQGYSKGVGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 166/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            LARKV+L RA+LY+IAQCLGAICGVGLVK FQ +FY RYGGGANE+++G++KGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAFYVRYGGGANELSSGFSKGTGLAAEI  179

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  180  IGTFVLVYTVFS  191



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAI GVGLVKAFQ ++++RYGGGAN +  GY+ G GLGAEI+GT
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y +YGGGAN +A G++ GTGLGAEIIGT
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V  +  EF AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MAKDVEVV--EGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+       +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQS----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY++AQCLGAICG GLVKAFQ S+YNR+GGGAN +A  YNKG GLGAEIIGT
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTGLVKAFQSSYYNRHGGGANTLADHYNKGVGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD + V E  A  +A+DY DPPP+PL+D +E+ KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKD-DDVQEGGAP-AARDYRDPPPAPLLDMEEIRKWSLYRAVIAEFVATLLFLYVSVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG GLVKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQ LGAI GV LVKAFQKS+Y +YGGGANE++ GY+ G GLGAEIIGT
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYTKYGGGANELSQGYSTGVGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
            EF+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TVLTVIGYKHQTDP   
Sbjct  15   EFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPNVA  74

Query  259  GQD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMI  435
            G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++
Sbjct  75   GTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIV  134

Query  436  AQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            AQCLGAICGVGLVKAFQ ++++RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFS
Sbjct  135  AQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFS  191



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA++AEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            K++L RAV+YMIAQCLGAICG GLVKAFQKS+Y  YGGGANE+A GY+ GTGL AEIIGT
Sbjct  119  KISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVNYGGGANELATGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 164/190 (86%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE F A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEG-----AEGFPARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLAEGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 167/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            VIGYK QTD   A G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  59   VIGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RA+LY++AQCLGAICGVGLVKAFQK++Y +YGGGAN +  GY+ GTGLGAEIIG
Sbjct  119  RKVSLIRAILYIVAQCLGAICGVGLVKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIG  178

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  179  TFVLVYTVFS  188



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 165/189 (87%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG  LVK+FQK+ YN +GGGAN +A GY+ GTGL AEIIGT
Sbjct  116  KVSLTRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQ LGAI GV LVKAFQKS+Y +YGGGAN ++ GY+ G GLGAEIIGT
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|AHW81492.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-n]
 gb|AHW81510.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-c]
Length=531

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRA+LY+IAQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIGT
Sbjct  119  KVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|NP_181255.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 sp|P30302.1|PIP23_ARATH RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; Short=AtPIP2;3; AltName: Full=Plasma 
membrane intrinsic protein 2c; Short=PIP2c; AltName: Full=RD28-PIP; 
AltName: Full=TMP2C; AltName: Full=Water stress-induced 
tonoplast intrinsic protein; Short=WSI-TIP; Contains: RecName: 
Full=Aquaporin PIP2-3, N-terminally processed [Arabidopsis 
thaliana]
 dbj|BAA02520.1| transmembrane channel protein [Arabidopsis thaliana]
 gb|AAD18141.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
 gb|AAL36385.1| putative aquaporin, plasma membrane intrinsic protein 2C [Arabidopsis 
thaliana]
 gb|AAM20335.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|AEC09363.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 prf||1905411A transmembrane channel
Length=285

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S Y  YGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>sp|Q8GRI8.1|PIP25_ORYSJ RecName: Full=Aquaporin PIP2-5; AltName: Full=OsPIP2;5; AltName: 
Full=Plasma membrane intrinsic protein 2-5 [Oryza sativa 
Japonica Group]
 dbj|BAC15863.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAC16116.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 gb|EAZ39660.1| hypothetical protein OsJ_24088 [Oryza sativa Japonica Group]
Length=283

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +1

Query  91   KDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQD-  267
            +DY DPPP+PL+D DEL +WS YRAVIAEF+ATLLFLYVTV TVIGYKHQTD  A G D 
Sbjct  13   RDYEDPPPAPLVDIDELGRWSLYRAVIAEFVATLLFLYVTVATVIGYKHQTDASASGDDA  72

Query  268  -CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQC  444
             CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQC
Sbjct  73   ACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQC  132

Query  445  LGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            LGA+CGV LVK FQ SFY+RYGGGANE+AAGY+KGTGL AEIIGTFVLVYTVFS
Sbjct  133  LGAVCGVALVKGFQSSFYDRYGGGANELAAGYSKGTGLAAEIIGTFVLVYTVFS  186



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPA---EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  210
            M KD+EA         E++AKDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+T
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYIT  60

Query  211  vltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  384
            V TVIGYKHQTD  + G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTFG
Sbjct  61   VATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFG  120

Query  385  LFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGA  564
            LFLARKV+L RA+LY++AQCLGAICGVGLVK FQ +FY RYGGGAN ++ GY+KGTGL A
Sbjct  121  LFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANGLSDGYSKGTGLAA  180

Query  565  EIIGTFVLVYTVFS  606
            EIIGTFVLVYTVFS
Sbjct  181  EIIGTFVLVYTVFS  194



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 167/190 (88%), Gaps = 5/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE   +   E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEGAEQ--GEYSAKDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTD-PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            VIGYK Q+  P A   DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  59   VIGYKVQSSAPDA--DDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  116

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVGLVK FQK+ YN+ GGGANE+A GYNKG GLGAEIIG
Sbjct  117  RKVSLIRAVLYMVAQCLGAICGVGLVKGFQKTHYNQNGGGANELAPGYNKGVGLGAEIIG  176

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  177  TFVLVYTVFS  186



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       ++ AKDY DPPP+ L D +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVGGN---DYGAKDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
             V+LPRA +YM+AQCLGAICG GLVKAFQK++Y +YGGGANE+A GY+ GTGLGAEI+GT
Sbjct  118  XVSLPRAFMYMVAQCLGAICGCGLVKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 165/189 (87%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D K+GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKSGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM AQCLGAICG  LVK+FQK+ YN YGGGAN +A GY+ GTGL AEIIGT
Sbjct  116  KVSLIRAILYMAAQCLGAICGCALVKSFQKALYNGYGGGANSLADGYSTGTGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQ LGAI GV LVKAFQKS+Y +YGGGAN ++ GY+ G GL AEIIGT
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYXKYGGGANSLSDGYSTGVGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEG-----AEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTK+VEAV EQ AE+S KDY DPPP+PLIDF+ELTKWS YRAVIA+FIATLLFLY+TVL 
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIATLLFLYITVLI  60

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  +   K     CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYNIKPMLKPA-SVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  119

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ ++YNRYGGG N MA G+ KG GL AEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAPGHTKGVGLAAEIIGT  179

Query  580  FVLVYTVFS  606
            FVLVY VFS
Sbjct  180  FVLVYVVFS  188



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 165/189 (87%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG  LVK+FQK+ YN +GGGAN +A GY+ GTGL AEIIGT
Sbjct  116  KVSLIRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 166/189 (88%), Gaps = 8/189 (4%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+ EA      EF AKDYHDPPP+PL D +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEAEAA----GEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQID---GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  113

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS Y+RY GGANE++ GY+KGTGLGAEIIGT
Sbjct  114  KVSLVRAILYMVAQCLGAICGCGLVKAFQKSHYSRY-GGANELSGGYSKGTGLGAEIIGT  172

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  173  FVLVYTVFS  181



>ref|XP_006436426.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 gb|ESR49666.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=206

 Score =   274 bits (700),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD   V E    +SAKDY DPPP PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDT-GVAEH-GSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAI GVGLVKAFQKS+Y RYGGGANE+A GY+ G GL AEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQ LGAI GV LVKAFQKS+Y +YGGGAN ++ GY+ G GL AEIIGT
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 164/190 (86%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE + A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEG-----AEGYQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 162/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E  P   A    KDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGPGANAP---KDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTDP     DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA+
Sbjct  58   VIGYSSQTDPDKNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQ  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y +YGGGAN +  GYNKGTGLGAEIIGT
Sbjct  118  KVSLVRAMLYMMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 164/191 (86%), Gaps = 9/191 (5%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE         + +DYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MVKDVEMA-------AGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLT  53

Query  220  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGY+ QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  54   VIGYRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  113

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RAV+YM+AQCLGAICG GLVK FQKS+YN YGGGANE+  G+NKGTGLGAEII
Sbjct  114  GRKVSLVRAVMYMVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGFNKGTGLGAEII  173

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  174  GTFVLVYTVFS  184



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDYHDPPP+ L D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAQLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y +YGGGAN +A G++ GTGLGAEIIGT
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|ABI96814.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 165/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P     ++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GGYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  220  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            LARKV+L RA+LY+IAQCLGAICGVGLVK FQ +FY RYGGGANE+++G++KGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAFYVRYGGGANELSSGFSKGTGLAAEI  179

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  180  IGTFVLVYTVFS  191



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 162/191 (85%), Gaps = 4/191 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVEA      E+  KDY DPPP PL+D +ELTKWS YRA IAEF+AT+LFLYVTV T
Sbjct  1    MAKDVEAGGR--GEYGGKDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVAT  58

Query  220  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
            ARK++L RA+LYMIAQCLGAICGVGLVK FQ ++Y RYGGGANE++ GY+KGTGL AEII
Sbjct  119  ARKISLVRALLYMIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  178

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  179  GTFVLVYTVFS  189



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEG-----AEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
            +F+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TV TVIGYKHQTD  A 
Sbjct  15   DFAAKDYTDPPPAPLIDAAELASWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDVSAS  74

Query  259  GQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYM  432
            G D  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM
Sbjct  75   GPDAACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYM  134

Query  433  IAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            IAQCLGA+CGVGLVKAFQ +++ RYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFS
Sbjct  135  IAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFS  192



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 2/178 (1%)
 Frame = +1

Query  79   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  258
            EF+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TV TVIGYKHQTD  A 
Sbjct  15   EFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDATAS  74

Query  259  GQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYM  432
            G D  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY+
Sbjct  75   GADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYI  134

Query  433  IAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFS  606
            +AQCLGAICGVGLVKAFQ ++++RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFS
Sbjct  135  VAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFS  192



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 164/189 (87%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EF+AKDYHDPPP+PL D DELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+        CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQS----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLY++AQ LGAICGVGLVKAFQK+ Y+ YGGGAN +A GY+KGTGL AEIIGT
Sbjct  115  KVSLLRAVLYIVAQSLGAICGVGLVKAFQKTLYDEYGGGANTLAPGYSKGTGLAAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E  P+    FSAKDY+DPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEVGPQ--GGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+LPRAVLY++AQ LGAICG GLVK+FQ + Y  YGGGAN +A GY+KGTGL AEIIGT
Sbjct  119  KVSLPRAVLYIVAQSLGAICGCGLVKSFQSALYTNYGGGANGLADGYSKGTGLAAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M K+VE    +   FS KDYHDPPP+P ID  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKNVEV--AERGSFSNKDYHDPPPAPFIDAAELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDIKAGGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++Y++AQCLGAICGVGLVKAFQ ++++RYGGGAN +  GY+ G GLGAEI+GT
Sbjct  119  KVSLIRAIMYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>gb|KDO44717.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=256

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD   V E    +SAKDY DPPP PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  51   MAKD-TGVAEH-GSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  108

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTDP      C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  109  VIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  168

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAI GVGLVKAFQKS+Y RYGGGANE+A GY+ G GL AEIIGT
Sbjct  169  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  228

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  229  FVLVYTVFS  237



>gb|AAM61438.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
Length=285

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 160/189 (85%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE        F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----SDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGVG VKAFQ S Y  YGGGAN +A GYN GTGL AEIIGT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E+  E P  F A+DY DPPP+PL+D +EL KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDMES-GEPP--FGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQVDPALNGTECDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICG GLVKAFQK+ Y RYGGGANE++ GY+KG GLGAEIIGT
Sbjct  118  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGT  177

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  178  FVLVYTVFS  186



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISG HINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLAR  115

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LYM+AQCLGAICG  LVK+FQK+ YN +GGGAN +A GY+ GTGL AEIIGT
Sbjct  116  KVSLTRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGT  175

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  176  FVLVYTVFS  184



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA+LY++AQC GAICG GL K FQK++YNR GGGAN +A GYNKGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRCGGGANSVADGYNKGTALGAEIIGT  178

Query  580  FVLVYTVFS  606
            F LVYTVFS
Sbjct  179  FALVYTVFS  187



>ref|NP_200874.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
 sp|Q9FF53.1|PIP24_ARATH RecName: Full=Probable aquaporin PIP2-4; AltName: Full=Plasma 
membrane intrinsic protein 2.4; Short=AtPIP2;4; Contains: RecName: 
Full=Probable aquaporin PIP2-4, N-terminally processed 
[Arabidopsis thaliana]
 dbj|BAB09839.1| water channel protein [Arabidopsis thaliana]
 gb|AAM64801.1| mipC protein-like (aquaporin) [Arabidopsis thaliana]
 dbj|BAF00622.1| mipC protein - like [Arabidopsis thaliana]
 gb|AED97364.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
Length=291

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD++     P   +A+DY DPPP+P  D +EL KW  YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLDVNESGPP--AARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L R VLY++AQCLGAICG G VKAFQ S+Y RYGGGANE+A GYNKGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E   +   EF AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGQ--GEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK QTD   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDANHGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICG GLVKAFQKS+Y RYGGGANE+A GY+ GTGLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  179  FVLVYTVFS  187



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 165/189 (87%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE V EQP EF+AKDY DPPP+ LID +ELTKWSFYRA+IAEFIATLLFLYVTV T
Sbjct  1    MGKDVE-VSEQP-EFTAKDYTDPPPAALIDLEELTKWSFYRALIAEFIATLLFLYVTVAT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK  ++       C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKRVSE----ADQCDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVK FQ ++YNRYGGGAN ++ GY+KG GLGAEIIGT
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGLVKGFQSAYYNRYGGGANTLSNGYDKGVGLGAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>gb|EMS51072.1| Aquaporin PIP2-5 [Triticum urartu]
Length=290

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+EA P    E+ AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFL +TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLCITVAT  59

Query  220  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  390
            VIGYK Q DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKPQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  391  LARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEI  570
            LARKV+L RA+LY+IAQCLGAICGVGLVK FQ +FY RYGGGANE+++GY+KGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAFYVRYGGGANELSSGYSKGTGLAAEI  179

Query  571  IGTFVLVYTVFS  606
            IGTFVLVYTVFS
Sbjct  180  IGTFVLVYTVFS  191



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE  +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEG-----AEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK  +D KAGG DCGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKISSDTKAGGDDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 164/191 (86%), Gaps = 9/191 (5%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE         + +DYHDPPP+PLI+ +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MVKDVETA-------AGRDYHDPPPAPLINAEELTQWSFYRALIAEFIATLLFLYVTVLT  53

Query  220  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  393
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  54   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  113

Query  394  ARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEII  573
             RKV+L RAV+YM+AQCLGAICG GLVK FQKS+YN YGGGANE+  G+NKGTGLGAEII
Sbjct  114  GRKVSLVRAVMYMVAQCLGAICGCGLVKWFQKSYYNTYGGGANELQDGFNKGTGLGAEII  173

Query  574  GTFVLVYTVFS  606
            GTFVLVYTVFS
Sbjct  174  GTFVLVYTVFS  184



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLAR  118

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAI GVGLVKAFQ ++++RYGGGAN +  GY+ G GLGAEI+GT
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGT  178

Query  580  FVLVYTVFS  606
            FVLVYT FS
Sbjct  179  FVLVYTAFS  187



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 163/189 (86%), Gaps = 6/189 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KDVE    +  EFSAKDY DPPP+PLID  EL  WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGEFSAKDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q+        CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQS----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVG VKAFQKS+Y ++GGGANE+A GYNKGTGL AEIIGT
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGT  174

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  175  FVLVYTVFS  183



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E    +   FSAKDY DPPP+PLID +ELTKWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MAKDIEV--AEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLT  58

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q D  A    C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y +Y GGAN +A GY+ GTGLGAEIIGT
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            MTKDV     +   F AKDYHDPPP+PL D  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVA----EHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP   G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPALKGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RAVLYM+AQCLGAICGV LVKAFQ ++Y +YGGGAN ++ GY+ G GLGAEI+GT
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVALVKAFQSAYYVKYGGGANSLSDGYSTGVGLGAEIVGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVFS
Sbjct  177  FVLVYTVFS  185



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 163/190 (86%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M K VE      AE + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVL
Sbjct  1    MAKGVEG-----AEGYQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 164/190 (86%), Gaps = 6/190 (3%)
 Frame = +1

Query  40   MTKDVEAVPEQPAE-FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  216
            M KDVE      AE  +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLY+TVL
Sbjct  1    MAKDVEG-----AEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVL  55

Query  217  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  396
            TVIGYK  +D KAGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  56   TVIGYKISSDTKAGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  115

Query  397  RKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIG  576
            RKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y RYGGGAN +A GY+ GTGL AEIIG
Sbjct  116  RKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIG  175

Query  577  TFVLVYTVFS  606
            TFVLVYTVFS
Sbjct  176  TFVLVYTVFS  185



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   274 bits (701),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +1

Query  40   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  219
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  220  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  399
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  400  KVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGT  579
            KV+L RA++YM+AQCLGAICG GLVKAFQK++Y +YGGGAN +  GYN GTGLGAEIIGT
Sbjct  117  KVSLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGT  176

Query  580  FVLVYTVFS  606
            FVLVYTVF+
Sbjct  177  FVLVYTVFA  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800