BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS169B12

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008228221.1|  PREDICTED: probable GPI-anchored adhesin-lik...    150   3e-38   
ref|XP_008228216.1|  PREDICTED: probable secreted beta-glucosidas...    150   4e-38   
ref|XP_008228217.1|  PREDICTED: probable secreted beta-glucosidas...    150   4e-38   Prunus mume [ume]
ref|XP_008228219.1|  PREDICTED: probable secreted beta-glucosidas...    145   2e-36   
ref|XP_008228220.1|  PREDICTED: probable secreted beta-glucosidas...    144   5e-36   Prunus mume [ume]
ref|XP_008228218.1|  PREDICTED: probable GPI-anchored adhesin-lik...    144   5e-36   
ref|XP_010654471.1|  PREDICTED: uncharacterized protein LOC100248...    141   7e-35   Vitis vinifera
ref|XP_010261965.1|  PREDICTED: uncharacterized protein LOC104600...    141   7e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010654468.1|  PREDICTED: uncharacterized protein LOC100248...    141   8e-35   Vitis vinifera
ref|XP_006361346.1|  PREDICTED: dentin sialophosphoprotein-like i...    140   9e-35   Solanum tuberosum [potatoes]
ref|XP_006361345.1|  PREDICTED: dentin sialophosphoprotein-like i...    140   9e-35   Solanum tuberosum [potatoes]
ref|XP_010273948.1|  PREDICTED: uncharacterized protein LOC104609...    139   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009757816.1|  PREDICTED: uncharacterized protein LOC104210...    139   3e-34   Nicotiana sylvestris
ref|XP_009757817.1|  PREDICTED: uncharacterized protein LOC104210...    139   4e-34   Nicotiana sylvestris
ref|XP_010273947.1|  PREDICTED: uncharacterized protein LOC104609...    139   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009599552.1|  PREDICTED: uncharacterized protein LOC104095...    139   4e-34   Nicotiana tomentosiformis
ref|XP_009599553.1|  PREDICTED: uncharacterized protein LOC104095...    139   4e-34   Nicotiana tomentosiformis
ref|XP_010654470.1|  PREDICTED: uncharacterized protein LOC100248...    137   1e-33   Vitis vinifera
ref|XP_010261966.1|  PREDICTED: uncharacterized protein LOC104600...    137   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006361347.1|  PREDICTED: dentin sialophosphoprotein-like i...    136   3e-33   Solanum tuberosum [potatoes]
ref|XP_006465941.1|  PREDICTED: dentin sialophosphoprotein-like         136   4e-33   Citrus sinensis [apfelsine]
ref|XP_006426627.1|  hypothetical protein CICLE_v10024871mg             136   4e-33   Citrus clementina [clementine]
ref|XP_006426626.1|  hypothetical protein CICLE_v10024871mg             136   4e-33   Citrus clementina [clementine]
ref|XP_009757818.1|  PREDICTED: uncharacterized protein LOC104210...    135   1e-32   Nicotiana sylvestris
ref|XP_009599554.1|  PREDICTED: uncharacterized protein LOC104095...    135   1e-32   Nicotiana tomentosiformis
emb|CBI35892.3|  unnamed protein product                                134   1e-32   Vitis vinifera
ref|XP_004252392.1|  PREDICTED: uncharacterized protein LOC101258...    134   2e-32   Solanum lycopersicum
ref|XP_010314322.1|  PREDICTED: uncharacterized protein LOC101258...    134   2e-32   Solanum lycopersicum
gb|EYU21338.1|  hypothetical protein MIMGU_mgv1a001286mg                134   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010062689.1|  PREDICTED: uncharacterized protein LOC104450...    132   6e-32   Eucalyptus grandis [rose gum]
ref|XP_007024585.1|  Uncharacterized protein isoform 2                  132   9e-32   
ref|XP_007024588.1|  Uncharacterized protein isoform 5                  132   9e-32   
gb|KDO65081.1|  hypothetical protein CISIN_1g040475mg                   132   1e-31   Citrus sinensis [apfelsine]
ref|XP_010062690.1|  PREDICTED: uncharacterized protein LOC104450...    132   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010654469.1|  PREDICTED: uncharacterized protein LOC100248...    131   3e-31   Vitis vinifera
ref|XP_010314323.1|  PREDICTED: uncharacterized protein LOC101258...    130   5e-31   Solanum lycopersicum
ref|XP_010936968.1|  PREDICTED: uncharacterized protein LOC105056...    130   5e-31   Elaeis guineensis
ref|XP_003528451.1|  PREDICTED: dentin sialophosphoprotein-like i...    130   6e-31   Glycine max [soybeans]
ref|XP_006583148.1|  PREDICTED: dentin sialophosphoprotein-like i...    130   7e-31   Glycine max [soybeans]
ref|XP_006583149.1|  PREDICTED: dentin sialophosphoprotein-like i...    129   7e-31   Glycine max [soybeans]
gb|EPS69388.1|  hypothetical protein M569_05379                         121   9e-31   Genlisea aurea
ref|XP_009339824.1|  PREDICTED: uncharacterized protein LOC103932...    129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009339841.1|  PREDICTED: uncharacterized protein LOC103932...    129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_007024587.1|  Uncharacterized protein isoform 4                  128   3e-30   
ref|XP_007024589.1|  Uncharacterized protein isoform 6                  128   3e-30   
ref|XP_007024584.1|  Uncharacterized protein isoform 1                  128   3e-30   
ref|XP_007135474.1|  hypothetical protein PHAVU_010G132600g             127   4e-30   Phaseolus vulgaris [French bean]
ref|XP_010936970.1|  PREDICTED: uncharacterized protein LOC105056...    127   4e-30   Elaeis guineensis
gb|KHG27656.1|  ATP-dependent zinc metalloprotease FtsH                 127   7e-30   Gossypium arboreum [tree cotton]
ref|XP_008338695.1|  PREDICTED: dentin sialophosphoprotein-like i...    126   9e-30   
ref|XP_008338694.1|  PREDICTED: dentin sialophosphoprotein-like i...    126   1e-29   
ref|XP_010087685.1|  hypothetical protein L484_013447                   126   1e-29   
ref|XP_010685333.1|  PREDICTED: uncharacterized protein LOC104899...    125   2e-29   
ref|XP_010685331.1|  PREDICTED: uncharacterized protein LOC104899...    125   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141213.1|  PREDICTED: uncharacterized protein LOC101203238    125   2e-29   
gb|KJB70100.1|  hypothetical protein B456_011G058000                    125   3e-29   Gossypium raimondii
gb|KJB70102.1|  hypothetical protein B456_011G058000                    125   3e-29   Gossypium raimondii
gb|KJB70101.1|  hypothetical protein B456_011G058000                    125   3e-29   Gossypium raimondii
gb|KJB70099.1|  hypothetical protein B456_011G058000                    125   3e-29   Gossypium raimondii
ref|XP_008464006.1|  PREDICTED: uncharacterized protein LOC103501...    125   3e-29   
ref|XP_008464007.1|  PREDICTED: uncharacterized protein LOC103501...    125   4e-29   Cucumis melo [Oriental melon]
ref|XP_004163891.1|  PREDICTED: uncharacterized protein LOC101226902    124   4e-29   
gb|KGN59790.1|  hypothetical protein Csa_3G846060                       124   4e-29   
ref|XP_006849609.1|  hypothetical protein AMTR_s00024p00205340          116   5e-29   
ref|XP_010685332.1|  PREDICTED: uncharacterized protein LOC104899...    123   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009339833.1|  PREDICTED: uncharacterized protein LOC103932...    123   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_009372373.1|  PREDICTED: uncharacterized protein LOC103961...    122   3e-28   Pyrus x bretschneideri [bai li]
gb|KHN39644.1|  hypothetical protein glysoja_020722                     121   7e-28   Glycine soja [wild soybean]
ref|XP_006598817.1|  PREDICTED: putative uncharacterized protein ...    121   8e-28   Glycine max [soybeans]
ref|XP_008338696.1|  PREDICTED: dentin sialophosphoprotein-like i...    120   9e-28   
ref|XP_010917132.1|  PREDICTED: uncharacterized protein LOC105041...    120   1e-27   Elaeis guineensis
ref|XP_008797669.1|  PREDICTED: uncharacterized protein LOC103712...    120   1e-27   Phoenix dactylifera
ref|XP_008391372.1|  PREDICTED: chitinase-like protein PB1E7.04c ...    120   1e-27   Malus domestica [apple tree]
ref|XP_009372374.1|  PREDICTED: uncharacterized protein LOC103961...    120   2e-27   Pyrus x bretschneideri [bai li]
gb|KDP40717.1|  hypothetical protein JCGZ_24716                         119   2e-27   Jatropha curcas
ref|XP_011467415.1|  PREDICTED: uncharacterized protein LOC101293...    120   2e-27   Fragaria vesca subsp. vesca
ref|XP_004303676.1|  PREDICTED: uncharacterized protein LOC101293...    119   3e-27   Fragaria vesca subsp. vesca
ref|XP_011072651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   3e-27   
ref|XP_009391448.1|  PREDICTED: uncharacterized protein LOC103977608    119   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510436.1|  PREDICTED: flocculation protein FLO11-like         118   8e-27   Cicer arietinum [garbanzo]
ref|XP_008391371.1|  PREDICTED: dentin sialophosphoprotein-like i...    118   8e-27   Malus domestica [apple tree]
ref|XP_010917133.1|  PREDICTED: uncharacterized protein LOC105041...    116   4e-26   Elaeis guineensis
ref|XP_002521347.1|  conserved hypothetical protein                     114   2e-25   Ricinus communis
ref|XP_008784271.1|  PREDICTED: uncharacterized protein LOC103703...    113   4e-25   Phoenix dactylifera
ref|XP_010932459.1|  PREDICTED: RNA polymerase II degradation fac...    111   2e-24   Elaeis guineensis
ref|XP_006296970.1|  hypothetical protein CARUB_v10012965mg             111   3e-24   Capsella rubella
ref|XP_010465276.1|  PREDICTED: uncharacterized protein LOC104745...    104   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010465278.1|  PREDICTED: uncharacterized protein LOC104745...    104   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010465277.1|  PREDICTED: uncharacterized protein LOC104745...    104   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002304144.2|  hypothetical protein POPTR_0003s06200g             103   1e-21   
ref|NP_188015.2|  kinase-related protein                                103   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078149.1|  kinase-related protein                             103   2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAN69468.1|  hypothetical protein VITISV_042555                     103   2e-21   Vitis vinifera
dbj|BAB02329.1|  unnamed protein product                                102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542406.1|  PREDICTED: uncharacterized protein LOC104815...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010542405.1|  PREDICTED: uncharacterized protein LOC104815...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010542407.1|  PREDICTED: uncharacterized protein LOC104815...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010487182.1|  PREDICTED: uncharacterized protein LOC104765...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010487183.1|  PREDICTED: uncharacterized protein LOC104765...    102   2e-21   Camelina sativa [gold-of-pleasure]
gb|KEH18456.1|  plant/MDC16-11 protein                                  102   3e-21   Medicago truncatula
ref|XP_010501517.1|  PREDICTED: uncharacterized protein LOC104778...    101   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010501523.1|  PREDICTED: uncharacterized protein LOC104778...    101   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010501500.1|  PREDICTED: uncharacterized protein LOC104778...    101   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010501510.1|  PREDICTED: uncharacterized protein LOC104778...    101   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010501505.1|  PREDICTED: uncharacterized protein LOC104778...    101   4e-21   Camelina sativa [gold-of-pleasure]
emb|CDX97535.1|  BnaA05g25440D                                          101   5e-21   
ref|XP_010534929.1|  PREDICTED: uncharacterized protein LOC104810...    100   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_009117292.1|  PREDICTED: uncharacterized protein LOC103842...    100   1e-20   Brassica rapa
ref|XP_004964933.1|  PREDICTED: uncharacterized protein LOC101755...    100   1e-20   Setaria italica
ref|XP_009117284.1|  PREDICTED: uncharacterized protein LOC103842...    100   1e-20   Brassica rapa
ref|XP_004964934.1|  PREDICTED: uncharacterized protein LOC101755...    100   1e-20   Setaria italica
ref|XP_002885002.1|  hypothetical protein ARALYDRAFT_478805             100   1e-20   
emb|CDO97864.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
emb|CDY33258.1|  BnaC01g37310D                                        99.8    2e-20   Brassica napus [oilseed rape]
ref|XP_011035692.1|  PREDICTED: uncharacterized protein LOC105133...  99.0    4e-20   Populus euphratica
ref|XP_011035693.1|  PREDICTED: uncharacterized protein LOC105133...  99.0    4e-20   Populus euphratica
ref|XP_002299597.2|  hydroxyproline-rich glycoprotein                 98.6    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010932458.1|  PREDICTED: RNA polymerase II degradation fac...  98.2    8e-20   
emb|CDY39087.1|  BnaA01g29690D                                        97.1    2e-19   Brassica napus [oilseed rape]
gb|AFW85392.1|  putative DUF1296 domain containing family protein     97.1    2e-19   
ref|XP_008658956.1|  PREDICTED: uncharacterized protein LOC100501...  97.1    2e-19   Zea mays [maize]
ref|XP_008658959.1|  PREDICTED: uncharacterized protein LOC100501...  97.1    2e-19   Zea mays [maize]
ref|XP_008658957.1|  PREDICTED: uncharacterized protein LOC100501...  97.1    2e-19   
ref|XP_008658958.1|  PREDICTED: uncharacterized protein LOC100501...  97.1    2e-19   Zea mays [maize]
ref|XP_010227878.1|  PREDICTED: uncharacterized protein LOC100833...  96.7    2e-19   Brachypodium distachyon [annual false brome]
ref|XP_010227879.1|  PREDICTED: uncharacterized protein LOC100833...  96.7    2e-19   Brachypodium distachyon [annual false brome]
gb|AFW85393.1|  putative DUF1296 domain containing family protein     95.9    3e-19   
gb|AAT08008.1|  unknown                                               96.3    3e-19   Zea mays [maize]
gb|EEE65290.1|  hypothetical protein OsJ_20522                        95.9    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80202.1|  hypothetical protein OsI_22088                        95.9    4e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001057094.1|  Os06g0206100                                     95.9    5e-19   
ref|XP_008648067.1|  PREDICTED: uncharacterized protein LOC100382...  94.7    1e-18   Zea mays [maize]
ref|NP_001168331.1|  uncharacterized protein LOC100382099             94.7    1e-18   Zea mays [maize]
ref|XP_002436662.1|  hypothetical protein SORBIDRAFT_10g006740        94.4    1e-18   Sorghum bicolor [broomcorn]
ref|XP_009146426.1|  PREDICTED: uncharacterized protein LOC103870...  94.4    1e-18   Brassica rapa
gb|AAL68853.1|AF466199_12  gb protein                                 94.4    2e-18   Sorghum bicolor [broomcorn]
ref|XP_009146425.1|  PREDICTED: uncharacterized protein LOC103870...  94.4    2e-18   Brassica rapa
ref|XP_009146424.1|  PREDICTED: uncharacterized protein LOC103870...  94.4    2e-18   Brassica rapa
ref|XP_009146423.1|  PREDICTED: uncharacterized protein LOC103870...  94.4    2e-18   Brassica rapa
dbj|BAK02193.1|  predicted protein                                    93.2    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY65326.1|  BnaCnng46620D                                        92.8    4e-18   Brassica napus [oilseed rape]
ref|XP_002445374.1|  hypothetical protein SORBIDRAFT_07g013800        84.3    1e-17   
ref|XP_010654472.1|  PREDICTED: uncharacterized protein LOC100248...  90.9    2e-17   Vitis vinifera
ref|XP_006656745.1|  PREDICTED: uncharacterized protein LOC102709938  90.1    4e-17   
gb|AES98495.2|  MLP3.11 protein                                       88.6    1e-16   Medicago truncatula
ref|XP_003615537.1|  hypothetical protein MTR_5g069290                88.6    1e-16   
ref|XP_010088349.1|  hypothetical protein L484_004857                 87.0    4e-16   
ref|XP_009765586.1|  PREDICTED: mucin-5AC-like                        85.9    5e-16   Nicotiana sylvestris
ref|XP_009610071.1|  PREDICTED: uncharacterized protein LOC104103...  86.3    8e-16   
ref|XP_009610070.1|  PREDICTED: uncharacterized protein LOC104103...  86.3    8e-16   Nicotiana tomentosiformis
ref|XP_009610068.1|  PREDICTED: uncharacterized protein LOC104103...  86.3    8e-16   Nicotiana tomentosiformis
gb|EPS69701.1|  hypothetical protein M569_05071                       80.5    8e-16   Genlisea aurea
ref|XP_009610069.1|  PREDICTED: uncharacterized protein LOC104103...  86.3    8e-16   Nicotiana tomentosiformis
ref|XP_008678496.1|  PREDICTED: uncharacterized protein LOC103653...  85.9    1e-15   Zea mays [maize]
gb|AGT17314.1|  Protein of unknown function DUF1296                   85.9    1e-15   Saccharum hybrid cultivar R570
ref|XP_009589264.1|  PREDICTED: protein PRRC2B-like isoform X6        85.9    1e-15   
ref|XP_009589260.1|  PREDICTED: uncharacterized protein LOC104086...  85.9    1e-15   Nicotiana tomentosiformis
ref|XP_009589263.1|  PREDICTED: protein PRRC2B-like isoform X5        85.9    1e-15   Nicotiana tomentosiformis
ref|XP_009589259.1|  PREDICTED: protein PRRC2B-like isoform X1        85.9    1e-15   Nicotiana tomentosiformis
ref|XP_009589262.1|  PREDICTED: uncharacterized protein LOC104086...  85.9    1e-15   Nicotiana tomentosiformis
ref|XP_008678497.1|  PREDICTED: uncharacterized protein LOC103653...  85.5    1e-15   Zea mays [maize]
ref|XP_004490553.1|  PREDICTED: flocculation protein FLO11-like       85.9    1e-15   Cicer arietinum [garbanzo]
ref|XP_004973209.1|  PREDICTED: flocculation protein FLO11-like       85.5    1e-15   Setaria italica
ref|XP_008678494.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.5    1e-15   Zea mays [maize]
ref|XP_008678495.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.1    2e-15   Zea mays [maize]
gb|AFW61911.1|  putative DUF1296 domain containing family protein     85.1    2e-15   
emb|CAN69467.1|  hypothetical protein VITISV_042554                   79.3    2e-15   Vitis vinifera
gb|AFW61910.1|  putative DUF1296 domain containing family protein     85.1    2e-15   
ref|XP_009589261.1|  PREDICTED: protein PRRC2B-like isoform X3        85.1    2e-15   Nicotiana tomentosiformis
ref|XP_007214926.1|  hypothetical protein PRUPE_ppa001246mg           85.1    2e-15   Prunus persica
ref|XP_008678498.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.7    2e-15   Zea mays [maize]
gb|EMT03241.1|  hypothetical protein F775_28234                       84.3    3e-15   
ref|XP_004502111.1|  PREDICTED: flocculation protein FLO11-like       84.0    5e-15   Cicer arietinum [garbanzo]
ref|XP_002301574.2|  hypothetical protein POPTR_0002s22320g           83.6    7e-15   
ref|XP_006392705.1|  hypothetical protein EUTSA_v10011240mg           82.8    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006392706.1|  hypothetical protein EUTSA_v10011240mg           82.8    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_003544279.1|  PREDICTED: cell wall protein AWA1-like           82.8    1e-14   Glycine max [soybeans]
gb|KHN46209.1|  hypothetical protein glysoja_039933                   82.4    1e-14   Glycine soja [wild soybean]
ref|XP_011007010.1|  PREDICTED: uncharacterized protein LOC105112...  82.4    1e-14   Populus euphratica
ref|XP_011007012.1|  PREDICTED: uncharacterized protein LOC105112...  82.4    1e-14   Populus euphratica
ref|XP_011100583.1|  PREDICTED: uncharacterized protein LOC105178745  82.4    2e-14   
ref|XP_006575395.1|  PREDICTED: cell wall protein AWA1-like           82.4    2e-14   Glycine max [soybeans]
ref|XP_009407930.1|  PREDICTED: uncharacterized protein LOC103990491  82.0    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391914.1|  PREDICTED: uncharacterized protein LOC103977...  81.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391913.1|  PREDICTED: uncharacterized protein LOC103977...  81.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252822.1|  PREDICTED: uncharacterized protein LOC104594...  81.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010252820.1|  PREDICTED: uncharacterized protein LOC104594...  81.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010252821.1|  PREDICTED: uncharacterized protein LOC104594...  81.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010323918.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    3e-14   Solanum lycopersicum
ref|XP_010323917.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    3e-14   Solanum lycopersicum
ref|XP_010323919.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    3e-14   Solanum lycopersicum
ref|XP_010323920.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    3e-14   Solanum lycopersicum
ref|XP_010252823.1|  PREDICTED: uncharacterized protein LOC104594...  81.3    4e-14   Nelumbo nucifera [Indian lotus]
emb|CDP14411.1|  unnamed protein product                              81.3    4e-14   Coffea canephora [robusta coffee]
ref|XP_009782968.1|  PREDICTED: uncharacterized protein LOC104231...  81.3    4e-14   Nicotiana sylvestris
ref|XP_009782965.1|  PREDICTED: uncharacterized protein LOC104231...  81.3    4e-14   Nicotiana sylvestris
ref|XP_009782966.1|  PREDICTED: uncharacterized protein LOC104231...  81.3    4e-14   Nicotiana sylvestris
ref|XP_008229781.1|  PREDICTED: cell wall protein AWA1 isoform X1     80.9    4e-14   Prunus mume [ume]
ref|XP_008229782.1|  PREDICTED: putative GPI-anchored protein PB1...  80.9    5e-14   Prunus mume [ume]
ref|XP_006857739.1|  hypothetical protein AMTR_s00061p00187940        80.9    5e-14   Amborella trichopoda
ref|XP_008342251.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  80.5    6e-14   
ref|XP_008342252.1|  PREDICTED: flocculation protein FLO11-like i...  80.5    7e-14   
ref|XP_009782967.1|  PREDICTED: uncharacterized protein LOC104231...  80.5    7e-14   Nicotiana sylvestris
ref|XP_010676081.1|  PREDICTED: uncharacterized protein LOC104891...  79.0    1e-13   
ref|XP_009412058.1|  PREDICTED: uncharacterized protein LOC103993639  79.7    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010245040.1|  PREDICTED: uncharacterized protein LOC104588...  79.7    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009396030.1|  PREDICTED: uncharacterized protein LOC103981...  79.3    1e-13   
ref|XP_010245043.1|  PREDICTED: uncharacterized protein LOC104588...  79.3    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010245041.1|  PREDICTED: uncharacterized protein LOC104588...  79.3    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010676080.1|  PREDICTED: uncharacterized protein LOC104891...  79.3    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010109270.1|  hypothetical protein L484_014864                 79.3    1e-13   Morus notabilis
ref|XP_009396015.1|  PREDICTED: uncharacterized protein LOC103981...  79.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396005.1|  PREDICTED: uncharacterized protein LOC103981...  79.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK38755.1|  hypothetical protein AALP_AA3G156400                  79.3    2e-13   Arabis alpina [alpine rockcress]
gb|KFK38754.1|  hypothetical protein AALP_AA3G156400                  79.3    2e-13   Arabis alpina [alpine rockcress]
gb|KFK38756.1|  hypothetical protein AALP_AA3G156400                  79.3    2e-13   Arabis alpina [alpine rockcress]
ref|XP_010245042.1|  PREDICTED: RNA polymerase II degradation fac...  79.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006353099.1|  PREDICTED: putative GPI-anchored protein PB1...  79.0    2e-13   Solanum tuberosum [potatoes]
ref|XP_009396023.1|  PREDICTED: uncharacterized protein LOC103981...  79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006353098.1|  PREDICTED: putative GPI-anchored protein PB1...  79.0    2e-13   Solanum tuberosum [potatoes]
ref|XP_009396039.1|  PREDICTED: uncharacterized protein LOC103981...  79.0    2e-13   
ref|XP_011467310.1|  PREDICTED: endochitinase A isoform X3            78.6    2e-13   Fragaria vesca subsp. vesca
ref|XP_011467309.1|  PREDICTED: endochitinase A isoform X2            78.6    2e-13   Fragaria vesca subsp. vesca
ref|XP_011467308.1|  PREDICTED: endochitinase A isoform X1            78.6    2e-13   Fragaria vesca subsp. vesca
ref|XP_010929038.1|  PREDICTED: uncharacterized protein LOC105050...  78.6    2e-13   Elaeis guineensis
ref|XP_010929036.1|  PREDICTED: uncharacterized protein LOC105050...  78.6    2e-13   Elaeis guineensis
ref|XP_010929035.1|  PREDICTED: uncharacterized protein LOC105050...  78.6    2e-13   Elaeis guineensis
ref|XP_010929039.1|  PREDICTED: uncharacterized protein LOC105050...  78.6    2e-13   Elaeis guineensis
ref|XP_010036125.1|  PREDICTED: uncharacterized protein LOC104425...  78.6    3e-13   Eucalyptus grandis [rose gum]
ref|XP_009361529.1|  PREDICTED: uncharacterized protein LOC103951...  78.6    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_009361530.1|  PREDICTED: mucin-12 isoform X2                   78.6    3e-13   
ref|XP_010036126.1|  PREDICTED: uncharacterized protein LOC104425...  78.6    3e-13   Eucalyptus grandis [rose gum]
emb|CDP13693.1|  unnamed protein product                              78.2    4e-13   Coffea canephora [robusta coffee]
ref|XP_004162890.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.2    4e-13   
ref|XP_008380020.1|  PREDICTED: flocculation protein FLO11-like i...  77.8    4e-13   
ref|XP_011008079.1|  PREDICTED: flocculation protein FLO11            77.8    4e-13   Populus euphratica
ref|XP_008380021.1|  PREDICTED: flocculation protein FLO11-like i...  77.8    4e-13   
ref|XP_007049405.1|  Cell wall protein AWA1 isoform 3                 77.8    5e-13   
ref|XP_008783016.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783014.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783012.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783013.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783011.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783009.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_008783015.1|  PREDICTED: uncharacterized protein LOC103702...  77.8    5e-13   Phoenix dactylifera
ref|XP_007049403.1|  Cell wall protein AWA1 isoform 1                 77.4    6e-13   
gb|KJB06118.1|  hypothetical protein B456_001G0984002                 77.4    6e-13   Gossypium raimondii
gb|KJB06119.1|  hypothetical protein B456_001G0984002                 77.4    6e-13   Gossypium raimondii
ref|XP_008797740.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    7e-13   Phoenix dactylifera
ref|XP_008797742.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    7e-13   Phoenix dactylifera
ref|XP_008797741.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    7e-13   Phoenix dactylifera
ref|XP_008797739.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    7e-13   Phoenix dactylifera
ref|XP_002320531.2|  hypothetical protein POPTR_0014s16780g           77.4    7e-13   
ref|XP_008797743.1|  PREDICTED: uncharacterized protein LOC103712...  77.4    7e-13   Phoenix dactylifera
ref|XP_008783017.1|  PREDICTED: uncharacterized protein LOC103702...  77.4    7e-13   Phoenix dactylifera
ref|XP_008783018.1|  PREDICTED: uncharacterized protein LOC103702...  77.4    7e-13   Phoenix dactylifera
ref|XP_010942575.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_010942571.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_010942570.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_010942576.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_010942574.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   
ref|XP_010942572.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_010942569.1|  PREDICTED: uncharacterized protein LOC105060...  77.0    8e-13   Elaeis guineensis
ref|XP_001756751.1|  predicted protein                                71.2    8e-13   
ref|XP_010321076.1|  PREDICTED: uncharacterized protein LOC101250...  76.6    1e-12   Solanum lycopersicum
ref|XP_008219419.1|  PREDICTED: flocculation protein FLO11-like       76.6    1e-12   Prunus mume [ume]
gb|KDO50974.1|  hypothetical protein CISIN_1g006896mg                 76.3    1e-12   Citrus sinensis [apfelsine]
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           76.6    1e-12   Citrus clementina [clementine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           76.6    1e-12   Citrus clementina [clementine]
ref|XP_010321075.1|  PREDICTED: uncharacterized protein LOC101250...  76.3    1e-12   Solanum lycopersicum
ref|XP_002964401.1|  hypothetical protein SELMODRAFT_438753           76.3    1e-12   
ref|XP_004491525.1|  PREDICTED: putative GPI-anchored protein PB1...  76.3    2e-12   
emb|CAN73914.1|  hypothetical protein VITISV_035233                   76.3    2e-12   Vitis vinifera
ref|XP_006357671.1|  PREDICTED: flocculation protein FLO11-like i...  75.9    2e-12   
ref|XP_006357673.1|  PREDICTED: flocculation protein FLO11-like i...  75.9    2e-12   
ref|XP_006357672.1|  PREDICTED: flocculation protein FLO11-like i...  75.9    2e-12   
ref|XP_007020433.1|  GBF-interacting protein 1, putative isoform 2    75.1    2e-12   
ref|XP_008462126.1|  PREDICTED: flocculation protein FLO11            75.5    3e-12   Cucumis melo [Oriental melon]
gb|KJB42721.1|  hypothetical protein B456_007G165200                  75.1    3e-12   Gossypium raimondii
gb|KCW70461.1|  hypothetical protein EUGRSUZ_F03678                   74.7    4e-12   
gb|KDP29958.1|  hypothetical protein JCGZ_18527                       75.1    4e-12   
gb|KJB42722.1|  hypothetical protein B456_007G165200                  74.7    4e-12   
ref|XP_010689211.1|  PREDICTED: uncharacterized protein LOC104902...  74.7    5e-12   
ref|XP_010689210.1|  PREDICTED: uncharacterized protein LOC104902...  74.7    5e-12   
ref|XP_006660473.1|  PREDICTED: flocculation protein FLO11-like       74.7    5e-12   
ref|XP_002967632.1|  hypothetical protein SELMODRAFT_440086           74.7    5e-12   
ref|XP_004144622.1|  PREDICTED: uncharacterized protein LOC101212400  73.9    9e-12   
ref|XP_010644611.1|  PREDICTED: RNA polymerase II degradation fac...  73.2    1e-11   
ref|XP_010644609.1|  PREDICTED: RNA polymerase II degradation fac...  73.2    1e-11   
ref|XP_010644610.1|  PREDICTED: RNA polymerase II degradation fac...  73.2    1e-11   
ref|XP_008229801.1|  PREDICTED: uncharacterized protein LOC103329149  72.4    2e-11   
ref|XP_008353055.1|  PREDICTED: uncharacterized protein LOC103416590  72.4    2e-11   
ref|XP_010657491.1|  PREDICTED: uncharacterized protein LOC100245...  72.4    2e-11   
ref|XP_002267265.1|  PREDICTED: uncharacterized protein LOC100245...  72.4    3e-11   
ref|XP_008367199.1|  PREDICTED: uncharacterized protein LOC103430833  71.2    3e-11   
ref|XP_010657492.1|  PREDICTED: uncharacterized protein LOC100245...  72.4    3e-11   
ref|XP_008366272.1|  PREDICTED: uncharacterized protein LOC103429921  70.9    4e-11   
ref|XP_011085417.1|  PREDICTED: uncharacterized protein LOC105167...  72.0    4e-11   
ref|XP_011085416.1|  PREDICTED: uncharacterized protein LOC105167...  71.6    4e-11   
ref|XP_011085415.1|  PREDICTED: uncharacterized protein LOC105167...  71.6    4e-11   
gb|KDO60962.1|  hypothetical protein CISIN_1g0031901mg                66.2    5e-11   
ref|XP_007142439.1|  hypothetical protein PHAVU_008G280600g           71.2    7e-11   
ref|XP_010324240.1|  PREDICTED: uncharacterized protein LOC101262230  67.0    8e-11   
gb|KCW70460.1|  hypothetical protein EUGRSUZ_F03678                   70.9    8e-11   
ref|XP_009334669.1|  PREDICTED: uncharacterized protein LOC103927468  70.9    9e-11   
ref|XP_009367245.1|  PREDICTED: uncharacterized protein LOC103956912  70.5    9e-11   
ref|XP_006575712.1|  PREDICTED: mucin-19-like isoform X1              70.5    1e-10   
gb|KHN23829.1|  hypothetical protein glysoja_028122                   70.5    1e-10   
ref|XP_006575714.1|  PREDICTED: mucin-19-like isoform X3              70.5    1e-10   
ref|XP_006575713.1|  PREDICTED: mucin-19-like isoform X2              70.5    1e-10   
ref|XP_006595682.1|  PREDICTED: putative GPI-anchored protein PB1...  70.5    1e-10   
gb|KHN43908.1|  hypothetical protein glysoja_025947                   70.5    1e-10   
ref|XP_003545090.1|  PREDICTED: putative GPI-anchored protein PB1...  70.5    1e-10   
ref|XP_010063251.1|  PREDICTED: uncharacterized protein LOC104450411  70.5    1e-10   
ref|XP_003617862.1|  hypothetical protein MTR_5g096290                70.1    1e-10   
ref|XP_010942880.1|  PREDICTED: uncharacterized protein LOC105060...  70.1    2e-10   
ref|XP_010942881.1|  PREDICTED: uncharacterized protein LOC105060...  70.1    2e-10   
gb|EMT26073.1|  hypothetical protein F775_05710                       69.7    2e-10   
gb|KDP39314.1|  hypothetical protein JCGZ_01071                       69.7    2e-10   
gb|KJB69764.1|  hypothetical protein B456_011G041100                  69.3    2e-10   
gb|KJB69767.1|  hypothetical protein B456_011G041100                  69.3    2e-10   
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like           69.3    3e-10   
emb|CDP17325.1|  unnamed protein product                              69.3    3e-10   
ref|XP_008384597.1|  PREDICTED: formin-like protein 7                 69.3    3e-10   
ref|XP_007020432.1|  GBF-interacting protein 1, putative isoform 1    69.3    3e-10   
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730        68.6    4e-10   
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...  68.2    6e-10   
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...  68.2    6e-10   
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...  67.8    7e-10   
ref|XP_002522794.1|  conserved hypothetical protein                   67.8    7e-10   
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           67.8    1e-09   
ref|XP_010917134.1|  PREDICTED: eukaryotic translation initiation...  67.4    1e-09   
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...  67.4    1e-09   
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...  67.4    1e-09   
ref|XP_011095579.1|  PREDICTED: endochitinase A                       67.4    1e-09   
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306  67.4    1e-09   
gb|KJB63043.1|  hypothetical protein B456_009G451000                  67.4    1e-09   
gb|KJB63041.1|  hypothetical protein B456_009G451000                  67.0    1e-09   
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351  67.0    1e-09   
ref|XP_006407810.1|  hypothetical protein EUTSA_v10020055mg           67.0    1e-09   
gb|KJB63042.1|  hypothetical protein B456_009G451000                  67.0    2e-09   
ref|XP_002884662.1|  hypothetical protein ARALYDRAFT_896937           67.0    2e-09   
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...  66.6    2e-09   
ref|XP_010237341.1|  PREDICTED: uncharacterized protein LOC100835561  66.2    2e-09   
ref|XP_010524628.1|  PREDICTED: uncharacterized protein LOC104802632  66.2    3e-09   
gb|KDO78065.1|  hypothetical protein CISIN_1g0026402mg                65.9    3e-09   
gb|KDO78063.1|  hypothetical protein CISIN_1g0026402mg                65.9    3e-09   
gb|KDO78068.1|  hypothetical protein CISIN_1g0026402mg                65.9    3e-09   
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...  66.2    3e-09   
gb|KDO78064.1|  hypothetical protein CISIN_1g0026402mg                65.9    3e-09   
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...  65.9    3e-09   
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...  65.9    3e-09   
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...  65.9    3e-09   
ref|XP_010456509.1|  PREDICTED: uncharacterized protein LOC104737938  65.9    4e-09   
ref|XP_010464402.1|  PREDICTED: uncharacterized protein LOC104744...  65.9    4e-09   
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...  65.9    4e-09   
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like           65.5    4e-09   
gb|AFK38455.1|  unknown                                               65.1    4e-09   
gb|KJB63039.1|  hypothetical protein B456_009G451000                  65.5    4e-09   
ref|XP_010486335.1|  PREDICTED: uncharacterized protein LOC104764492  65.5    4e-09   
ref|XP_006474833.1|  PREDICTED: mucin-17-like isoform X1              65.5    4e-09   
ref|XP_006474835.1|  PREDICTED: mucin-17-like isoform X3              65.5    4e-09   
ref|XP_006474834.1|  PREDICTED: mucin-17-like isoform X2              65.5    4e-09   
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820        65.5    4e-09   
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like           65.5    4e-09   
gb|KDO59193.1|  hypothetical protein CISIN_1g004145mg                 65.5    5e-09   
ref|XP_006452645.1|  hypothetical protein CICLE_v10007522mg           65.5    5e-09   
ref|XP_006452644.1|  hypothetical protein CICLE_v10007522mg           65.5    5e-09   
gb|KDO59190.1|  hypothetical protein CISIN_1g004145mg                 65.5    5e-09   
ref|NP_187423.2|  uncharacterized protein                             65.5    5e-09   
gb|KDO59192.1|  hypothetical protein CISIN_1g004145mg                 65.5    5e-09   
gb|KDO59191.1|  hypothetical protein CISIN_1g004145mg                 65.5    5e-09   
ref|XP_002891854.1|  F20N2.19                                         65.5    5e-09   
gb|KJB63040.1|  hypothetical protein B456_009G451000                  65.1    5e-09   
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like             65.5    5e-09   
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...  65.5    5e-09   
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g           65.1    5e-09   
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...  65.1    6e-09   
gb|KHN22963.1|  hypothetical protein glysoja_030633                   65.1    6e-09   
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593  65.1    6e-09   
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...  65.1    6e-09   
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...  65.1    6e-09   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...  65.1    6e-09   
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg              65.1    6e-09   
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...  65.1    6e-09   
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...  65.1    7e-09   
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...  65.1    7e-09   
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like             64.7    8e-09   
ref|XP_010487071.1|  PREDICTED: uncharacterized protein LOC104765097  64.3    9e-09   
ref|NP_187929.4|  GBF-interacting protein 1                           63.9    1e-08   
gb|KFK38227.1|  hypothetical protein AALP_AA3G085200                  63.9    1e-08   
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...  63.9    1e-08   
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...  63.9    1e-08   
ref|XP_010465140.1|  PREDICTED: uncharacterized protein LOC104745563  63.5    2e-08   
ref|XP_006296980.1|  hypothetical protein CARUB_v10012975mg           63.9    2e-08   
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...  63.9    2e-08   
ref|XP_006392599.1|  hypothetical protein EUTSA_v10011305mg           63.5    2e-08   
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...  63.5    2e-08   
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...  63.5    2e-08   
gb|KFK35559.1|  hypothetical protein AALP_AA4G006700                  63.5    2e-08   
gb|KHF99173.1|  hypothetical protein F383_17166                       63.5    2e-08   
gb|KFK27097.1|  hypothetical protein AALP_AA8G333800                  60.1    2e-08   
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.5    2e-08   
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...  63.5    2e-08   
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...  63.5    2e-08   
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388  63.5    2e-08   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                         63.5    2e-08   
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...  63.5    2e-08   
ref|XP_010500212.1|  PREDICTED: uncharacterized protein LOC104777...  63.2    2e-08   
gb|KHF99174.1|  hypothetical protein F383_17166                       63.5    2e-08   
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...  63.2    2e-08   
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...  63.2    2e-08   
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...  63.2    2e-08   
ref|XP_010551966.1|  PREDICTED: uncharacterized protein LOC104822439  63.2    2e-08   
dbj|BAB01415.1|  unnamed protein product                              63.2    2e-08   
ref|XP_002884954.1|  hypothetical protein ARALYDRAFT_478702           63.2    2e-08   
ref|XP_010500220.1|  PREDICTED: uncharacterized protein LOC104777...  63.2    2e-08   
ref|XP_006299052.1|  hypothetical protein CARUB_v10015191mg           63.2    2e-08   
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...  63.2    2e-08   
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...  63.2    2e-08   
ref|XP_009147476.1|  PREDICTED: uncharacterized protein LOC103871018  63.2    2e-08   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...  63.2    3e-08   
gb|KJB69763.1|  hypothetical protein B456_011G041100                  63.2    3e-08   
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756  63.2    3e-08   
ref|XP_010469383.1|  PREDICTED: uncharacterized protein LOC104749...  60.5    3e-08   
gb|KGN49366.1|  hypothetical protein Csa_6G522110                     63.2    3e-08   
gb|KJB69765.1|  hypothetical protein B456_011G041100                  63.2    3e-08   
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...  63.2    3e-08   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...  62.8    3e-08   
gb|KJB69766.1|  hypothetical protein B456_011G041100                  62.8    3e-08   
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549  62.8    4e-08   
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...  62.8    4e-08   
emb|CDY61669.1|  BnaC01g40800D                                        62.4    4e-08   
ref|XP_010102151.1|  hypothetical protein L484_021385                 62.4    4e-08   
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g           62.4    4e-08   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg           62.4    4e-08   
gb|KHG18569.1|  Protein translocase subunit SecA                      62.4    5e-08   
emb|CDX78828.1|  BnaA01g08950D                                        62.4    5e-08   
ref|XP_010469381.1|  PREDICTED: uncharacterized protein LOC104749...  59.7    5e-08   
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            62.4    5e-08   
ref|XP_010552357.1|  PREDICTED: uncharacterized protein LOC104822725  62.0    5e-08   
gb|KJB57295.1|  hypothetical protein B456_009G157400                  62.4    5e-08   
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg           62.4    5e-08   
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.0    5e-08   
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...  62.0    6e-08   
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...  62.0    6e-08   
ref|NP_001141689.1|  uncharacterized protein LOC100273818             62.0    6e-08   
gb|AAT44198.1|  unknown protein                                       62.0    6e-08   
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...  62.0    6e-08   
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                62.0    6e-08   
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...  62.0    6e-08   
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...  62.0    6e-08   
ref|XP_010462445.1|  PREDICTED: uncharacterized protein LOC104743021  61.6    6e-08   
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...  62.0    6e-08   
emb|CDY43361.1|  BnaA01g29920D                                        61.6    7e-08   
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  61.6    7e-08   
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  62.0    7e-08   
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  61.6    7e-08   
ref|XP_007025176.1|  Uncharacterized protein TCM_029557               61.6    7e-08   
ref|XP_009124224.1|  PREDICTED: uncharacterized protein LOC103849165  61.6    7e-08   
emb|CDY22126.1|  BnaC01g39750D                                        61.6    8e-08   
ref|XP_010501199.1|  PREDICTED: uncharacterized protein LOC104778449  61.2    8e-08   
ref|XP_007048866.1|  Uncharacterized protein TCM_001879               61.6    8e-08   
ref|XP_006346245.1|  PREDICTED: uncharacterized protein LOC102592558  61.6    8e-08   
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...  61.6    8e-08   
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...  61.6    8e-08   
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           61.2    9e-08   
ref|XP_002519742.1|  conserved hypothetical protein                   61.2    1e-07   
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg           61.2    1e-07   
ref|XP_002300395.2|  hypothetical protein POPTR_0001s37980g           61.2    1e-07   
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  61.2    1e-07   
ref|NP_001056433.1|  Os05g0581800                                     60.8    1e-07   
ref|XP_002317304.2|  kinase-related family protein                    60.8    1e-07   
ref|XP_006307156.1|  hypothetical protein CARUB_v10008748mg           60.5    2e-07   
ref|XP_010480139.1|  PREDICTED: uncharacterized protein LOC104758...  60.5    2e-07   
ref|XP_010480138.1|  PREDICTED: uncharacterized protein LOC104758...  60.5    2e-07   
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...  60.5    2e-07   
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...  60.5    2e-07   
gb|KHN48057.1|  hypothetical protein glysoja_015527                   60.5    2e-07   
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g           60.5    2e-07   
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...  60.5    2e-07   
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...  60.5    2e-07   
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...  60.5    2e-07   
gb|AFW81251.1|  putative DUF1296 domain containing family protein     60.5    2e-07   
emb|CDY24202.1|  BnaC01g37820D                                        60.1    2e-07   
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...  60.5    2e-07   
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...  60.1    2e-07   
ref|NP_175978.2|  uncharacterized protein                             60.1    2e-07   
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  60.1    2e-07   
gb|AFW81250.1|  putative DUF1296 domain containing family protein     60.1    2e-07   
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...  60.1    2e-07   
emb|CBI30819.3|  unnamed protein product                              60.1    2e-07   
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  60.1    2e-07   
ref|NP_001146586.1|  uncharacterized protein LOC100280182             60.1    2e-07   
gb|AFW81248.1|  putative DUF1296 domain containing family protein     60.1    2e-07   
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...  60.1    3e-07   
dbj|BAJ92311.1|  predicted protein                                    60.1    3e-07   
dbj|BAJ85689.1|  predicted protein                                    60.1    3e-07   
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...  60.1    3e-07   
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...  60.1    3e-07   



>ref|XP_008228221.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X6 [Prunus mume]
Length=829

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ + GTG+SREFRVVRDNRVN
Sbjct  117  RSGVTGTGISREFRVVRDNRVN  138



>ref|XP_008228216.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X1 
[Prunus mume]
Length=853

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ + GTG+SREFRVVRDNRVN
Sbjct  117  RSGVTGTGISREFRVVRDNRVN  138



>ref|XP_008228217.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X2 
[Prunus mume]
Length=852

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ + GTG+SREFRVVRDNRVN
Sbjct  117  RSGVTGTGISREFRVVRDNRVN  138



>ref|XP_008228219.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X4 
[Prunus mume]
Length=851

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE      V+  + G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKE------VSSNSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  114

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ + GTG+SREFRVVRDNRVN
Sbjct  115  RSGVTGTGISREFRVVRDNRVN  136



>ref|XP_008228220.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X5 
[Prunus mume]
Length=850

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ +  TG+SREFRVVRDNRVN
Sbjct  117  RSGV--TGISREFRVVRDNRVN  136



>ref|XP_008228218.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Prunus mume]
Length=851

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R+ +  TG+SREFRVVRDNRVN
Sbjct  117  RSGV--TGISREFRVVRDNRVN  136



>ref|XP_010654471.1| PREDICTED: uncharacterized protein LOC100248075 isoform X4 [Vitis 
vinifera]
Length=819

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 96/148 (65%), Gaps = 25/148 (17%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  363  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  518
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  519  RRGPYKRNALPGTGVSREFRVVRDNRVN  602
            RRG Y R+ +P  G+ REFRVVRDNRVN
Sbjct  104  RRGGYSRSTVPDAGIGREFRVVRDNRVN  131



>ref|XP_010261965.1| PREDICTED: uncharacterized protein LOC104600611 isoform X1 [Nelumbo 
nucifera]
Length=851

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 12/141 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            M +GS+ +GGTQ LS  VR TI+++KE+ + HS+ADIY  LKESNMDPNET QKL +QD 
Sbjct  1    MNSGSRLDGGTQILSARVRKTIQSIKEIVQNHSDADIYVMLKESNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FHEVKR+RD+KKE +N          YR   D +++ E    A KS T ++   RRG Y 
Sbjct  61   FHEVKRKRDKKKENIN----------YRGSIDPKRQSEHLGQAAKSHTFSDRNARRGGYV  110

Query  537  RNALPGTGVSREFRVVRDNRV  599
            RN LP  G+SREFRVVRDNRV
Sbjct  111  RNVLPDAGISREFRVVRDNRV  131



>ref|XP_010654468.1| PREDICTED: uncharacterized protein LOC100248075 isoform X1 [Vitis 
vinifera]
Length=855

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 96/148 (65%), Gaps = 25/148 (17%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  363  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  518
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  519  RRGPYKRNALPGTGVSREFRVVRDNRVN  602
            RRG Y R+ +P  G+ REFRVVRDNRVN
Sbjct  104  RRGGYSRSTVPDAGIGREFRVVRDNRVN  131



>ref|XP_006361346.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 14/144 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  530
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  531  YKRNALPGTGVSREFRVVRDNRVN  602
            Y R ALP  G +REFRVVRDNRVN
Sbjct  111  YNRTALPDAGFTREFRVVRDNRVN  134



>ref|XP_006361345.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum 
tuberosum]
Length=839

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 14/144 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  530
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  531  YKRNALPGTGVSREFRVVRDNRVN  602
            Y R ALP  G +REFRVVRDNRVN
Sbjct  111  YNRTALPDAGFTREFRVVRDNRVN  134



>ref|XP_010273948.1| PREDICTED: uncharacterized protein LOC104609354 isoform X2 [Nelumbo 
nucifera]
Length=857

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 98/143 (69%), Gaps = 15/143 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ +GGTQ L   VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSGSRPDGGTQILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYR-TEEDRKEFEPANLAVKSKTHNNLIRR--GPY  533
            FHEVKRRRD++KE          NTGY+ + E RK  E      KS T ++ + R  G Y
Sbjct  61   FHEVKRRRDKRKE----------NTGYKVSTEPRKPIERIGQGTKSHTFSDRVARRGGGY  110

Query  534  KRNALPGTGVSREFRVVRDNRVN  602
             RNAL  +G+SREFR+VRDNR++
Sbjct  111  SRNAL--SGISREFRIVRDNRIS  131



>ref|XP_009757816.1| PREDICTED: uncharacterized protein LOC104210585 isoform X1 [Nicotiana 
sylvestris]
Length=834

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y + ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSQTALPDAGLTREFRVVRDNRVS  136



>ref|XP_009757817.1| PREDICTED: uncharacterized protein LOC104210585 isoform X2 [Nicotiana 
sylvestris]
Length=833

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y + ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSQTALPDAGLTREFRVVRDNRVS  136



>ref|XP_010273947.1| PREDICTED: uncharacterized protein LOC104609354 isoform X1 [Nelumbo 
nucifera]
Length=873

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 98/143 (69%), Gaps = 15/143 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ +GGTQ L   VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSGSRPDGGTQILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYR-TEEDRKEFEPANLAVKSKTHNNLIRR--GPY  533
            FHEVKRRRD++KE          NTGY+ + E RK  E      KS T ++ + R  G Y
Sbjct  61   FHEVKRRRDKRKE----------NTGYKVSTEPRKPIERIGQGTKSHTFSDRVARRGGGY  110

Query  534  KRNALPGTGVSREFRVVRDNRVN  602
             RNAL  +G+SREFR+VRDNR++
Sbjct  111  SRNAL--SGISREFRIVRDNRIS  131



>ref|XP_009599552.1| PREDICTED: uncharacterized protein LOC104095192 isoform X1 [Nicotiana 
tomentosiformis]
Length=833

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y R ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSRTALPDAGLTREFRVVRDNRVS  136



>ref|XP_009599553.1| PREDICTED: uncharacterized protein LOC104095192 isoform X2 [Nicotiana 
tomentosiformis]
Length=832

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y R ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSRTALPDAGLTREFRVVRDNRVS  136



>ref|XP_010654470.1| PREDICTED: uncharacterized protein LOC100248075 isoform X3 [Vitis 
vinifera]
Length=853

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 96/148 (65%), Gaps = 27/148 (18%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  363  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  518
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  519  RRGPYKRNALPGTGVSREFRVVRDNRVN  602
            RRG Y R+ +PG G  REFRVVRDNRVN
Sbjct  104  RRGGYSRSTVPGIG--REFRVVRDNRVN  129



>ref|XP_010261966.1| PREDICTED: uncharacterized protein LOC104600611 isoform X2 [Nelumbo 
nucifera]
Length=849

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 14/141 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            M +GS+ +GGTQ LS  VR TI+++KE+ + HS+ADIY  LKESNMDPNET QKL +QD 
Sbjct  1    MNSGSRLDGGTQILSARVRKTIQSIKEIVQNHSDADIYVMLKESNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FHEVKR+RD+KKE +N          YR   D +++ E    A KS T ++   RRG Y 
Sbjct  61   FHEVKRKRDKKKENIN----------YRGSIDPKRQSEHLGQAAKSHTFSDRNARRGGYV  110

Query  537  RNALPGTGVSREFRVVRDNRV  599
            RN LP  G+SREFRVVRDNRV
Sbjct  111  RNVLP--GISREFRVVRDNRV  129



>ref|XP_006361347.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Solanum 
tuberosum]
Length=837

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 16/144 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  530
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  531  YKRNALPGTGVSREFRVVRDNRVN  602
            Y R ALP  G +REFRVVRDNRVN
Sbjct  111  YNRTALP--GFTREFRVVRDNRVN  132



>ref|XP_006465941.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=862

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 14/149 (9%)
 Frame = +3

Query  165  RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  344
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  345  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  515
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
             RRG Y RNALP  G++REFRVVRDNRVN
Sbjct  117  RRRG-YNRNALPDAGINREFRVVRDNRVN  144



>ref|XP_006426627.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39867.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=867

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 14/149 (9%)
 Frame = +3

Query  165  RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  344
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  345  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  515
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
             RRG Y RNALP  G++REFRVVRDNRVN
Sbjct  117  RRRG-YNRNALPDAGINREFRVVRDNRVN  144



>ref|XP_006426626.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39866.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=866

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 14/149 (9%)
 Frame = +3

Query  165  RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  344
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  345  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  515
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
             RRG Y RNALP  G++REFRVVRDNRVN
Sbjct  117  RRRG-YNRNALPDAGINREFRVVRDNRVN  144



>ref|XP_009757818.1| PREDICTED: uncharacterized protein LOC104210585 isoform X3 [Nicotiana 
sylvestris]
Length=832

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 18/146 (12%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y + ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSQTALP--GLTREFRVVRDNRVS  134



>ref|XP_009599554.1| PREDICTED: uncharacterized protein LOC104095192 isoform X3 [Nicotiana 
tomentosiformis]
Length=831

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 96/146 (66%), Gaps = 18/146 (12%)
 Frame = +3

Query  183  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  524
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
            G Y R ALP  G++REFRVVRDNRV+
Sbjct  111  GSYSRTALP--GLTREFRVVRDNRVS  134



>emb|CBI35892.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 97/162 (60%), Gaps = 39/162 (24%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  363  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  518
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  519  RRGPYKRNALPG--------------TGVSREFRVVRDNRVN  602
            RRG Y R+ +PG               G+ REFRVVRDNRVN
Sbjct  104  RRGGYSRSTVPGNAKTYQFYHSILLDAGIGREFRVVRDNRVN  145



>ref|XP_004252392.1| PREDICTED: uncharacterized protein LOC101258733 isoform X1 [Solanum 
lycopersicum]
Length=834

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 90/141 (64%), Gaps = 8/141 (6%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTH-NNLIRRGPYKR  539
            FH+VKR+ DR+KE            G   E D  E       ++  TH N  IRRG Y R
Sbjct  61   FHKVKRKGDRRKENHGYKSSTAPENGNYLEHDAHE-------MRINTHINRNIRRGSYNR  113

Query  540  NALPGTGVSREFRVVRDNRVN  602
             ALP  G++REFRVVRDNRVN
Sbjct  114  TALPDAGLTREFRVVRDNRVN  134



>ref|XP_010314322.1| PREDICTED: uncharacterized protein LOC101258733 isoform X2 [Solanum 
lycopersicum]
Length=833

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 90/141 (64%), Gaps = 8/141 (6%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTH-NNLIRRGPYKR  539
            FH+VKR+ DR+KE            G   E D  E       ++  TH N  IRRG Y R
Sbjct  61   FHKVKRKGDRRKENHGYKSSTAPENGNYLEHDAHE-------MRINTHINRNIRRGSYNR  113

Query  540  NALPGTGVSREFRVVRDNRVN  602
             ALP  G++REFRVVRDNRVN
Sbjct  114  TALPDAGLTREFRVVRDNRVN  134



>gb|EYU21338.1| hypothetical protein MIMGU_mgv1a001286mg [Erythranthe guttata]
Length=847

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 14/142 (10%)
 Frame = +3

Query  189  AGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFH  368
            +GS+ EGG   +S GVR TI+++KE+   HS+ADIYA L+++NMDPNET QK+ +QD FH
Sbjct  4    SGSRTEGGPLVISAGVRRTIQSIKEIVGNHSDADIYAVLQDTNMDPNETAQKMLNQDPFH  63

Query  369  EVKRRRDRKKEALNVPKVNIQNTGYRT---EEDRKEFEPANLAVKSKTHNNL-IRRGPYK  536
            EVKR+RDRK+E           +GY++    + +K  +PA++ VK   +++   RRG   
Sbjct  64   EVKRKRDRKREI----------SGYKSYIAADPKKSADPAHMPVKFSAYSDRNTRRGVST  113

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RNA P  G +REFRVVRDNRVN
Sbjct  114  RNAAPDAGANREFRVVRDNRVN  135



>ref|XP_010062689.1| PREDICTED: uncharacterized protein LOC104450008 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69815.1| hypothetical protein EUGRSUZ_F03171 [Eucalyptus grandis]
Length=866

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 97/153 (63%), Gaps = 23/153 (15%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV  SK EGGTQ L P VR TI+T+KEV K +S+ADIYA LKES+MDPNET QKL +QD 
Sbjct  1    MVTASKAEGGTQVLPPRVRSTIQTIKEVVKNYSDADIYAALKESDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVK-SKTHNNLIRRGPYKR  539
            FHEVKR++DRKKE+          TG    E RK FE      K S   ++ IR+G Y R
Sbjct  61   FHEVKRKKDRKKES-------TAQTG--PTEQRKHFENVGQVRKFSPQVDHGIRKG-YTR  110

Query  540  NA-----------LPGTGV-SREFRVVRDNRVN  602
            NA           LPG G  S+EFRVVRDNRVN
Sbjct  111  NALPSNSGQARKSLPGNGTRSKEFRVVRDNRVN  143



>ref|XP_007024585.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY27207.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=852

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 13/141 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  540  NALPGTGVSREFRVVRDNRVN  602
            N LP  GV+REFRVVRDNRVN
Sbjct  109  NTLPDAGVNREFRVVRDNRVN  129



>ref|XP_007024588.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY27210.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=842

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 13/141 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  540  NALPGTGVSREFRVVRDNRVN  602
            N LP  GV+REFRVVRDNRVN
Sbjct  109  NTLPDAGVNREFRVVRDNRVN  129



>gb|KDO65081.1| hypothetical protein CISIN_1g040475mg [Citrus sinensis]
Length=861

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 16/149 (11%)
 Frame = +3

Query  165  RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  344
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  345  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  515
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
             RRG Y RNALP  G++REFRVVRDNRVN
Sbjct  117  RRRG-YNRNALP--GINREFRVVRDNRVN  142



>ref|XP_010062690.1| PREDICTED: uncharacterized protein LOC104450008 isoform X2 [Eucalyptus 
grandis]
Length=863

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 95/150 (63%), Gaps = 20/150 (13%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV  SK EGGTQ L P VR TI+T+KEV K +S+ADIYA LKES+MDPNET QKL +QD 
Sbjct  1    MVTASKAEGGTQVLPPRVRSTIQTIKEVVKNYSDADIYAALKESDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVK-SKTHNNLIRRGPYKR  539
            FHEVKR++DRKKE+          TG    E RK FE      K S   ++ IR+G Y R
Sbjct  61   FHEVKRKKDRKKES-------TAQTG--PTEQRKHFENVGQVRKFSPQVDHGIRKG-YTR  110

Query  540  NALPG---------TGVSREFRVVRDNRVN  602
            NALP             S+EFRVVRDNRVN
Sbjct  111  NALPSNSGQARKSLPARSKEFRVVRDNRVN  140



>ref|XP_010654469.1| PREDICTED: uncharacterized protein LOC100248075 isoform X2 [Vitis 
vinifera]
Length=855

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 25/148 (17%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            M   S+ EGG Q L P V  TI+ +KE+   HS+ADIY  L+E NMDPNET QKL +QD 
Sbjct  1    MAFDSRMEGGMQILPPQVHKTIQLIKEIVGNHSDADIYVALREMNMDPNETVQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  518
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  519  RRGPYKRNALPGTGVSREFRVVRDNRVN  602
            RRG Y R+ +P  G+ REFRVVRDNRVN
Sbjct  104  RRGGYSRSTVPDAGIGREFRVVRDNRVN  131



>ref|XP_010314323.1| PREDICTED: uncharacterized protein LOC101258733 isoform X3 [Solanum 
lycopersicum]
Length=832

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 90/141 (64%), Gaps = 10/141 (7%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTH-NNLIRRGPYKR  539
            FH+VKR+ DR+KE            G   E D  E       ++  TH N  IRRG Y R
Sbjct  61   FHKVKRKGDRRKENHGYKSSTAPENGNYLEHDAHE-------MRINTHINRNIRRGSYNR  113

Query  540  NALPGTGVSREFRVVRDNRVN  602
             ALP  G++REFRVVRDNRVN
Sbjct  114  TALP--GLTREFRVVRDNRVN  132



>ref|XP_010936968.1| PREDICTED: uncharacterized protein LOC105056461 isoform X1 [Elaeis 
guineensis]
Length=863

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 26/149 (17%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV  S+ +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QD 
Sbjct  1    MVLASRLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED---------RKEFEPANLAVKSKTHNNL  515
            FHEVKR+RDRKKE         QNTGYR   D         +KE   A+    +K     
Sbjct  61   FHEVKRKRDRKKEP--------QNTGYRASVDTRIRTVHKIQKEKSQASWGQNAK-----  107

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
              RG Y RN +PG   +REFR+VRDNR+N
Sbjct  108  --RGSYPRNPVPGP--NREFRIVRDNRMN  132



>ref|XP_003528451.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 gb|KHN01390.1| hypothetical protein glysoja_009596 [Glycine soja]
Length=863

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  527
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  528  PYKRNALPGTGVSREFRVVRDNRVN  602
             Y RN LP  G+S+EFRVVRDNRVN
Sbjct  115  NYSRNTLP--GISKEFRVVRDNRVN  137



>ref|XP_006583148.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=855

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  527
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  528  PYKRNALPGTGVSREFRVVRDNRVN  602
             Y RN LP  G+S+EFRVVRDNRVN
Sbjct  115  NYSRNTLP--GISKEFRVVRDNRVN  137



>ref|XP_006583149.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
Length=830

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  527
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  528  PYKRNALPGTGVSREFRVVRDNRVN  602
             Y RN LP  G+S+EFRVVRDNRVN
Sbjct  115  NYSRNTLP--GISKEFRVVRDNRVN  137



>gb|EPS69388.1| hypothetical protein M569_05379, partial [Genlisea aurea]
Length=160

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  189  AGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFH  368
            +GS+ EGG Q LS GVR TI+++KEV   HS+ADIY  LKE+NMDPNET  KL  QD FH
Sbjct  1    SGSRIEGGPQVLSAGVRRTIQSIKEVFGSHSDADIYVALKEANMDPNETAHKLLIQDPFH  60

Query  369  EVKRRRDRKKEALNVPKVNIQNTGYRT---EEDRKEFEPANLAVKSKTHNN-LIRRGPYK  536
            EVKR+RDRKKE          N+G++     +  K  E  ++  ++ T+++ + RRG + 
Sbjct  61   EVKRKRDRKKE----------NSGHKIPVGPDVPKYSEITHVPPRNTTNSDRVARRGVFG  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN     G  +EFRVVRDNRVN
Sbjct  111  RNVPSDAGAIQEFRVVRDNRVN  132



>ref|XP_009339824.1| PREDICTED: uncharacterized protein LOC103932015 isoform X1 [Pyrus 
x bretschneideri]
Length=877

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 97/171 (57%), Gaps = 37/171 (22%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T             
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNTSSDRPPSQNTTSD  114

Query  504  --------------HNNL----IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                          HN      +RRG Y R    GTG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPSSHNTFSDRNVRRGGYARGGSTGTGISREFRVVRDNRIN  165



>ref|XP_009339841.1| PREDICTED: uncharacterized protein LOC103932015 isoform X3 [Pyrus 
x bretschneideri]
Length=848

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 97/171 (57%), Gaps = 37/171 (22%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T             
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNTSSDRPPSQNTTSD  114

Query  504  --------------HNNL----IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                          HN      +RRG Y R    GTG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPSSHNTFSDRNVRRGGYARGGSTGTGISREFRVVRDNRIN  165



>ref|XP_007024587.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY27209.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=849

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 15/141 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  540  NALPGTGVSREFRVVRDNRVN  602
            N LP  GV+REFRVVRDNRVN
Sbjct  109  NTLP--GVNREFRVVRDNRVN  127



>ref|XP_007024589.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY27211.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=839

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 15/141 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  540  NALPGTGVSREFRVVRDNRVN  602
            N LP  GV+REFRVVRDNRVN
Sbjct  109  NTLP--GVNREFRVVRDNRVN  127



>ref|XP_007024584.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY27206.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=883

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 15/141 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  540  NALPGTGVSREFRVVRDNRVN  602
            N LP  GV+REFRVVRDNRVN
Sbjct  109  NTLP--GVNREFRVVRDNRVN  127



>ref|XP_007135474.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
 gb|ESW07468.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
Length=864

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 88/145 (61%), Gaps = 15/145 (10%)
 Frame = +3

Query  183  MVAGSKFEG--GTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GS+ E   GT  LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTESATGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRG  527
            D FHEVKRRRDRKKE         QN G     D +     N     K H      +RR 
Sbjct  61   DPFHEVKRRRDRKKEP--------QNVGNNGSADSRRPSENNSGQGVKFHTPSERNVRRA  112

Query  528  PYKRNALPGTGVSREFRVVRDNRVN  602
             Y RN LP  G+SREFRVVRDNRVN
Sbjct  113  NYSRNTLP--GISREFRVVRDNRVN  135



>ref|XP_010936970.1| PREDICTED: uncharacterized protein LOC105056461 isoform X2 [Elaeis 
guineensis]
Length=861

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 92/149 (62%), Gaps = 28/149 (19%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV  S+ +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QD 
Sbjct  1    MVLASRLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED---------RKEFEPANLAVKSKTHNNL  515
            FHEVKR+RDRKKE          NTGYR   D         +KE   A+    +K     
Sbjct  61   FHEVKRKRDRKKE----------NTGYRASVDTRIRTVHKIQKEKSQASWGQNAK-----  105

Query  516  IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
              RG Y RN +PG   +REFR+VRDNR+N
Sbjct  106  --RGSYPRNPVPGP--NREFRIVRDNRMN  130



>gb|KHG27656.1| ATP-dependent zinc metalloprotease FtsH [Gossypium arboreum]
Length=853

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 15/142 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  536
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RNALP   V+REFRVVRDNRVN
Sbjct  108  RNALPDARVNREFRVVRDNRVN  129



>ref|XP_008338695.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Malus 
domestica]
Length=875

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 96/171 (56%), Gaps = 37/171 (22%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE  +       + G    + R+ FE A     S T             
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSDRPPSQNTTSD  114

Query  504  ----HNNL--------------IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                H+                +RRG Y R +  GTG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPPYRNTFSDRNVRRGGYARGSSTGTGISREFRVVRDNRIN  165



>ref|XP_008338694.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=876

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 96/171 (56%), Gaps = 37/171 (22%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE  +       + G    + R+ FE A     S T             
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSDRPPSQNTTSD  114

Query  504  ----HNNL--------------IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                H+                +RRG Y R +  GTG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPPYRNTFSDRNVRRGGYARGSSTGTGISREFRVVRDNRIN  165



>ref|XP_010087685.1| hypothetical protein L484_013447 [Morus notabilis]
 gb|EXB29673.1| hypothetical protein L484_013447 [Morus notabilis]
Length=854

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 93/146 (64%), Gaps = 15/146 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+ S+ +GG Q LS GVR TI+++KE+   HS+ DIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSASRIDGGPQILSAGVRKTIQSIKEIVGNHSDIDIYLALKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  539
            FHEV+R+RD+KKE+      N  +T  R   + K         K  T ++   RRG Y R
Sbjct  61   FHEVRRKRDKKKESAG----NDSSTDPRGHSEVK-----GQGSKVNTFSDRNARRGGYAR  111

Query  540  NALPG-----TGVSREFRVVRDNRVN  602
            N+LP       GVSREFRVVRDNRVN
Sbjct  112  NSLPDRIMLHAGVSREFRVVRDNRVN  137



>ref|XP_010685333.1| PREDICTED: uncharacterized protein LOC104899768 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=796

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 92/141 (65%), Gaps = 11/141 (8%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  540  NALPGTGVSREFRVVRDNRVN  602
            + +   G+S+EFRVVRDNRVN
Sbjct  111  SPVNDAGMSQEFRVVRDNRVN  131



>ref|XP_010685331.1| PREDICTED: uncharacterized protein LOC104899768 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=825

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 92/141 (65%), Gaps = 11/141 (8%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  540  NALPGTGVSREFRVVRDNRVN  602
            + +   G+S+EFRVVRDNRVN
Sbjct  111  SPVNDAGMSQEFRVVRDNRVN  131



>ref|XP_004141213.1| PREDICTED: uncharacterized protein LOC101203238 [Cucumis sativus]
Length=740

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            +++ P  G+S+EFRVVRDNRVN
Sbjct  111  KSSWP--GISKEFRVVRDNRVN  130



>gb|KJB70100.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=853

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  536
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN LP   V+REFRVVRDNRVN
Sbjct  108  RNTLPDARVNREFRVVRDNRVN  129



>gb|KJB70102.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=854

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  536
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN LP   V+REFRVVRDNRVN
Sbjct  108  RNTLPDARVNREFRVVRDNRVN  129



>gb|KJB70101.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=843

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  536
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN LP   V+REFRVVRDNRVN
Sbjct  108  RNTLPDARVNREFRVVRDNRVN  129



>gb|KJB70099.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=852

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  536
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN LP   V+REFRVVRDNRVN
Sbjct  108  RNTLPDARVNREFRVVRDNRVN  129



>ref|XP_008464006.1| PREDICTED: uncharacterized protein LOC103501996 isoform X1 [Cucumis 
melo]
Length=850

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRIDGGTHILPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            +++ P  G+S+EFRVVRDNRVN
Sbjct  111  KSSWP--GISKEFRVVRDNRVN  130



>ref|XP_008464007.1| PREDICTED: uncharacterized protein LOC103501996 isoform X2 [Cucumis 
melo]
Length=846

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRIDGGTHILPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            +++ P  G+S+EFRVVRDNRVN
Sbjct  111  KSSWP--GISKEFRVVRDNRVN  130



>ref|XP_004163891.1| PREDICTED: uncharacterized protein LOC101226902 [Cucumis sativus]
Length=846

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            +++ P  G+S+EFRVVRDNRVN
Sbjct  111  KSSWP--GISKEFRVVRDNRVN  130



>gb|KGN59790.1| hypothetical protein Csa_3G846060 [Cucumis sativus]
Length=855

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            +++ P  G+S+EFRVVRDNRVN
Sbjct  111  KSSWP--GISKEFRVVRDNRVN  130



>ref|XP_006849609.1| hypothetical protein AMTR_s00024p00205340 [Amborella trichopoda]
 gb|ERN11190.1| hypothetical protein AMTR_s00024p00205340 [Amborella trichopoda]
Length=158

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 92/143 (64%), Gaps = 15/143 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV+G + E  T ++ P  V+ TI+++KE+   HS+  IY TLKESNMDPNET QKL +QD
Sbjct  1    MVSGPRAETETSDILPAKVQRTIQSIKEIVGNHSDEYIYVTLKESNMDPNETAQKLLNQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSK-THNNLIRRGPY  533
             FHEVKR+RD+KKE+          T +++  E R+  EP    V++    +   RRG Y
Sbjct  61   PFHEVKRKRDKKKES----------TLHKSPPEIRRRPEPTGQVVRTHMVWDQNARRGGY  110

Query  534  KRNALPGTGVSREFRVVRDNRVN  602
             RN LP  G+SREFRVVRDNR N
Sbjct  111  ARNKLP--GISREFRVVRDNRFN  131



>ref|XP_010685332.1| PREDICTED: uncharacterized protein LOC104899768 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=823

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 92/141 (65%), Gaps = 13/141 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  540  NALPGTGVSREFRVVRDNRVN  602
            +  P  G+S+EFRVVRDNRVN
Sbjct  111  S--PVNGMSQEFRVVRDNRVN  129



>ref|XP_009339833.1| PREDICTED: uncharacterized protein LOC103932015 isoform X2 [Pyrus 
x bretschneideri]
Length=875

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 96/171 (56%), Gaps = 39/171 (23%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T             
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNTSSDRPPSQNTTSD  114

Query  504  --------------HNNL----IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                          HN      +RRG Y R     TG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPSSHNTFSDRNVRRGGYARGG--STGISREFRVVRDNRIN  163



>ref|XP_009372373.1| PREDICTED: uncharacterized protein LOC103961534 isoform X1 [Pyrus 
x bretschneideri]
Length=900

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 98/192 (51%), Gaps = 58/192 (30%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT------------  503
            FH VKR+RD++KE      V+  + G++  ED R+ FE A    K  T            
Sbjct  61   FHVVKRKRDKRKE------VSSNSNGHKVPEDARRHFESAGQGPKPNTSSDHPSSQNTTS  114

Query  504  ---------------HNNL------------------------IRRGPYKRNALPGTGVS  566
                           HN                          +RRG Y R    GT +S
Sbjct  115  DHPFSQNTTSDRPSSHNTFSDRPSSHNTFSDRPSSRNTFSDRNVRRGGYTRGGSTGTKIS  174

Query  567  REFRVVRDNRVN  602
            REFRVVRDNR+N
Sbjct  175  REFRVVRDNRIN  186



>gb|KHN39644.1| hypothetical protein glysoja_020722 [Glycine soja]
Length=860

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 13/146 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQN----LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  350
            MV GSK EGG       LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPGSKTEGGGTGTTHLLSARVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLL  60

Query  351  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE-PANLAVKSKTHNNL-IRR  524
            +QD FHEVKRRRDRKKE  NV      N G  + + R+  E  +   +K  TH+   +RR
Sbjct  61   NQDPFHEVKRRRDRKKETQNV-----GNRGQPSADSRRPSENNSGQGMKFHTHSERNVRR  115

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
              Y R+  P  G+SREFRVVRDNRVN
Sbjct  116  TNYSRSTFP--GISREFRVVRDNRVN  139



>ref|XP_006598817.1| PREDICTED: putative uncharacterized protein DDB_G0277255-like 
[Glycine max]
Length=852

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 13/146 (9%)
 Frame = +3

Query  183  MVAGSKFEGGTQN----LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  350
            MV GSK EGG       LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPGSKTEGGGTGTTHLLSARVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLL  60

Query  351  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE-PANLAVKSKTHNNL-IRR  524
            +QD FHEVKRRRDRKKE  NV      N G  + + R+  E  +   +K  TH+   +RR
Sbjct  61   NQDPFHEVKRRRDRKKETQNV-----GNRGQPSADSRRPSENNSGQGMKFHTHSERNVRR  115

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
              Y R+  P  G+SREFRVVRDNRVN
Sbjct  116  TNYSRSTFP--GISREFRVVRDNRVN  139



>ref|XP_008338696.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Malus 
domestica]
Length=874

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 95/171 (56%), Gaps = 39/171 (23%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  503
            FH VKR+RD++KE  +       + G    + R+ FE A     S T             
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSDRPPSQNTTSD  114

Query  504  ----HNNL--------------IRRGPYKRNALPGTGVSREFRVVRDNRVN  602
                H+                +RRG Y R +   TG+SREFRVVRDNR+N
Sbjct  115  RPSSHSTFSDRPPYRNTFSDRNVRRGGYARGS--STGISREFRVVRDNRIN  163



>ref|XP_010917132.1| PREDICTED: uncharacterized protein LOC105041803 isoform X1 [Elaeis 
guineensis]
Length=861

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 12/142 (8%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV GS+ +G +Q +S  +R TI+++KE+    S+ DIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVLGSRLDGESQIVSVPIRKTIQSIKEIVGNQSDTDIYAMLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FHEVKR+RD+KKE          +TGY+   D  K  E      KS T  +   RRG + 
Sbjct  61   FHEVKRKRDKKKE----------HTGYKGSGDTNKRIEHNVQWTKSHTSGDRNARRGGFT  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R   P  G+ +EFR+VRDNRVN
Sbjct  111  RKPAPDAGIRQEFRIVRDNRVN  132



>ref|XP_008797669.1| PREDICTED: uncharacterized protein LOC103712805 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 16/143 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV  SK +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QDT
Sbjct  1    MVLASKLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDT  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRGPY  533
            FHEVKR+RDRKKE+          TGYR   D +     +   + K+  +     +RG Y
Sbjct  61   FHEVKRKRDRKKES----------TGYRASVDTR-IRTVHKIQREKSQASWGQNAKRGGY  109

Query  534  KRNALPGTGVSREFRVVRDNRVN  602
             R+ +PG   +REFR+VRDNR+N
Sbjct  110  PRSPVPGP--NREFRIVRDNRMN  130



>ref|XP_008391372.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X2 [Malus 
domestica]
Length=894

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 100/182 (55%), Gaps = 43/182 (24%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNI----------QNTGYRTEEDRKEFE------PA--NLA  488
            FH VKR+RD++KE+ N  KV++          Q     T  DR   +      P+  N +
Sbjct  61   FHVVKRKRDKRKES-NGHKVSVDARRHSESAGQGPKPNTSSDRPSSQNTTSDHPSSQNTS  119

Query  489  VKSKTHNNL------------------------IRRGPYKRNALPGTGVSREFRVVRDNR  596
             +  +HN                          +RRG Y R    GT +SREFRVVRDNR
Sbjct  120  DRPSSHNTFPDRPSSRNTFSDHPSSRNTFSDRNVRRGGYARGGSTGTRISREFRVVRDNR  179

Query  597  VN  602
            +N
Sbjct  180  IN  181



>ref|XP_009372374.1| PREDICTED: uncharacterized protein LOC103961534 isoform X2 [Pyrus 
x bretschneideri]
Length=896

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 96/192 (50%), Gaps = 62/192 (32%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT------------  503
            FH VKR+RD++KE+           G++  ED R+ FE A    K  T            
Sbjct  61   FHVVKRKRDKRKES----------NGHKVPEDARRHFESAGQGPKPNTSSDHPSSQNTTS  110

Query  504  ---------------HNNL------------------------IRRGPYKRNALPGTGVS  566
                           HN                          +RRG Y R    GT +S
Sbjct  111  DHPFSQNTTSDRPSSHNTFSDRPSSHNTFSDRPSSRNTFSDRNVRRGGYTRGGSTGTKIS  170

Query  567  REFRVVRDNRVN  602
            REFRVVRDNR+N
Sbjct  171  REFRVVRDNRIN  182



>gb|KDP40717.1| hypothetical protein JCGZ_24716 [Jatropha curcas]
Length=866

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 89/135 (66%), Gaps = 17/135 (13%)
 Frame = +3

Query  213  TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDR  392
            T  LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEV+R+RD+
Sbjct  20   THTLSARVRKTIQSIKEIVGNFSDADIYMALKETNMDPNETAQKLLNQDPFHEVRRKRDK  79

Query  393  KKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT---HNNLIRRGPYKRNALPG-T  557
            KKE++          GYR   D RK  E  NL   +KT    +   R+G Y RNA+PG  
Sbjct  80   KKESM----------GYRVAVDSRKNSE--NLGQGAKTRIFSDRNARQGGYMRNAVPGNA  127

Query  558  GVSREFRVVRDNRVN  602
            G++REFRVVRDNRVN
Sbjct  128  GMNREFRVVRDNRVN  142



>ref|XP_011467415.1| PREDICTED: uncharacterized protein LOC101293990 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=913

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 103/209 (49%), Gaps = 69/209 (33%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGG Q +S GVR TI+T+KE+   HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGNQIISAGVRKTIQTIKEIVGNHSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKE---------ALNVPKVNIQNTGY---------RTEEDRKEFEPANLA  488
            FHEVKR+RD+KKE          L  P+ ++++ G          R  E ++ FE A   
Sbjct  61   FHEVKRKRDKKKEVPPKSIGQKVLTEPRRHVESAGQGPRSNTTSERVVEPKRHFETAVQG  120

Query  489  VKSKTHNNL-----------------------------------------------IRRG  527
             +S T+++                                                +RRG
Sbjct  121  PRSNTNSDRNVEPRRQFDSAGHGPKFNKFSDRNVEPRRHFENAGQGPRQSSFSDRNVRRG  180

Query  528  PYKRNALP----GTGVSREFRVVRDNRVN  602
             Y R   P    GTG+SREFRVVRDNR N
Sbjct  181  GYVRRGFPGISRGTGISREFRVVRDNRAN  209



>ref|XP_004303676.1| PREDICTED: uncharacterized protein LOC101293990 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 103/209 (49%), Gaps = 69/209 (33%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+ EGG Q +S GVR TI+T+KE+   HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGNQIISAGVRKTIQTIKEIVGNHSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKE---------ALNVPKVNIQNTGY---------RTEEDRKEFEPANLA  488
            FHEVKR+RD+KKE          L  P+ ++++ G          R  E ++ FE A   
Sbjct  61   FHEVKRKRDKKKEVPPKSIGQKVLTEPRRHVESAGQGPRSNTTSERVVEPKRHFETAVQG  120

Query  489  VKSKTHNNL-----------------------------------------------IRRG  527
             +S T+++                                                +RRG
Sbjct  121  PRSNTNSDRNVEPRRQFDSAGHGPKFNKFSDRNVEPRRHFENAGQGPRQSSFSDRNVRRG  180

Query  528  PYKRNALP----GTGVSREFRVVRDNRVN  602
             Y R   P    GTG+SREFRVVRDNR N
Sbjct  181  GYVRRGFPGISRGTGISREFRVVRDNRAN  209



>ref|XP_011072651.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157853 
[Sesamum indicum]
Length=859

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 14/124 (11%)
 Frame = +3

Query  243  TIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNVPKV  422
            TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RDRKKE       
Sbjct  27   TIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQDPFHEVKRKRDRKKE-------  79

Query  423  NIQNTGYR---TEEDRKEFEPANLAVKSKTHNNL-IRRGPYKRNALPGTGVSREFRVVRD  590
               N+GY+     E RK  E A + VK+ T+++   RRG   RN    TG SREFRVVRD
Sbjct  80   ---NSGYKNYVAAEPRKNTELARMPVKNSTYSDRNSRRGGSGRNIASDTGASREFRVVRD  136

Query  591  NRVN  602
            NRV+
Sbjct  137  NRVS  140



>ref|XP_009391448.1| PREDICTED: uncharacterized protein LOC103977608 [Musa acuminata 
subsp. malaccensis]
Length=857

 Score =   119 bits (298),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 71/142 (50%), Positives = 92/142 (65%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV GS  +GG Q +   ++ TI+++KE+   HS+ADIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVMGSGVDGGGQVVPLRIQKTIQSIKEIVGNHSDADIYAVLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTH-NNLIRRGPYK  536
            FHEVKR+RDRKKE           TGYR   D R+  EP     K  T  +  + +G Y 
Sbjct  61   FHEVKRKRDRKKEP----------TGYRGLADTRRHVEPNVQWAKPLTSWDQNMHKGDYT  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            RN++P   +SR+FR+VRDNRVN
Sbjct  111  RNSVP--RISRQFRIVRDNRVN  130



>ref|XP_004510436.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=889

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 95/167 (57%), Gaps = 31/167 (19%)
 Frame = +3

Query  183  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV  S+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPSSRTEGGTGTHLLSAKVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNV-------PKVNIQNTGYRTE---------------EDRKEF  470
            D FHEVKRRRDRKKE  NV       P+ + +N G   +               E R+  
Sbjct  61   DPFHEVKRRRDRKKENQNVGNRGSGEPRRHSENGGQGMQFNNPSEHNVGNKGSGEPRRHT  120

Query  471  EPANLAVKSKT---HNNLIRRGPYKRNALPGTGVSREFRVVRDNRVN  602
            E     +   T   HN  +RR  Y RN+ P    SREFRVVRDNRVN
Sbjct  121  ENGGQGMHFHTPAEHN--VRRTNYSRNSTP--SFSREFRVVRDNRVN  163



>ref|XP_008391371.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=898

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 99/185 (54%), Gaps = 45/185 (24%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEA---LNVPKVNI----------QNTGYRTEEDRKEFE------PA--  479
            FH VKR+RD++KE     N  KV++          Q     T  DR   +      P+  
Sbjct  61   FHVVKRKRDKRKEVSSNSNGHKVSVDARRHSESAGQGPKPNTSSDRPSSQNTTSDHPSSQ  120

Query  480  NLAVKSKTHNNL------------------------IRRGPYKRNALPGTGVSREFRVVR  587
            N + +  +HN                          +RRG Y R    GT +SREFRVVR
Sbjct  121  NTSDRPSSHNTFPDRPSSRNTFSDHPSSRNTFSDRNVRRGGYARGGSTGTRISREFRVVR  180

Query  588  DNRVN  602
            DNR+N
Sbjct  181  DNRIN  185



>ref|XP_010917133.1| PREDICTED: uncharacterized protein LOC105041803 isoform X2 [Elaeis 
guineensis]
Length=859

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 14/142 (10%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV GS+ +G +Q +S  +R TI+++KE+    S+ DIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVLGSRLDGESQIVSVPIRKTIQSIKEIVGNQSDTDIYAMLKETNMDPNETAQKLLNQDP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  536
            FHEVKR+RD+KKE          +TGY+   D  K  E      KS T  +   RRG + 
Sbjct  61   FHEVKRKRDKKKE----------HTGYKGSGDTNKRIEHNVQWTKSHTSGDRNARRGGFT  110

Query  537  RNALPGTGVSREFRVVRDNRVN  602
            R   P  G+ +EFR+VRDNRVN
Sbjct  111  RK--PAPGIRQEFRIVRDNRVN  130



>ref|XP_002521347.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41015.1| conserved hypothetical protein [Ricinus communis]
Length=864

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 85/130 (65%), Gaps = 13/130 (10%)
 Frame = +3

Query  222  LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RD+KKE
Sbjct  21   LSATVRKTIQSIKEIVGNFSDADIYMALKETNMDPNETAQKLLNQDPFHEVKRKRDKKKE  80

Query  402  ALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYKRNALPG-TGVSRE  572
            ++           YR   D RK  E      K +T ++   R+G Y R A+PG  G++RE
Sbjct  81   SM----------AYRGSLDSRKNPENMGQGTKFRTFSDRNTRQGGYIRAAVPGNAGINRE  130

Query  573  FRVVRDNRVN  602
            FRVVRDNRVN
Sbjct  131  FRVVRDNRVN  140



>ref|XP_008784271.1| PREDICTED: uncharacterized protein LOC103703266 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 66/143 (46%), Positives = 92/143 (64%), Gaps = 16/143 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV GS+ +GG+Q +S  +R TI+++KE+   HS++DIYA L+E+NMDPNET QKL +Q  
Sbjct  1    MVLGSRLDGGSQIVSVRIRKTIQSIKEIVGDHSDSDIYAMLQETNMDPNETAQKLLNQGP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRN  542
            FHEVKR+RD++KE          +TGY    D K     N+   +K+H +  R    +R+
Sbjct  61   FHEVKRKRDKRKE----------HTGYMGSGDTKTSVEHNVQW-TKSHASWDRNA--RRD  107

Query  543  ALPGT---GVSREFRVVRDNRVN  602
               G    G+SREFR+VRDNRVN
Sbjct  108  GFTGKLAPGISREFRIVRDNRVN  130



>ref|XP_010932459.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Elaeis guineensis]
Length=861

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 16/143 (11%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV GS+ +GG+Q +S  +R TI+++KE+   HS++DIYA L+E+NMDPNET Q L +Q  
Sbjct  1    MVLGSRLDGGSQIVSVRIRKTIQSIKEIVGDHSDSDIYAMLQETNMDPNETAQNLLNQGP  60

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLA-VKSKTH--NNLIRRGPY  533
            FHEVKRRRD++KE          +TGY    D K+    N+   KS T    N  R G  
Sbjct  61   FHEVKRRRDKRKE----------HTGYGGSGDTKKGVEHNVQWTKSHTSWDQNTQRDGFT  110

Query  534  KRNALPGTGVSREFRVVRDNRVN  602
             +   P  G+SREFRVVRDNRVN
Sbjct  111  GK---PAPGISREFRVVRDNRVN  130



>ref|XP_006296970.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
 gb|EOA29868.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
Length=850

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 84/146 (58%), Gaps = 6/146 (4%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMDP+E  QKL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDPDEAVQKLIHQD  60

Query  360  TFHEVKRRRDRKKEALNV--PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPY  533
             FHEVKR+RDRKKE   V  P    +     T E +   +P     +   H N + R   
Sbjct  61   PFHEVKRKRDRKKEDTVVVEPANRKKPLESVTSEVKVRTQPEYNVRRGGYHRNFVPRNAA  120

Query  534  KRNAL---PGTGVSREFRVVRDNRVN  602
            +RNA    P TG +REFRVVRDNR N
Sbjct  121  QRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010465276.1| PREDICTED: uncharacterized protein LOC104745669 isoform X1 [Camelina 
sativa]
Length=853

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 84/156 (54%), Gaps = 26/156 (17%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  533
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  534  KRNAL-------------PGTGVSREFRVVRDNRVN  602
             RN               P TG +REFRVVRDNR N
Sbjct  111  NRNFFPRNAVQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010465278.1| PREDICTED: uncharacterized protein LOC104745669 isoform X3 [Camelina 
sativa]
Length=852

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 84/156 (54%), Gaps = 26/156 (17%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  533
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  534  KRNAL-------------PGTGVSREFRVVRDNRVN  602
             RN               P TG +REFRVVRDNR N
Sbjct  111  NRNFFPRNAVQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010465277.1| PREDICTED: uncharacterized protein LOC104745669 isoform X2 [Camelina 
sativa]
Length=852

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 84/156 (54%), Gaps = 26/156 (17%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  533
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  534  KRNAL-------------PGTGVSREFRVVRDNRVN  602
             RN               P TG +REFRVVRDNR N
Sbjct  111  NRNFFPRNAVQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_002304144.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
 gb|EEE79123.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
Length=858

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 13/130 (10%)
 Frame = +3

Query  222  LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            LS  VR  I+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RD+KKE
Sbjct  30   LSARVRKIIQSIKEIVGNFSDADIYMVLKETNMDPNETVQKLLNQDPFHEVKRKRDKKKE  89

Query  402  ALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTH-NNLIRRGPYKR-NALPGTGVSRE  572
            +++          YR   D RK+ E  +  ++ +T  +   +RG + R +++   GV+RE
Sbjct  90   SMS----------YRGSVDSRKQPENFDQGMRPRTFLDRYAQRGGHTRTDSIGNRGVNRE  139

Query  573  FRVVRDNRVN  602
            FRVVRDNR+N
Sbjct  140  FRVVRDNRIN  149



>ref|NP_188015.2| kinase-related protein [Arabidopsis thaliana]
 gb|AAM83252.1| AT3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AAN18205.1| At3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AEE75448.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=848

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 85/158 (54%), Gaps = 30/158 (19%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  527
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  528  PYKRNAL-------------PGTGVSREFRVVRDNRVN  602
             Y RN               P TG ++EFRVVRDNR N
Sbjct  109  GYSRNFFPRNAAQRNASPRNPATGSNKEFRVVRDNRSN  146



>ref|NP_001078149.1| kinase-related protein [Arabidopsis thaliana]
 dbj|BAE99198.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75449.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=847

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 85/158 (54%), Gaps = 30/158 (19%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  527
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  528  PYKRNAL-------------PGTGVSREFRVVRDNRVN  602
             Y RN               P TG ++EFRVVRDNR N
Sbjct  109  GYSRNFFPRNAAQRNASPRNPATGSNKEFRVVRDNRSN  146



>emb|CAN69468.1| hypothetical protein VITISV_042555 [Vitis vinifera]
Length=914

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 90/207 (43%), Gaps = 84/207 (41%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD-  359
            M   S+ EGG Q L P V  TI+ +KE+   HS+ADIY  L+E NMDPNET QKL +QD 
Sbjct  1    MAFDSRMEGGMQILPPQVHKTIQLIKEIVGNHSDADIYVALREMNMDPNETVQKLLNQDL  60

Query  360  ------------------------TFHEVKRRRDRKKEALNV-----PKVNIQNTG---Y  443
                                     FHEVKR+RD+KKE+        P++ I+N G   +
Sbjct  61   DIHVMLREMNMDPNEVAQKLLNQDPFHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKF  120

Query  444  RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPG-----------------------  554
            R+  DR                  +RRG Y R+ +PG                       
Sbjct  121  RSFPDRN-----------------VRRGGYSRSTVPGNAKTYQFYHSFVLELLYLTVCFL  163

Query  555  -----------TGVSREFRVVRDNRVN  602
                        G+ REFRVVRDNRVN
Sbjct  164  LSELMVRILLDAGIGREFRVVRDNRVN  190



>dbj|BAB02329.1| unnamed protein product [Arabidopsis thaliana]
Length=870

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 85/158 (54%), Gaps = 30/158 (19%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  360  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  527
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  528  PYKRNAL-------------PGTGVSREFRVVRDNRVN  602
             Y RN               P TG ++EFRVVRDNR N
Sbjct  109  GYSRNFFPRNAAQRNASPRNPATGSNKEFRVVRDNRSN  146



>ref|XP_010542406.1| PREDICTED: uncharacterized protein LOC104815628 isoform X2 [Tarenaya 
hassleriana]
Length=860

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 22/154 (14%)
 Frame = +3

Query  183  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            TFHEVKRRRDRKKE       +    G  + E   +   + +  +++   N +RRG Y R
Sbjct  61   TFHEVKRRRDRKKE-------DAVFDGPASREKPSDDADSEVKFRTQPERN-VRRGGYSR  112

Query  540  NALP-GT------------GVSREFRVVRDNRVN  602
             +   GT            G +REFRVVRDNR N
Sbjct  113  GSFSRGTAPRHAFSRNSTAGTNREFRVVRDNRSN  146



>ref|XP_010542405.1| PREDICTED: uncharacterized protein LOC104815628 isoform X1 [Tarenaya 
hassleriana]
Length=861

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 22/154 (14%)
 Frame = +3

Query  183  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            TFHEVKRRRDRKKE       +    G  + E   +   + +  +++   N +RRG Y R
Sbjct  61   TFHEVKRRRDRKKE-------DAVFDGPASREKPSDDADSEVKFRTQPERN-VRRGGYSR  112

Query  540  NALP-GT------------GVSREFRVVRDNRVN  602
             +   GT            G +REFRVVRDNR N
Sbjct  113  GSFSRGTAPRHAFSRNSTAGTNREFRVVRDNRSN  146



>ref|XP_010542407.1| PREDICTED: uncharacterized protein LOC104815628 isoform X3 [Tarenaya 
hassleriana]
Length=860

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 22/154 (14%)
 Frame = +3

Query  183  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKR  539
            TFHEVKRRRDRKKE       +    G  + E   +   + +  +++   N +RRG Y R
Sbjct  61   TFHEVKRRRDRKKE-------DAVFDGPASREKPSDDADSEVKFRTQPERN-VRRGGYSR  112

Query  540  NALP-GT------------GVSREFRVVRDNRVN  602
             +   GT            G +REFRVVRDNR N
Sbjct  113  GSFSRGTAPRHAFSRNSTAGTNREFRVVRDNRSN  146



>ref|XP_010487182.1| PREDICTED: uncharacterized protein LOC104765203 isoform X1 [Camelina 
sativa]
Length=855

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 84/156 (54%), Gaps = 26/156 (17%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  533
             FHEVKR+RDRKKE          +T      DRK+  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  534  KRNAL-------------PGTGVSREFRVVRDNRVN  602
             RN               P TG +REFRVVRDNR N
Sbjct  111  NRNFFPRNAVQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010487183.1| PREDICTED: uncharacterized protein LOC104765203 isoform X2 [Camelina 
sativa]
Length=854

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 84/156 (54%), Gaps = 26/156 (17%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  533
             FHEVKR+RDRKKE          +T      DRK+  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  534  KRNAL-------------PGTGVSREFRVVRDNRVN  602
             RN               P TG +REFRVVRDNR N
Sbjct  111  NRNFFPRNAVQRNAFPRNPATGSNREFRVVRDNRSN  146



>gb|KEH18456.1| plant/MDC16-11 protein [Medicago truncatula]
Length=1006

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 8/113 (7%)
 Frame = +3

Query  183  MVAGSKFEG----GTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  350
            MV  S+ EG    GT  LS  VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPASRTEGAGGTGTHLLSAKVRKTIQSIKEIVGNHSEADIYVALKETNMDPNETTQKLL  60

Query  351  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHN  509
            +QD FHEVKRRRDRKKE  N    N+ N G  + E R+  +  N   ++++HN
Sbjct  61   NQDPFHEVKRRRDRKKENQNHVNQNVGNRG--SSEPRRHSD--NGGQRAQSHN  109



>ref|XP_010501517.1| PREDICTED: uncharacterized protein LOC104778757 isoform X4 [Camelina 
sativa]
Length=852

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE--ALNVP---KVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
             FHEVKR+RDRKKE   L  P   K  ++N    T E +   +P     +   + N + R
Sbjct  61   PFHEVKRKRDRKKEDTVLVEPADRKKPLENV---TSEVKVHTQPEYNVRRGGYNRNFVPR  117

Query  525  GPYKRNAL---PGTGVSREFRVVRDNRVN  602
               +RNA    P TG +REFRVVRDNR N
Sbjct  118  NAGQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010501523.1| PREDICTED: uncharacterized protein LOC104778757 isoform X5 [Camelina 
sativa]
Length=851

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE--ALNVP---KVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
             FHEVKR+RDRKKE   L  P   K  ++N    T E +   +P     +   + N + R
Sbjct  61   PFHEVKRKRDRKKEDTVLVEPADRKKPLENV---TSEVKVHTQPEYNVRRGGYNRNFVPR  117

Query  525  GPYKRNAL---PGTGVSREFRVVRDNRVN  602
               +RNA    P TG +REFRVVRDNR N
Sbjct  118  NAGQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010501500.1| PREDICTED: uncharacterized protein LOC104778757 isoform X1 [Camelina 
sativa]
Length=852

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE--ALNVP---KVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
             FHEVKR+RDRKKE   L  P   K  ++N    T E +   +P     +   + N + R
Sbjct  61   PFHEVKRKRDRKKEDTVLVEPADRKKPLENV---TSEVKVHTQPEYNVRRGGYNRNFVPR  117

Query  525  GPYKRNAL---PGTGVSREFRVVRDNRVN  602
               +RNA    P TG +REFRVVRDNR N
Sbjct  118  NAGQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010501510.1| PREDICTED: uncharacterized protein LOC104778757 isoform X3 [Camelina 
sativa]
Length=851

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE--ALNVP---KVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
             FHEVKR+RDRKKE   L  P   K  ++N    T E +   +P     +   + N + R
Sbjct  61   PFHEVKRKRDRKKEDTVLVEPADRKKPLENV---TSEVKVHTQPEYNVRRGGYNRNFVPR  117

Query  525  GPYKRNAL---PGTGVSREFRVVRDNRVN  602
               +RNA    P TG +REFRVVRDNR N
Sbjct  118  NAGQRNAFPRNPATGSNREFRVVRDNRSN  146



>ref|XP_010501505.1| PREDICTED: uncharacterized protein LOC104778757 isoform X2 [Camelina 
sativa]
Length=851

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  360  TFHEVKRRRDRKKE--ALNVP---KVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
             FHEVKR+RDRKKE   L  P   K  ++N    T E +   +P     +   + N + R
Sbjct  61   PFHEVKRKRDRKKEDTVLVEPADRKKPLENV---TSEVKVHTQPEYNVRRGGYNRNFVPR  117

Query  525  GPYKRNAL---PGTGVSREFRVVRDNRVN  602
               +RNA    P TG +REFRVVRDNR N
Sbjct  118  NAGQRNAFPRNPATGSNREFRVVRDNRSN  146



>emb|CDX97535.1| BnaA05g25440D [Brassica napus]
Length=863

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 90/165 (55%), Gaps = 35/165 (21%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEA-------------------LNV---PKVNIQNTGYR--TEEDRKEF  470
            FHEVKRRRDRKKE                    +NV   P+ N +  GY       R EF
Sbjct  60   FHEVKRRRDRKKEVAVLVEPADEKKPLESVTSEVNVRTQPEHNARRGGYSRNNTAPRNEF  119

Query  471  EPANLAVKSKTHNNLIRRGPYKRNALP-GTGVSREFRVVRDNRVN  602
             P N A +++            RNA P  TG  REFRVVRDNR N
Sbjct  120  -PRNAAPRNENA--------APRNAFPRATGSKREFRVVRDNRSN  155



>ref|XP_010534929.1| PREDICTED: uncharacterized protein LOC104810364 isoform X1 [Tarenaya 
hassleriana]
Length=836

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 85/154 (55%), Gaps = 29/154 (19%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            M +GS+  G     +  GVR TI+++KE+   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MASGSRTSGNPAAGIDDGVRKTIQSIKEIVGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  360  TFHEVKRRRDRKKE--ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPY  533
             FHEVKRRR+RKKE    + P    +++   T E + + +P             +RRG Y
Sbjct  61   PFHEVKRRRERKKEDAVFDRPVSGEKSSDDVTREVKFQVQP-------------VRRGGY  107

Query  534  KRNALP-------------GTGVSREFRVVRDNR  596
             R+  P               G +REFRVVRDNR
Sbjct  108  SRSYFPRSTAPRNASHRNSTAGTNREFRVVRDNR  141



>ref|XP_009117292.1| PREDICTED: uncharacterized protein LOC103842413 isoform X2 [Brassica 
rapa]
Length=862

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 85/171 (50%), Gaps = 51/171 (30%)
 Frame = +3

Query  237  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-----  401
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE     
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  402  -ALNV----------------PKVNIQNTGYR--------TEED---RKEFEPANLAVKS  497
               NV                P+ N++  GY           +D   RK  E A   VK 
Sbjct  82   EPANVKKPLESVTSEVKVRTQPEHNVRRGGYSRNAFPGNAAPQDAFPRKPLESATSEVKV  141

Query  498  KT---HNNLIRRGPYKRNAL-------------PGTGVSREFRVVRDNRVN  602
            +T   HN  +RRG Y RN               P TG  REFRVVRDNR N
Sbjct  142  RTQSEHN--VRRGGYSRNVFSRNAAPRNAFSRNPATGSKREFRVVRDNRSN  190



>ref|XP_004964933.1| PREDICTED: uncharacterized protein LOC101755132 isoform X1 [Setaria 
italica]
Length=852

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 9/121 (7%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+   
Sbjct  26   IQSTIQSIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESSG-  84

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
             + +  ++    E++ +  +P    ++    NN  RR P +      +G SREFRVVRDN
Sbjct  85   -QKSFADSTAPVEQNPQWMKPHTQRIE----NNDQRRIPNQGQM---SGPSREFRVVRDN  136

Query  594  R  596
            R
Sbjct  137  R  137



>ref|XP_009117284.1| PREDICTED: uncharacterized protein LOC103842413 isoform X1 [Brassica 
rapa]
Length=871

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 85/171 (50%), Gaps = 51/171 (30%)
 Frame = +3

Query  237  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-----  401
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE     
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  402  -ALNV----------------PKVNIQNTGYR--------TEED---RKEFEPANLAVKS  497
               NV                P+ N++  GY           +D   RK  E A   VK 
Sbjct  82   EPANVKKPLESVTSEVKVRTQPEHNVRRGGYSRNAFPGNAAPQDAFPRKPLESATSEVKV  141

Query  498  KT---HNNLIRRGPYKRNAL-------------PGTGVSREFRVVRDNRVN  602
            +T   HN  +RRG Y RN               P TG  REFRVVRDNR N
Sbjct  142  RTQSEHN--VRRGGYSRNVFSRNAAPRNAFSRNPATGSKREFRVVRDNRSN  190



>ref|XP_004964934.1| PREDICTED: uncharacterized protein LOC101755132 isoform X2 [Setaria 
italica]
Length=847

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 9/121 (7%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+   
Sbjct  26   IQSTIQSIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESSG-  84

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
             + +  ++    E++ +  +P    ++    NN  RR P +      +G SREFRVVRDN
Sbjct  85   -QKSFADSTAPVEQNPQWMKPHTQRIE----NNDQRRIPNQGQM---SGPSREFRVVRDN  136

Query  594  R  596
            R
Sbjct  137  R  137



>ref|XP_002885002.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61261.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
Length=852

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 84/159 (53%), Gaps = 31/159 (19%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS+  G     L    +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDESKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIHQD  60

Query  360  TFHEVKRRRDRKKEA-LNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  527
             FHEVKR+RDRKKE  + V   N+          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEGTVFVEPANV----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  528  PYKRNAL--------------PGTGVSREFRVVRDNRVN  602
             Y RN                P  G +REFRVVRDNR N
Sbjct  109  GYSRNFFPRNAAAQRNASPRNPAAGSNREFRVVRDNRSN  147



>emb|CDO97864.1| unnamed protein product [Coffea canephora]
Length=849

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 69/146 (47%), Positives = 96/146 (66%), Gaps = 18/146 (12%)
 Frame = +3

Query  183  MVAGSKFEGG--TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV+G++ +GG  TQ +S G+  TI+++KE+   H++ DIYA LKE+NMDPN+  QKL +Q
Sbjct  1    MVSGARIDGGGTTQIVSAGLMKTIQSIKEIVGNHTDGDIYAALKETNMDPNDAAQKLLNQ  60

Query  357  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTHNNL-IRR  524
            D FHEVKR++D+KKE          N GYR+    E ++  E    AVK  T+++  +RR
Sbjct  61   DPFHEVKRKKDKKKE----------NPGYRSSAAAEPKRYLEHGGQAVKLNTYSDRNMRR  110

Query  525  GPYKRNALPGTGVSREFRVVRDNRVN  602
              + RN    +G SREFRVVRDNRVN
Sbjct  111  LTHVRNT--SSGFSREFRVVRDNRVN  134



>emb|CDY33258.1| BnaC01g37310D [Brassica napus]
Length=871

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 84/171 (49%), Gaps = 51/171 (30%)
 Frame = +3

Query  237  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK------  398
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKK      
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  399  EALNV----------------PKVNIQNTGY-----------RTEEDRKEFEPANLAVKS  497
            E  NV                P+ N++  GY           +    RK  E A   VK 
Sbjct  82   EPANVKKPLESATSEVKVRTQPEHNVRRGGYSRNIFPRNAAPQNAFPRKPLESATSEVKV  141

Query  498  KT---HNNLIRRGPYKRNAL-------------PGTGVSREFRVVRDNRVN  602
            +T   HN  +RRG Y RN               P TG  REFRVVRDNR N
Sbjct  142  RTQSEHN--VRRGGYSRNVFSRNAAPRNAFARNPATGSKREFRVVRDNRSN  190



>ref|XP_011035692.1| PREDICTED: uncharacterized protein LOC105133406 isoform X1 [Populus 
euphratica]
Length=849

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +3

Query  213  TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDR  392
            T  LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+R++
Sbjct  23   THTLSAKVRKTIQSIKEIVGNFSDADIYMVLKETNMDPNETAQKLLNQDPFHEVKRKREK  82

Query  393  KKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYKRNALPGT-GV  563
            KKE          NT YR   D RK  E     ++  T ++   +RG Y R A PG  G+
Sbjct  83   KKE----------NTSYRGSVDSRKHSENFGQGMRPHTFSDRNAQRGGYTRTASPGNRGI  132

Query  564  SREFRVVRDNRVN  602
            +REFRVVRDNRVN
Sbjct  133  NREFRVVRDNRVN  145



>ref|XP_011035693.1| PREDICTED: uncharacterized protein LOC105133406 isoform X2 [Populus 
euphratica]
Length=848

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +3

Query  213  TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDR  392
            T  LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+R++
Sbjct  23   THTLSAKVRKTIQSIKEIVGNFSDADIYMVLKETNMDPNETAQKLLNQDPFHEVKRKREK  82

Query  393  KKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYKRNALPGT-GV  563
            KKE          NT YR   D RK  E     ++  T ++   +RG Y R A PG  G+
Sbjct  83   KKE----------NTSYRGSVDSRKHSENFGQGMRPHTFSDRNAQRGGYTRTASPGNRGI  132

Query  564  SREFRVVRDNRVN  602
            +REFRVVRDNRVN
Sbjct  133  NREFRVVRDNRVN  145



>ref|XP_002299597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE84402.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=854

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +3

Query  213  TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDR  392
            T  LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+R++
Sbjct  24   THTLSAKVRKTIQSIKEIVGNFSDADIYMVLKETNMDPNETAQKLLNQDPFHEVKRKREK  83

Query  393  KKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYKRNALPGT-GV  563
            KKE          NT YR   D RK  E     ++  T ++   +RG Y R A PG  G+
Sbjct  84   KKE----------NTSYRGSVDSRKHSENFGQGMRPHTFSDRNAQRGGYTRTASPGNRGI  133

Query  564  SREFRVVRDNRVN  602
            +REFRVVRDNRVN
Sbjct  134  NREFRVVRDNRVN  146



>ref|XP_010932458.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Elaeis guineensis]
Length=887

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 69/169 (41%), Positives = 90/169 (53%), Gaps = 42/169 (25%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ--  356
            MV GS+ +GG+Q +S  +R TI+++KE+   HS++DIYA L+E+NMDPNET Q L +Q  
Sbjct  1    MVLGSRLDGGSQIVSVRIRKTIQSIKEIVGDHSDSDIYAMLQETNMDPNETAQNLLNQVG  60

Query  357  ------------------------DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRK  464
                                      FHEVKRRRD++KE          +TGY    D K
Sbjct  61   IHAAPQCYNIASEYDDSCENAILLGPFHEVKRRRDKRKE----------HTGYGGSGDTK  110

Query  465  EFEPANLA-VKSKTH--NNLIRRGPYKRNALPGTGVSREFRVVRDNRVN  602
            +    N+   KS T    N  R G   +   P  G+SREFRVVRDNRVN
Sbjct  111  KGVEHNVQWTKSHTSWDQNTQRDGFTGK---PAPGISREFRVVRDNRVN  156



>emb|CDY39087.1| BnaA01g29690D [Brassica napus]
Length=873

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 84/171 (49%), Gaps = 51/171 (30%)
 Frame = +3

Query  237  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-----  401
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE     
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  402  -ALNV----------------PKVNIQNTGYR--------TEED---RKEFEPANLAVKS  497
               NV                P+ N++  GY           +D   RK  E     V+ 
Sbjct  82   EPANVKKPLESVTSEVKIRTQPEHNVRRGGYSRNAFPRNAAPQDAFPRKPLESVTSEVRV  141

Query  498  KT---HNNLIRRGPYKRNAL-------------PGTGVSREFRVVRDNRVN  602
            +T   HN  +RRG Y RN               P TG  REFRVVRDNR N
Sbjct  142  RTQPEHN--VRRGGYSRNVFSRNAAPRNAFSRNPATGSKREFRVVRDNRSN  190



>gb|AFW85392.1| putative DUF1296 domain containing family protein [Zea mays]
Length=830

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P       K  N+  +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHT----QKMEND--QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>ref|XP_008658956.1| PREDICTED: uncharacterized protein LOC100501220 isoform X1 [Zea 
mays]
Length=853

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P    +++       +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHTQKMEND------QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>ref|XP_008658959.1| PREDICTED: uncharacterized protein LOC100501220 isoform X4 [Zea 
mays]
Length=851

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P    +++       +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHTQKMEND------QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>ref|XP_008658957.1| PREDICTED: uncharacterized protein LOC100501220 isoform X2 [Zea 
mays]
 gb|AFW85391.1| putative DUF1296 domain containing family protein [Zea mays]
Length=852

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P    +++       +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHTQKMEND------QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>ref|XP_008658958.1| PREDICTED: uncharacterized protein LOC100501220 isoform X3 [Zea 
mays]
Length=852

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P    +++       +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHTQKMEND------QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>ref|XP_010227878.1| PREDICTED: uncharacterized protein LOC100833454 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = +3

Query  225  SPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  404
            +P +  TI+++KEV  GHS+ADIY  L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+
Sbjct  21   APTIHSTIQSIKEVVGGHSDADIYDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRES  80

Query  405  LNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVV  584
                  ++     + +   +  +P    V      N  RR  Y +      G SREFRVV
Sbjct  81   AG--HKSVAEAATQVDNSSQRMKPHTQKV-----GNDQRRA-YNQGQT--YGPSREFRVV  130

Query  585  RDNR  596
            RDNR
Sbjct  131  RDNR  134



>ref|XP_010227879.1| PREDICTED: uncharacterized protein LOC100833454 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = +3

Query  225  SPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  404
            +P +  TI+++KEV  GHS+ADIY  L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+
Sbjct  21   APTIHSTIQSIKEVVGGHSDADIYDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRES  80

Query  405  LNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVV  584
                  ++     + +   +  +P    V      N  RR  Y +      G SREFRVV
Sbjct  81   AG--HKSVAEAATQVDNSSQRMKPHTQKV-----GNDQRRA-YNQGQT--YGPSREFRVV  130

Query  585  RDNR  596
            RDNR
Sbjct  131  RDNR  134



>gb|AFW85393.1| putative DUF1296 domain containing family protein [Zea mays]
Length=625

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P    +++       +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHTQKMEND------QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>gb|AAT08008.1| unknown [Zea mays]
 gb|AFW85394.1| putative DUF1296 domain containing family protein [Zea mays]
Length=942

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+  
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG  84

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRD  590
              + +  ++  + E++ +  +P       K  N+  +R P K+  +  +G +REFRVVRD
Sbjct  85   --QKSFADSTAQVEQNSQWMKPHT----QKMEND--QRTP-KQGQM--SGPTREFRVVRD  133

Query  591  NR  596
            NR
Sbjct  134  NR  135



>gb|EEE65290.1| hypothetical protein OsJ_20522 [Oryza sativa Japonica Group]
Length=861

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAG-  80

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
             +  + +   + E + +  +P    V++         G    N     G +REFRVVRD+
Sbjct  81   -QKTVPDASAQAEHNSQWTKPRTQRVEND-QRRAYSHGQASGNTAESHGPNREFRVVRDS  138

Query  594  R  596
            R
Sbjct  139  R  139



>gb|EEC80202.1| hypothetical protein OsI_22088 [Oryza sativa Indica Group]
Length=861

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAG-  80

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
             +  + +   + E + +  +P    V++         G    N     G +REFRVVRD+
Sbjct  81   -QKTVPDASAQAEHNSQWTKPRTQRVEND-QRRAYSHGQASGNTAESHGPNREFRVVRDS  138

Query  594  R  596
            R
Sbjct  139  R  139



>ref|NP_001057094.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAD35846.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAD36202.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF19008.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAH00409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=854

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 77/121 (64%), Gaps = 10/121 (8%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAG-  80

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
             +  + +   + E + +  +P    V+     N  RR  Y       +G +REFRVVRD+
Sbjct  81   -QKTVPDASAQAEHNSQWTKPRTQRVE-----NDQRRA-YSHGQ--ASGPNREFRVVRDS  131

Query  594  R  596
            R
Sbjct  132  R  132



>ref|XP_008648067.1| PREDICTED: uncharacterized protein LOC100382099 isoform X1 [Zea 
mays]
 gb|AFW76656.1| putative DUF1296 domain containing family protein [Zea mays]
Length=858

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 14/123 (11%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+   
Sbjct  31   IQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAGQ  90

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTH--NNLIRRGPYKRNALPGTGVSREFRVVR  587
             K    +TG + +++ +   P        TH   N  RR P +      +G S EFRVVR
Sbjct  91   -KSFADSTG-QVDQNPQWMRP-------HTHRMENDQRRLPNQGQM---SGPSHEFRVVR  138

Query  588  DNR  596
            DNR
Sbjct  139  DNR  141



>ref|NP_001168331.1| uncharacterized protein LOC100382099 [Zea mays]
 gb|ACN27843.1| unknown [Zea mays]
Length=857

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 14/123 (11%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+   
Sbjct  31   IQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAGQ  90

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAVKSKTH--NNLIRRGPYKRNALPGTGVSREFRVVR  587
             K    +TG + +++ +   P        TH   N  RR P +      +G S EFRVVR
Sbjct  91   -KSFADSTG-QVDQNPQWMRP-------HTHRMENDQRRLPNQGQM---SGPSHEFRVVR  138

Query  588  DNR  596
            DNR
Sbjct  139  DNR  141



>ref|XP_002436662.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
 gb|EER88029.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
Length=859

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 10/115 (9%)
 Frame = +3

Query  252  TLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNVPKVNIQ  431
            ++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+    + +  
Sbjct  37   SIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG--QKSFA  94

Query  432  NTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDNR  596
            ++  + E+  +  +P      ++   N  RR P   N    +G SREFRVVRDNR
Sbjct  95   DSTAQVEQSSQWMKP-----HTQRMENDQRRTP---NQGQNSGPSREFRVVRDNR  141



>ref|XP_009146426.1| PREDICTED: uncharacterized protein LOC103870075 isoform X4 [Brassica 
rapa]
Length=892

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 92/196 (47%), Gaps = 58/196 (30%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEA-------------------LNV---PKVNIQNTGY-----------  443
            FH VKRRRDRKKE                    +NV   P+ N +  GY           
Sbjct  60   FHVVKRRRDRKKEVAVLVEPADEKKPLESVTSEVNVRTQPEHNARRGGYSRNVFPRNAAP  119

Query  444  ---------------RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNAL--------PG  554
                           R    R EF P N A + +   N   R  + RNA         P 
Sbjct  120  RDDFHRNTAPRNELPRNAAPRNEF-PRNAAQQHEFPGNPAPRNAFLRNAAPRNAFPRNPA  178

Query  555  TGVSREFRVVRDNRVN  602
            TG  +EFRVVRDNR N
Sbjct  179  TGSKKEFRVVRDNRSN  194



>gb|AAL68853.1|AF466199_12 gb protein [Sorghum bicolor]
Length=1009

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 10/115 (9%)
 Frame = +3

Query  252  TLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNVPKVNIQ  431
            ++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+    + +  
Sbjct  37   SIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKESAG--QKSFA  94

Query  432  NTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDNR  596
            ++  + E+  +  +P      ++   N  RR P   N    +G SREFRVVRDNR
Sbjct  95   DSTAQVEQSSQWMKP-----HTQRMENDQRRTP---NQGQNSGPSREFRVVRDNR  141



>ref|XP_009146425.1| PREDICTED: uncharacterized protein LOC103870075 isoform X3 [Brassica 
rapa]
Length=902

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 92/196 (47%), Gaps = 58/196 (30%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEA-------------------LNV---PKVNIQNTGY-----------  443
            FH VKRRRDRKKE                    +NV   P+ N +  GY           
Sbjct  60   FHVVKRRRDRKKEVAVLVEPADEKKPLESVTSEVNVRTQPEHNARRGGYSRNVFPRNAAP  119

Query  444  ---------------RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNAL--------PG  554
                           R    R EF P N A + +   N   R  + RNA         P 
Sbjct  120  RDDFHRNTAPRNELPRNAAPRNEF-PRNAAQQHEFPGNPAPRNAFLRNAAPRNAFPRNPA  178

Query  555  TGVSREFRVVRDNRVN  602
            TG  +EFRVVRDNR N
Sbjct  179  TGSKKEFRVVRDNRSN  194



>ref|XP_009146424.1| PREDICTED: uncharacterized protein LOC103870075 isoform X2 [Brassica 
rapa]
Length=902

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 92/196 (47%), Gaps = 58/196 (30%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEA-------------------LNV---PKVNIQNTGY-----------  443
            FH VKRRRDRKKE                    +NV   P+ N +  GY           
Sbjct  60   FHVVKRRRDRKKEVAVLVEPADEKKPLESVTSEVNVRTQPEHNARRGGYSRNVFPRNAAP  119

Query  444  ---------------RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNAL--------PG  554
                           R    R EF P N A + +   N   R  + RNA         P 
Sbjct  120  RDDFHRNTAPRNELPRNAAPRNEF-PRNAAQQHEFPGNPAPRNAFLRNAAPRNAFPRNPA  178

Query  555  TGVSREFRVVRDNRVN  602
            TG  +EFRVVRDNR N
Sbjct  179  TGSKKEFRVVRDNRSN  194



>ref|XP_009146423.1| PREDICTED: uncharacterized protein LOC103870075 isoform X1 [Brassica 
rapa]
Length=903

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 92/196 (47%), Gaps = 58/196 (30%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEA-------------------LNV---PKVNIQNTGY-----------  443
            FH VKRRRDRKKE                    +NV   P+ N +  GY           
Sbjct  60   FHVVKRRRDRKKEVAVLVEPADEKKPLESVTSEVNVRTQPEHNARRGGYSRNVFPRNAAP  119

Query  444  ---------------RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNAL--------PG  554
                           R    R EF P N A + +   N   R  + RNA         P 
Sbjct  120  RDDFHRNTAPRNELPRNAAPRNEF-PRNAAQQHEFPGNPAPRNAFLRNAAPRNAFPRNPA  178

Query  555  TGVSREFRVVRDNRVN  602
            TG  +EFRVVRDNR N
Sbjct  179  TGSKKEFRVVRDNRSN  194



>dbj|BAK02193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=876

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 74/126 (59%), Gaps = 16/126 (13%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            +  T++++KEV  GHSEADI   L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  24   IDSTVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRESAV-  82

Query  414  PKVNIQNTGYRTEEDRKEFEPANLAV---KSKTHNNLIRRGPYKRNALPGTGVSREFRVV  584
             + N   T  + E   +  +P    V   + + HN     GP           +REFRVV
Sbjct  83   -QKNCTETTAQGEHGTQRTKPHTQRVEIDQRRAHNQGQTYGP-----------TREFRVV  130

Query  585  RDNRVN  602
            RDNR N
Sbjct  131  RDNRHN  136



>emb|CDY65326.1| BnaCnng46620D [Brassica napus]
Length=851

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 84/155 (54%), Gaps = 27/155 (17%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  362
            MV+GS+  GG + +    R  IE+++E+   H++ADI+A LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDEERKLIESIREIVGNHTDADIHAALKEADMNADEAVQKLIHQDP  59

Query  363  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  533
            FHEVKRRRDRKKE   +             +++K  E     V  +T   HN   RRG +
Sbjct  60   FHEVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGH  108

Query  534  KR---------NALPGTGVS---REFRVVRDNRVN  602
             R         N  PG       REFRVVRDNR N
Sbjct  109  SRNFPRNAAQQNEFPGNPAPRSKREFRVVRDNRSN  143



>ref|XP_002445374.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
 gb|EES14869.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
Length=70

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTFHEVKRKR  63

Query  387  DRKKE  401
            D+KKE
Sbjct  64   DKKKE  68



>ref|XP_010654472.1| PREDICTED: uncharacterized protein LOC100248075 isoform X5 [Vitis 
vinifera]
Length=816

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 25/108 (23%)
 Frame = +3

Query  303  LKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEED  458
            L+E NMDPNE  QKL +QD FHEVKR+RD+KKE+        P++ I+N G   +R+  D
Sbjct  2    LREMNMDPNEVAQKLLNQDPFHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPD  61

Query  459  RKEFEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDNRVN  602
            R                  +RRG Y R+ +P  G+ REFRVVRDNRVN
Sbjct  62   RN-----------------VRRGGYSRSTVPDAGIGREFRVVRDNRVN  92



>ref|XP_006656745.1| PREDICTED: uncharacterized protein LOC102709938, partial [Oryza 
brachyantha]
Length=1028

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 78/124 (63%), Gaps = 15/124 (12%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
             ++ TI+++KEV  GHS+ADIYA L+E  MDPNET Q+L +QD FHEVKR+RD+K+E+  
Sbjct  4    AIQSTIQSIKEVVGGHSDADIYAALRECGMDPNETTQRLLNQDPFHEVKRKRDKKRESAG  63

Query  411  VPKVNIQNTGYRTEEDRKEFEPANLAVKS--KTHNNLIRRGPYKRNALPGTGVSREFRVV  584
              + NI +   + E   +  +P    V++  +T+++    GP           +REFRVV
Sbjct  64   --QKNIADASAQVEHSSQWTKPRTQRVENDQRTYSHGHASGP-----------NREFRVV  110

Query  585  RDNR  596
            RDNR
Sbjct  111  RDNR  114



>gb|AES98495.2| MLP3.11 protein [Medicago truncatula]
Length=868

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  186  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  365
            ++GS F+    N    V+ TI+ +KE+   HS+ DIYA LKE +MDPNET QKL  QDTF
Sbjct  1    MSGSGFKASIPN---SVKKTIQNIKEITGNHSDEDIYAMLKECSMDPNETTQKLLLQDTF  57

Query  366  HEVKRRRDRKKEALN  410
            HEVKR++DRKKE LN
Sbjct  58   HEVKRKKDRKKEILN  72



>ref|XP_003615537.1| hypothetical protein MTR_5g069290 [Medicago truncatula]
Length=924

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  186  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  365
            ++GS F+    N    V+ TI+ +KE+   HS+ DIYA LKE +MDPNET QKL  QDTF
Sbjct  1    MSGSGFKASIPN---SVKKTIQNIKEITGNHSDEDIYAMLKECSMDPNETTQKLLLQDTF  57

Query  366  HEVKRRRDRKKEALN  410
            HEVKR++DRKKE LN
Sbjct  58   HEVKRKKDRKKEILN  72



>ref|XP_010088349.1| hypothetical protein L484_004857 [Morus notabilis]
 gb|EXB34467.1| hypothetical protein L484_004857 [Morus notabilis]
Length=651

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ LKE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR+KE +N
Sbjct  14   VRKTIQNLKEIAGNHSDDEIYAMLKECSMDPNETAQKLLLQDTFHEVKRKRDRRKENVN  72



>ref|XP_009765586.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=500

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_009610071.1| PREDICTED: uncharacterized protein LOC104103838 isoform X4 [Nicotiana 
tomentosiformis]
Length=888

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_009610070.1| PREDICTED: uncharacterized protein LOC104103838 isoform X3 [Nicotiana 
tomentosiformis]
Length=889

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_009610068.1| PREDICTED: uncharacterized protein LOC104103838 isoform X1 [Nicotiana 
tomentosiformis]
Length=893

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>gb|EPS69701.1| hypothetical protein M569_05071, partial [Genlisea aurea]
Length=120

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  159  LLRSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEV-AKGHSEADIYATLKESNMDPNET  335
            L R    +M +G K      ++  GV+ TIE +KE+    HSE +IYA LKE  MDPNET
Sbjct  5    LFRGLLKKMNSGVKGSTTRVSIPIGVKKTIENIKEITGNNHSEDEIYAMLKECAMDPNET  64

Query  336  FQKLYHQDTFHEVKRRRDRKKEALN  410
              KL H DTFHEVKR+RDRKKE  N
Sbjct  65   TDKLLHLDTFHEVKRKRDRKKENPN  89



>ref|XP_009610069.1| PREDICTED: uncharacterized protein LOC104103838 isoform X2 [Nicotiana 
tomentosiformis]
Length=892

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_008678496.1| PREDICTED: uncharacterized protein LOC103653346 isoform X3 [Zea 
mays]
Length=774

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>gb|AGT17314.1| Protein of unknown function DUF1296 [Saccharum hybrid cultivar 
R570]
Length=798

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +3

Query  180  EMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            EM AG +F     ++  G R T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +D
Sbjct  4    EMAAGGRF-----SIPAGARRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLED  58

Query  360  TFHEVKRRRDRKKEALNVP  416
            TFHEVKR+RD+KKE    P
Sbjct  59   TFHEVKRKRDKKKEGSKEP  77



>ref|XP_009589264.1| PREDICTED: protein PRRC2B-like isoform X6 [Nicotiana tomentosiformis]
Length=887

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009589260.1| PREDICTED: uncharacterized protein LOC104086650 isoform X2 [Nicotiana 
tomentosiformis]
Length=907

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009589263.1| PREDICTED: protein PRRC2B-like isoform X5 [Nicotiana tomentosiformis]
Length=889

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009589259.1| PREDICTED: protein PRRC2B-like isoform X1 [Nicotiana tomentosiformis]
Length=908

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009589262.1| PREDICTED: uncharacterized protein LOC104086650 isoform X4 [Nicotiana 
tomentosiformis]
Length=900

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_008678497.1| PREDICTED: uncharacterized protein LOC103653346 isoform X4 [Zea 
mays]
Length=756

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_004490553.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=882

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ ++E+   HS+ DIYA LKE +MDPNET QKL  QDTFHEVKR+RDR+KE LN
Sbjct  15   VRKTIQNIREITGNHSDEDIYAMLKECSMDPNETAQKLLLQDTFHEVKRKRDRRKENLN  73



>ref|XP_004973209.1| PREDICTED: flocculation protein FLO11-like [Setaria italica]
Length=829

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  GVR T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGVRRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEGSKEP  73



>ref|XP_008678494.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Zea mays]
Length=806

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_008678495.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Zea mays]
Length=788

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>gb|AFW61911.1| putative DUF1296 domain containing family protein [Zea mays]
Length=745

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>emb|CAN69467.1| hypothetical protein VITISV_042554 [Vitis vinifera]
Length=108

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD-  359
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +Q  
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQGY  60

Query  360  TFHE  371
            +F E
Sbjct  61   SFFE  64



>gb|AFW61910.1| putative DUF1296 domain containing family protein [Zea mays]
Length=769

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_009589261.1| PREDICTED: protein PRRC2B-like isoform X3 [Nicotiana tomentosiformis]
Length=902

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKE  80



>ref|XP_007214926.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
 gb|EMJ16125.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
Length=873

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_008678498.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X5 [Zea mays]
Length=738

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  387  DRKKEALNVP  416
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>gb|EMT03241.1| hypothetical protein F775_28234 [Aegilops tauschii]
Length=859

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  228  PGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  404
            P +  TI+++KEV  GHSE DIY  L+ESNMDPNET Q+L +QD FHEV+R+RD+KKE+
Sbjct  24   PAIDSTIKSIKEVVGGHSEDDIYDALRESNMDPNETAQRLLNQDPFHEVRRKRDKKKES  82



>ref|XP_004502111.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=874

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            GVR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QDTFHEVKR++D++KE +N
Sbjct  13   GVRKTIQNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKKDKRKENVN  72



>ref|XP_002301574.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
 gb|EEE80847.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
Length=886

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL +QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLYQDPFHEVKRK  63

Query  384  RDRKKEALN  410
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>ref|XP_006392705.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
 gb|ESQ29991.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
Length=831

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 81/157 (52%), Gaps = 28/157 (18%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS   G     +    R TI ++KE+   HS+ADI+A LKE+NMD +E  Q+L +QD
Sbjct  1    MVTGSGTGGSFASGIDENTRKTIRSIKEIVGNHSDADIFAALKETNMDADEAVQRLIYQD  60

Query  360  TFHEVKRRR-------------DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSK  500
             FHEVKR+R             +R+K + N+           + E   + +P + A +  
Sbjct  61   PFHEVKRKREKKKEETTSVELAERRKPSENI-----------SREGNFQTQPEHSARRGD  109

Query  501  THNNLIRRGPYKRNAL---PGTGVSREFRVVRDNRVN  602
             + N   R    RNA+   P  G SREFRVVRDNR N
Sbjct  110  YNQNSFPRNAAPRNAVPKNPAAGPSREFRVVRDNRSN  146



>ref|XP_006392706.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
 gb|ESQ29992.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
Length=832

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 81/157 (52%), Gaps = 28/157 (18%)
 Frame = +3

Query  183  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            MV GS   G     +    R TI ++KE+   HS+ADI+A LKE+NMD +E  Q+L +QD
Sbjct  1    MVTGSGTGGSFASGIDENTRKTIRSIKEIVGNHSDADIFAALKETNMDADEAVQRLIYQD  60

Query  360  TFHEVKRRR-------------DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSK  500
             FHEVKR+R             +R+K + N+           + E   + +P + A +  
Sbjct  61   PFHEVKRKREKKKEETTSVELAERRKPSENI-----------SREGNFQTQPEHSARRGD  109

Query  501  THNNLIRRGPYKRNAL---PGTGVSREFRVVRDNRVN  602
             + N   R    RNA+   P  G SREFRVVRDNR N
Sbjct  110  YNQNSFPRNAAPRNAVPKNPAAGPSREFRVVRDNRSN  146



>ref|XP_003544279.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=878

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE DIYA LKE +MDPNET QKL  QDTFHEVKR++
Sbjct  5    GFRASIPSSVRRTIQNIKEITGNHSEEDIYAMLKECSMDPNETTQKLLLQDTFHEVKRKK  64

Query  387  DRKKEALN  410
            DR+KE LN
Sbjct  65   DRRKENLN  72



>gb|KHN46209.1| hypothetical protein glysoja_039933 [Glycine soja]
Length=884

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE D+YA LKE +MDPNET QKL  QDTFHEVKR++
Sbjct  5    GFRASIPSSVRRTIQNIKEITGNHSEEDVYAMLKECSMDPNETTQKLLLQDTFHEVKRKK  64

Query  387  DRKKEALN  410
            DR+KE LN
Sbjct  65   DRRKENLN  72



>ref|XP_011007010.1| PREDICTED: uncharacterized protein LOC105112841 isoform X1 [Populus 
euphratica]
Length=893

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRK  63

Query  384  RDRKKEALN  410
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>ref|XP_011007012.1| PREDICTED: uncharacterized protein LOC105112841 isoform X2 [Populus 
euphratica]
Length=888

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRK  63

Query  384  RDRKKEALN  410
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>ref|XP_011100583.1| PREDICTED: uncharacterized protein LOC105178745 [Sesamum indicum]
Length=885

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPGVRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQD  359
            M +G K      ++  GV+ TIE +KE+  + HSE +IYA LKE +MDPNET QKL   D
Sbjct  1    MSSGVKGGASRVSIPSGVKKTIEDIKEITGQNHSEDEIYAMLKECSMDPNETTQKLLLLD  60

Query  360  TFHEVKRRRDRKKEALN  410
            TFHEVKR+RDR+KE LN
Sbjct  61   TFHEVKRKRDRRKENLN  77



>ref|XP_006575395.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=884

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE D+YA LKE +MDPNET QKL  QDTFHEVKR++
Sbjct  5    GFRASIPSSVRRTIQNIKEITGNHSEEDVYAMLKECSMDPNETTQKLLLQDTFHEVKRKK  64

Query  387  DRKKEALN  410
            DR+KE LN
Sbjct  65   DRRKENLN  72



>ref|XP_009407930.1| PREDICTED: uncharacterized protein LOC103990491 [Musa acuminata 
subsp. malaccensis]
Length=895

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  204  EGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            +G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+
Sbjct  4    DGSRVSIPAGVRPTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRK  63

Query  384  RDRKKEALNVP  416
            RDR+KE +  P
Sbjct  64   RDRRKENVREP  74



>ref|XP_009391914.1| PREDICTED: uncharacterized protein LOC103977959 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=894

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+R
Sbjct  5    GARVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKR  64

Query  387  DRKKEALNVP  416
            D++KE +  P
Sbjct  65   DKRKETVREP  74



>ref|XP_009391913.1| PREDICTED: uncharacterized protein LOC103977959 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=895

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+R
Sbjct  5    GARVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKR  64

Query  387  DRKKEALNVP  416
            D++KE +  P
Sbjct  65   DKRKETVREP  74



>ref|XP_010252822.1| PREDICTED: uncharacterized protein LOC104594285 isoform X3 [Nelumbo 
nucifera]
Length=910

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG++   P  VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+
Sbjct  3    GGSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRK  62

Query  384  RDRKKEALN  410
            RD++KE +N
Sbjct  63   RDKRKENVN  71



>ref|XP_010252820.1| PREDICTED: uncharacterized protein LOC104594285 isoform X1 [Nelumbo 
nucifera]
Length=913

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG++   P  VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+
Sbjct  3    GGSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRK  62

Query  384  RDRKKEALN  410
            RD++KE +N
Sbjct  63   RDKRKENVN  71



>ref|XP_010252821.1| PREDICTED: uncharacterized protein LOC104594285 isoform X2 [Nelumbo 
nucifera]
Length=912

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG++   P  VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+
Sbjct  3    GGSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRK  62

Query  384  RDRKKEALN  410
            RD++KE +N
Sbjct  63   RDKRKENVN  71



>ref|XP_010323918.1| PREDICTED: melanoma-associated antigen C1 isoform X2 [Solanum 
lycopersicum]
Length=875

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323917.1| PREDICTED: melanoma-associated antigen C1 isoform X1 [Solanum 
lycopersicum]
Length=876

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323919.1| PREDICTED: melanoma-associated antigen C1 isoform X3 [Solanum 
lycopersicum]
Length=874

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323920.1| PREDICTED: melanoma-associated antigen C1 isoform X4 [Solanum 
lycopersicum]
Length=871

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  401
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010252823.1| PREDICTED: uncharacterized protein LOC104594285 isoform X4 [Nelumbo 
nucifera]
Length=858

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  207  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG++   P  VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+
Sbjct  3    GGSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRK  62

Query  384  RDRKKEALN  410
            RD++KE +N
Sbjct  63   RDKRKENVN  71



>emb|CDP14411.1| unnamed protein product [Coffea canephora]
Length=867

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR  I+++KE+   HSE DIYA LKE +MDPNET QKL  QDTFHEV+R+RDRKK
Sbjct  22   SIPSNVRKIIQSIKEITGNHSEEDIYAMLKECSMDPNETTQKLLLQDTFHEVRRKRDRKK  81

Query  399  EALN  410
            E LN
Sbjct  82   ENLN  85



>ref|XP_009782968.1| PREDICTED: uncharacterized protein LOC104231636 isoform X4 [Nicotiana 
sylvestris]
Length=877

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+R
Sbjct  16   GARVSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKR  75

Query  387  DRKKEALNVPK  419
            DRKKE  N  K
Sbjct  76   DRKKELQNSIK  86



>ref|XP_009782965.1| PREDICTED: uncharacterized protein LOC104231636 isoform X1 [Nicotiana 
sylvestris]
Length=885

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+R
Sbjct  16   GARVSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKR  75

Query  387  DRKKEALNVPK  419
            DRKKE  N  K
Sbjct  76   DRKKELQNSIK  86



>ref|XP_009782966.1| PREDICTED: uncharacterized protein LOC104231636 isoform X2 [Nicotiana 
sylvestris]
Length=884

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+R
Sbjct  16   GARVSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKR  75

Query  387  DRKKEALNVPK  419
            DRKKE  N  K
Sbjct  76   DRKKELQNSIK  86



>ref|XP_008229781.1| PREDICTED: cell wall protein AWA1 isoform X1 [Prunus mume]
Length=875

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_008229782.1| PREDICTED: putative GPI-anchored protein PB15E9.01c isoform X2 
[Prunus mume]
Length=874

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_006857739.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
 gb|ERN19206.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
Length=909

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  186  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  365
            ++G     G  ++   VR  I+ +KE+A  H + +IYA LKE NMDPNET QKL  QDTF
Sbjct  1    MSGGLHHSGGASIPSSVRKMIQNIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTF  60

Query  366  HEVKRRRDRKKEALN  410
            HEV+R+RD++KE LN
Sbjct  61   HEVRRKRDKRKENLN  75



>ref|XP_008342251.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X1 [Malus 
domestica]
Length=866

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            GVR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  13   GVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_008342252.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            GVR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  13   GVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_009782967.1| PREDICTED: uncharacterized protein LOC104231636 isoform X3 [Nicotiana 
sylvestris]
Length=879

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+R
Sbjct  16   GARVSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKR  75

Query  387  DRKKE  401
            DRKKE
Sbjct  76   DRKKE  80



>ref|XP_010676081.1| PREDICTED: uncharacterized protein LOC104891984 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=562

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  407
            VR TI+ +KE+   HSE DIYA LK+ +MDPNET Q+L H DTFHEVKR+R ++KE +
Sbjct  29   VRKTIQHIKEITSNHSEDDIYAMLKDCSMDPNETTQRLLHLDTFHEVKRKRVKRKETV  86



>ref|XP_009412058.1| PREDICTED: uncharacterized protein LOC103993639 [Musa acuminata 
subsp. malaccensis]
Length=890

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++  GVR TI+ +KE+A  HS+ +IYA LK+  MDPNET QKL  QDTFHEV+R+R
Sbjct  5    GSRVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKDCGMDPNETAQKLLLQDTFHEVRRKR  64

Query  387  DRKKEALNVP  416
            D++KE +  P
Sbjct  65   DKRKENVRDP  74



>ref|XP_010245040.1| PREDICTED: uncharacterized protein LOC104588700 isoform X1 [Nelumbo 
nucifera]
Length=952

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  5    GSRVSIPNSVRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKR  64

Query  387  DRKKEALN  410
            D++KE +N
Sbjct  65   DKRKENMN  72



>ref|XP_009396030.1| PREDICTED: uncharacterized protein LOC103981123 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=780

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  387  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_010245043.1| PREDICTED: uncharacterized protein LOC104588700 isoform X4 [Nelumbo 
nucifera]
Length=897

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  5    GSRVSIPNSVRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKR  64

Query  387  DRKKEALN  410
            D++KE +N
Sbjct  65   DKRKENMN  72



>ref|XP_010245041.1| PREDICTED: uncharacterized protein LOC104588700 isoform X2 [Nelumbo 
nucifera]
Length=922

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  5    GSRVSIPNSVRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKR  64

Query  387  DRKKEALN  410
            D++KE +N
Sbjct  65   DKRKENMN  72



>ref|XP_010676080.1| PREDICTED: uncharacterized protein LOC104891984 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=716

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  407
            VR TI+ +KE+   HSE DIYA LK+ +MDPNET Q+L H DTFHEVKR+R ++KE +
Sbjct  29   VRKTIQHIKEITSNHSEDDIYAMLKDCSMDPNETTQRLLHLDTFHEVKRKRVKRKETV  86



>ref|XP_010109270.1| hypothetical protein L484_014864 [Morus notabilis]
 gb|EXC21509.1| hypothetical protein L484_014864 [Morus notabilis]
Length=731

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  234  VRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI  ++E+  K HS+ +I+A LKE  MDPNET QKL + DTFHEVKRRRDR+KE+LN
Sbjct  16   VRKTIHDIREITGKQHSDDEIFAVLKECAMDPNETAQKLLYLDTFHEVKRRRDRRKESLN  75



>ref|XP_009396015.1| PREDICTED: uncharacterized protein LOC103981123 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=791

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  387  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_009396005.1| PREDICTED: uncharacterized protein LOC103981123 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=792

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  387  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>gb|KFK38755.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=869

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 82/162 (51%), Gaps = 41/162 (25%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPG--VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GSK  GG + + P    +  IE++KE+   HS+ADIY  LKE++M+ +E  QKL HQ
Sbjct  1    MVTGSK-TGGNRVMGPDEEAKKKIESIKEIMGNHSDADIYTALKEADMNADEAVQKLIHQ  59

Query  357  DTFHEVKRRR--------------DRKKEALNV---------PKVNIQNTGYRTEEDRKE  467
            D FHEVK+R+              +RKK   NV         P+ N+   GY      + 
Sbjct  60   DPFHEVKKRKKDRKKEEVVLVEPANRKKPIENVTSEVKVRTQPEHNVWRGGY-----NRN  114

Query  468  FEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
            F P N         N   R  + RN  P TG +REFRVVRDN
Sbjct  115  FLPRN--------RNAPPRNAFSRN--PATGPNREFRVVRDN  146



>gb|KFK38754.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=869

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 82/162 (51%), Gaps = 41/162 (25%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPG--VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GSK  GG + + P    +  IE++KE+   HS+ADIY  LKE++M+ +E  QKL HQ
Sbjct  1    MVTGSK-TGGNRVMGPDEEAKKKIESIKEIMGNHSDADIYTALKEADMNADEAVQKLIHQ  59

Query  357  DTFHEVKRRR--------------DRKKEALNV---------PKVNIQNTGYRTEEDRKE  467
            D FHEVK+R+              +RKK   NV         P+ N+   GY      + 
Sbjct  60   DPFHEVKKRKKDRKKEEVVLVEPANRKKPIENVTSEVKVRTQPEHNVWRGGY-----NRN  114

Query  468  FEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
            F P N         N   R  + RN  P TG +REFRVVRDN
Sbjct  115  FLPRN--------RNAPPRNAFSRN--PATGPNREFRVVRDN  146



>gb|KFK38756.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=870

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 82/162 (51%), Gaps = 41/162 (25%)
 Frame = +3

Query  183  MVAGSKFEGGTQNLSPG--VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  356
            MV GSK  GG + + P    +  IE++KE+   HS+ADIY  LKE++M+ +E  QKL HQ
Sbjct  1    MVTGSK-TGGNRVMGPDEEAKKKIESIKEIMGNHSDADIYTALKEADMNADEAVQKLIHQ  59

Query  357  DTFHEVKRRR--------------DRKKEALNV---------PKVNIQNTGYRTEEDRKE  467
            D FHEVK+R+              +RKK   NV         P+ N+   GY      + 
Sbjct  60   DPFHEVKKRKKDRKKEEVVLVEPANRKKPIENVTSEVKVRTQPEHNVWRGGY-----NRN  114

Query  468  FEPANLAVKSKTHNNLIRRGPYKRNALPGTGVSREFRVVRDN  593
            F P N         N   R  + RN  P TG +REFRVVRDN
Sbjct  115  FLPRN--------RNAPPRNAFSRN--PATGPNREFRVVRDN  146



>ref|XP_010245042.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X3 [Nelumbo nucifera]
Length=914

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++   VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  5    GSRVSIPNSVRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKR  64

Query  387  DRKKEALN  410
            D++KE +N
Sbjct  65   DKRKENMN  72



>ref|XP_006353099.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Solanum tuberosum]
Length=865

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+RDR++E LN 
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKRDRRRENLNK  80

Query  414  ----PKVNIQNTGYRTEEDRKEFEP  476
                PK      G   +  R  F P
Sbjct  81   ESTEPKWKPAMQGRGNKGSRGNFTP  105



>ref|XP_009396023.1| PREDICTED: uncharacterized protein LOC103981123 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=784

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  387  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_006353098.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Solanum tuberosum]
Length=876

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+RDR++E LN 
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKRDRRRENLNK  80

Query  414  ----PKVNIQNTGYRTEEDRKEFEP  476
                PK      G   +  R  F P
Sbjct  81   ESTEPKWKPAMQGRGNKGSRGNFTP  105



>ref|XP_009396039.1| PREDICTED: uncharacterized protein LOC103981123 isoform X5 [Musa 
acuminata subsp. malaccensis]
Length=771

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +3

Query  207  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  386
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  387  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  524
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_011467310.1| PREDICTED: endochitinase A isoform X3 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>ref|XP_011467309.1| PREDICTED: endochitinase A isoform X2 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>ref|XP_011467308.1| PREDICTED: endochitinase A isoform X1 [Fragaria vesca subsp. 
vesca]
Length=882

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>ref|XP_010929038.1| PREDICTED: uncharacterized protein LOC105050641 isoform X3 [Elaeis 
guineensis]
Length=899

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929036.1| PREDICTED: uncharacterized protein LOC105050641 isoform X2 [Elaeis 
guineensis]
Length=899

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929035.1| PREDICTED: uncharacterized protein LOC105050641 isoform X1 [Elaeis 
guineensis]
Length=900

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929039.1| PREDICTED: uncharacterized protein LOC105050641 isoform X4 [Elaeis 
guineensis]
Length=890

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010036125.1| PREDICTED: uncharacterized protein LOC104425205 isoform X1 [Eucalyptus 
grandis]
 gb|KCW47652.1| hypothetical protein EUGRSUZ_K01392 [Eucalyptus grandis]
Length=874

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            GVR TI+ +KE+   HSE +IYA L+E +MDPNET QKL  QDTFHEVKR+RDR+K
Sbjct  15   GVRQTIQDIKEITGNHSEEEIYAMLRECSMDPNETAQKLLFQDTFHEVKRKRDRRK  70



>ref|XP_009361529.1| PREDICTED: uncharacterized protein LOC103951798 isoform X1 [Pyrus 
x bretschneideri]
Length=861

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_009361530.1| PREDICTED: mucin-12 isoform X2 [Pyrus x bretschneideri]
Length=860

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_010036126.1| PREDICTED: uncharacterized protein LOC104425205 isoform X2 [Eucalyptus 
grandis]
 gb|KCW47651.1| hypothetical protein EUGRSUZ_K01392 [Eucalyptus grandis]
Length=840

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  231  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            GVR TI+ +KE+   HSE +IYA L+E +MDPNET QKL  QDTFHEVKR+RDR+K
Sbjct  15   GVRQTIQDIKEITGNHSEEEIYAMLRECSMDPNETAQKLLFQDTFHEVKRKRDRRK  70



>emb|CDP13693.1| unnamed protein product [Coffea canephora]
Length=816

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  TIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  413
            TI+ +KE+A  HS+ DIYA LKE NMDPNET Q+L + DTFHEVK++RD++K  +++
Sbjct  19   TIQDIKEIAGKHSDDDIYAMLKECNMDPNETAQRLLYLDTFHEVKKKRDKRKSNVSI  75



>ref|XP_004162890.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101212400 
[Cucumis sativus]
Length=879

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TIE +KE+   HS+ +I+A LKE +MDPNET QKL  QDTFHEVK +R+R+KE  N
Sbjct  15   VRKTIENIKEITGNHSDDEIFAMLKECSMDPNETAQKLLLQDTFHEVKSKRERRKENAN  73



>ref|XP_008380020.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=866

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +I+A LKE NMDP+ET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_011008079.1| PREDICTED: flocculation protein FLO11 [Populus euphratica]
Length=886

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  207  GGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  383
            GG + ++    R TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+
Sbjct  4    GGVRVSIPSNARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRK  63

Query  384  RDRKKE  401
            RDRKKE
Sbjct  64   RDRKKE  69



>ref|XP_008380021.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +I+A LKE NMDP+ET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_007049405.1| Cell wall protein AWA1 isoform 3 [Theobroma cacao]
 gb|EOX93562.1| Cell wall protein AWA1 isoform 3 [Theobroma cacao]
Length=873

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE+LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKESLN  73



>ref|XP_008783016.1| PREDICTED: uncharacterized protein LOC103702379 isoform X7 [Phoenix 
dactylifera]
Length=898

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783014.1| PREDICTED: uncharacterized protein LOC103702379 isoform X5 [Phoenix 
dactylifera]
Length=899

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783012.1| PREDICTED: uncharacterized protein LOC103702379 isoform X3 [Phoenix 
dactylifera]
Length=899

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783013.1| PREDICTED: uncharacterized protein LOC103702379 isoform X4 [Phoenix 
dactylifera]
Length=899

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783011.1| PREDICTED: uncharacterized protein LOC103702379 isoform X2 [Phoenix 
dactylifera]
Length=899

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783009.1| PREDICTED: uncharacterized protein LOC103702379 isoform X1 [Phoenix 
dactylifera]
Length=900

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_008783015.1| PREDICTED: uncharacterized protein LOC103702379 isoform X6 [Phoenix 
dactylifera]
Length=898

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_007049403.1| Cell wall protein AWA1 isoform 1 [Theobroma cacao]
 gb|EOX93560.1| Cell wall protein AWA1 isoform 1 [Theobroma cacao]
Length=885

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE+LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKESLN  73



>gb|KJB06118.1| hypothetical protein B456_001G0984002 [Gossypium raimondii]
Length=880

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKEVLN  73



>gb|KJB06119.1| hypothetical protein B456_001G0984002 [Gossypium raimondii]
 gb|KJB06120.1| hypothetical protein B456_001G0984002 [Gossypium raimondii]
Length=883

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  234  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  410
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKEVLN  73



>ref|XP_008797740.1| PREDICTED: uncharacterized protein LOC103712844 isoform X2 [Phoenix 
dactylifera]
Length=896

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LK+ +MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKDCSMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIRDP  73



>ref|XP_008797742.1| PREDICTED: uncharacterized protein LOC103712844 isoform X4 [Phoenix 
dactylifera]
Length=895

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  219  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  398
            ++   VR TI+ +KE+A  HS+ ++YA LK+ +MDPNET Q+L  QDTFHEVKR+RD++K
Sbjct  8    SIPSNVRKTIQNIKEIAGNHSDEEVYAMLKDCSMDPNETAQRLLLQDTFHEVKRKRDKRK  67

Query  399  EALNVP  416
            E +  P
Sbjct  68   ENIRDP  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370