BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS169A01

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    318   1e-100   Solanum tuberosum [potatoes]
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    318   2e-100   Nicotiana sylvestris
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   318   2e-100   Solanum lycopersicum
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    318   3e-100   Sesamum indicum [beniseed]
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    317   5e-100   Sesamum indicum [beniseed]
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        317   6e-100   Nicotiana tomentosiformis
emb|CBI40753.3|  unnamed protein product                                314   2e-99    Vitis vinifera
gb|KJB14182.1|  hypothetical protein B456_002G113400                    310   2e-99    Gossypium raimondii
gb|KJB14183.1|  hypothetical protein B456_002G113400                    310   2e-99    Gossypium raimondii
gb|KDO85211.1|  hypothetical protein CISIN_1g004673mg                   311   2e-99    Citrus sinensis [apfelsine]
emb|CAN59780.1|  hypothetical protein VITISV_024656                     314   9e-99    Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            314   9e-99    Vitis vinifera
emb|CDP07261.1|  unnamed protein product                                313   1e-98    Coffea canephora [robusta coffee]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   313   1e-98    Morus notabilis
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   1e-98    Glycine max [soybeans]
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             313   2e-98    Phaseolus vulgaris [French bean]
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    313   3e-98    
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    313   3e-98    
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                312   4e-98    Erythranthe guttata [common monkey flower]
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        312   4e-98    Glycine soja [wild soybean]
gb|AAX47312.1|  hexose transporter 6                                    312   4e-98    Vitis vinifera
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    312   5e-98    Glycine max [soybeans]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   310   8e-98    Citrus sinensis [apfelsine]
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         311   1e-97    Jatropha curcas
gb|AIQ77649.1|  tonoplastic transporter 1                               310   2e-97    Vitis vinifera
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             310   2e-97    Citrus clementina [clementine]
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  310   2e-97    Gossypium arboreum [tree cotton]
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    309   5e-97    Eucalyptus grandis [rose gum]
gb|KJB14177.1|  hypothetical protein B456_002G113400                    309   6e-97    Gossypium raimondii
ref|XP_002510716.1|  sugar transporter, putative                        308   1e-96    Ricinus communis
ref|XP_008351570.1|  PREDICTED: monosaccharide-sensing protein 2-...    291   2e-96    
dbj|BAK00015.1|  predicted protein                                      289   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    303   8e-95    Populus euphratica
ref|XP_010266258.1|  PREDICTED: monosaccharide-sensing protein 2 ...    300   2e-94    
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             302   2e-94    Populus trichocarpa [western balsam poplar]
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    302   3e-94    Populus euphratica
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             301   4e-94    Populus trichocarpa [western balsam poplar]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    301   7e-94    Cicer arietinum [garbanzo]
gb|KJB79727.1|  hypothetical protein B456_013G064200                    297   7e-94    Gossypium raimondii
emb|CBI21577.3|  unnamed protein product                                296   3e-93    Vitis vinifera
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    299   4e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006364349.1|  PREDICTED: monosaccharide-sensing protein 2-...    283   1e-92    
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        297   2e-92    Vitis vinifera
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    297   3e-92    
gb|KJB79728.1|  hypothetical protein B456_013G064200                    296   6e-92    Gossypium raimondii
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  296   6e-92    Gossypium arboreum [tree cotton]
ref|XP_002520608.1|  sugar transporter, putative                        296   6e-92    Ricinus communis
ref|XP_003603868.1|  Monosaccharide-sensing protein                     296   6e-92    Medicago truncatula
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             296   6e-92    Phaseolus vulgaris [French bean]
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 295   9e-92    Camellia sinensis [black tea]
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        295   1e-91    Fragaria vesca subsp. vesca
gb|KDO68405.1|  hypothetical protein CISIN_1g004750mg                   290   2e-91    Citrus sinensis [apfelsine]
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    295   2e-91    
emb|CDY31497.1|  BnaC05g16060D                                          292   2e-91    Brassica napus [oilseed rape]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             295   2e-91    Prunus persica
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         294   2e-91    Jatropha curcas
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        294   3e-91    Pyrus x bretschneideri [bai li]
gb|EAY85098.1|  hypothetical protein OsI_06450                          293   3e-91    Oryza sativa Indica Group [Indian rice]
gb|EPS65490.1|  hypothetical protein M569_09283                         294   3e-91    Genlisea aurea
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    293   4e-91    Tarenaya hassleriana [spider flower]
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    293   7e-91    Elaeis guineensis
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    293   9e-91    Tarenaya hassleriana [spider flower]
emb|CDY29502.1|  BnaA06g14680D                                          291   1e-90    Brassica napus [oilseed rape]
gb|AAP54842.2|  hexose transporter, putative, expressed                 284   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        292   2e-90    Prunus mume [ume]
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          293   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        291   2e-90    Brassica rapa
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        291   2e-90    Triticum urartu
dbj|BAJ33724.1|  unnamed protein product                                292   2e-90    Eutrema halophilum
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             292   2e-90    Eutrema salsugineum [saltwater cress]
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    292   2e-90    Populus euphratica
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             292   2e-90    Prunus persica
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    291   3e-90    Prunus mume [ume]
dbj|BAJ89532.1|  predicted protein                                      291   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB12352.1|  hypothetical protein B456_002G014400                    288   3e-90    Gossypium raimondii
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    291   3e-90    
ref|XP_008349018.1|  PREDICTED: monosaccharide-sensing protein 2-...    277   3e-90    
ref|NP_001046359.1|  Os02g0229400                                       291   3e-90    
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    291   5e-90    Brachypodium distachyon [annual false brome]
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        292   6e-90    
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    290   6e-90    Citrus sinensis [apfelsine]
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             290   7e-90    
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   290   7e-90    Citrus sinensis [apfelsine]
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    290   1e-89    
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    290   2e-89    Nicotiana sylvestris
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   290   2e-89    Morus notabilis
emb|CDY33650.1|  BnaC08g19500D                                          288   2e-89    Brassica napus [oilseed rape]
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        289   2e-89    Prunus mume [ume]
gb|KJB77474.1|  hypothetical protein B456_012G139000                    286   2e-89    Gossypium raimondii
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        289   3e-89    Tarenaya hassleriana [spider flower]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    289   3e-89    
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              289   3e-89    
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    289   3e-89    
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    289   3e-89    Oryza brachyantha
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    289   3e-89    Pyrus x bretschneideri [bai li]
emb|CAA90628.1|  sugar transporter                                      288   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    288   5e-89    Pyrus x bretschneideri [bai li]
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    288   6e-89    Eucalyptus grandis [rose gum]
gb|AAD30608.1|AC007369_18  Sugar transporter                            288   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 288   7e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             288   7e-89    
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    288   8e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312798.1|  transporter-related family protein                 288   8e-89    
emb|CDI66586.1|  putative sugar transporter type 2a protein             288   9e-89    Saccharum hybrid cultivar R570
emb|CDI66591.1|  putative sugar transporter type 2a protein             288   9e-89    Saccharum hybrid cultivar R570
gb|KJB12351.1|  hypothetical protein B456_002G014400                    287   1e-88    Gossypium raimondii
ref|XP_006384856.1|  transporter-related family protein                 287   1e-88    
emb|CDP01766.1|  unnamed protein product                                287   1e-88    Coffea canephora [robusta coffee]
gb|KJB12354.1|  hypothetical protein B456_002G014400                    288   1e-88    Gossypium raimondii
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    286   2e-88    Nicotiana tomentosiformis
emb|CDX96618.1|  BnaA08g21610D                                          286   2e-88    
gb|KJB77472.1|  hypothetical protein B456_012G139000                    286   3e-88    Gossypium raimondii
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        286   3e-88    Brassica rapa
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             286   3e-88    
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    286   4e-88    Eucalyptus grandis [rose gum]
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    285   4e-88    Sesamum indicum [beniseed]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     285   6e-88    Eucalyptus grandis [rose gum]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    285   6e-88    Eucalyptus grandis [rose gum]
emb|CBI37732.3|  unnamed protein product                                283   6e-88    Vitis vinifera
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        285   7e-88    Triticum urartu
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        285   7e-88    
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        285   8e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        285   9e-88    Gossypium arboreum [tree cotton]
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        285   9e-88    Nelumbo nucifera [Indian lotus]
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    285   1e-87    Fragaria vesca subsp. vesca
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          285   1e-87    
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    284   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             284   2e-87    Prunus persica
gb|EEC67373.1|  hypothetical protein OsI_34495                          284   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        284   2e-87    Vitis vinifera
gb|AFP89954.1|  tonoplastic transporter 2                               284   2e-87    Vitis vinifera
emb|CAD58958.1|  hexose transporter                                     284   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             284   2e-87    Phaseolus vulgaris [French bean]
ref|NP_001065182.1|  Os10g0539900                                       284   2e-87    
dbj|BAJ90138.1|  predicted protein                                      284   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          284   3e-87    Sorghum bicolor [broomcorn]
gb|AIN39841.1|  hypothetical protein                                    283   3e-87    Zoysia matrella [Japanese carpet grass]
ref|XP_010906859.1|  PREDICTED: monosaccharide-sensing protein 2-...    278   4e-87    
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    283   5e-87    Elaeis guineensis
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             283   6e-87    Capsella rubella
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    283   6e-87    Pyrus x bretschneideri [bai li]
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    283   6e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    282   7e-87    Solanum tuberosum [potatoes]
emb|CAN80213.1|  hypothetical protein VITISV_042076                     282   9e-87    Vitis vinifera
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   1e-86    Sesamum indicum [beniseed]
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    282   1e-86    Populus euphratica
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        282   1e-86    
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        282   1e-86    Glycine soja [wild soybean]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    282   1e-86    
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        281   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   2e-86    
emb|CDX69128.1|  BnaC01g03250D                                          280   2e-86    
emb|CDP14489.1|  unnamed protein product                                281   2e-86    Coffea canephora [robusta coffee]
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   3e-86    
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   3e-86    Brachypodium distachyon [annual false brome]
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    280   3e-86    Nicotiana sylvestris
emb|CDY65623.1|  BnaCnng48010D                                          280   3e-86    Brassica napus [oilseed rape]
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              281   3e-86    Solanum lycopersicum
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    281   4e-86    Setaria italica
ref|NP_001151936.1|  LOC100285573                                       280   8e-86    Zea mays [maize]
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    279   9e-86    Nicotiana sylvestris
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    279   1e-85    Nicotiana tomentosiformis
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    279   2e-85    Zea mays [maize]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        279   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    279   2e-85    Glycine max [soybeans]
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    278   2e-85    
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    278   4e-85    Nicotiana tomentosiformis
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    278   4e-85    Camelina sativa [gold-of-pleasure]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    277   7e-85    Arabis alpina [alpine rockcress]
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    277   7e-85    
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        277   1e-84    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        276   1e-84    Glycine soja [wild soybean]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    275   2e-84    Glycine max [soybeans]
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    276   2e-84    Setaria italica
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        276   3e-84    Cucumis melo [Oriental melon]
gb|AAO37640.1|  putative sugar transporter type 2a                      276   3e-84    Saccharum hybrid cultivar Q117
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    275   4e-84    
ref|XP_002877807.1|  predicted protein                                  275   4e-84    
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    275   6e-84    
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              275   6e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 275   6e-84    Arabidopsis thaliana [mouse-ear cress]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                274   1e-83    Erythranthe guttata [common monkey flower]
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        269   1e-83    
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   274   2e-83    Morus notabilis
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    272   4e-83    Cucumis sativus [cucumbers]
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    272   5e-83    Cucumis melo [Oriental melon]
ref|NP_001067890.1|  Os11g0475600                                       272   1e-82    
gb|EAY80902.1|  hypothetical protein OsI_36080                          271   2e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    269   1e-81    Phoenix dactylifera
ref|NP_195256.3|  monosaccharide-sensing protein 2                      268   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    268   2e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_849565.1|  monosaccharide-sensing protein 2                      268   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             268   3e-81    
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    267   4e-81    Pyrus x bretschneideri [bai li]
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        267   7e-81    Fragaria vesca subsp. vesca
dbj|BAI94493.1|  sugar transporter                                      266   9e-81    Dianthus caryophyllus [carnation]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       267   1e-80    Cucumis sativus [cucumbers]
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    266   2e-80    Phoenix dactylifera
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    264   6e-80    
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        263   9e-80    Fragaria vesca subsp. vesca
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    263   2e-79    Prunus mume [ume]
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             263   2e-79    Prunus persica
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    262   2e-79    
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             262   3e-79    
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    262   3e-79    Populus euphratica
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             262   5e-79    Eutrema salsugineum [saltwater cress]
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         261   6e-79    Jatropha curcas
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    261   1e-78    
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    261   1e-78    
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                260   1e-78    Erythranthe guttata [common monkey flower]
gb|KJB31963.1|  hypothetical protein B456_005G216600                    259   5e-78    Gossypium raimondii
gb|EPS57524.1|  hypothetical protein M569_17293                         258   6e-78    Genlisea aurea
ref|XP_002532480.1|  sugar transporter, putative                        254   6e-78    
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    258   2e-77    Brachypodium distachyon [annual false brome]
emb|CDY16303.1|  BnaC01g23380D                                          256   3e-77    Brassica napus [oilseed rape]
emb|CDY33276.1|  BnaA01g19430D                                          256   4e-77    Brassica napus [oilseed rape]
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        256   5e-77    Brassica rapa
gb|KEH36403.1|  tonoplast monosaccharide transporter 2                  254   7e-77    Medicago truncatula
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  256   9e-77    Gossypium arboreum [tree cotton]
emb|CDX78009.1|  BnaA09g32040D                                          254   1e-76    
emb|CDX73717.1|  BnaC08g22860D                                          254   2e-76    
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        255   2e-76    Brassica rapa
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             254   2e-76    
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             254   3e-76    Eutrema salsugineum [saltwater cress]
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        254   5e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    254   6e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    254   6e-76    Camelina sativa [gold-of-pleasure]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     253   7e-76    Medicago truncatula
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        249   2e-74    Glycine soja [wild soybean]
gb|KJB14185.1|  hypothetical protein B456_002G113400                    248   2e-74    Gossypium raimondii
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    249   3e-74    Setaria italica
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        248   7e-74    Glycine soja [wild soybean]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                245   2e-73    Erythranthe guttata [common monkey flower]
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    247   3e-73    Setaria italica
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    246   6e-73    
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    245   1e-72    Eucalyptus grandis [rose gum]
ref|XP_003603869.1|  Monosaccharide-sensing protein                     243   2e-72    
gb|ACG25339.1|  hexose transporter                                      243   7e-72    Zea mays [maize]
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    242   7e-72    
ref|NP_001147067.1|  hexose transporter                                 243   8e-72    Zea mays [maize]
dbj|BAK02857.1|  predicted protein                                      242   9e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        233   4e-71    Triticum urartu
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        233   2e-68    Gossypium arboreum [tree cotton]
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    229   9e-67    Brachypodium distachyon [annual false brome]
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  228   2e-66    Gossypium arboreum [tree cotton]
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    228   2e-66    Glycine max [soybeans]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    228   2e-66    
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             225   2e-65    Phaseolus vulgaris [French bean]
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          224   6e-65    Sorghum bicolor [broomcorn]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             220   1e-63    Phaseolus vulgaris [French bean]
dbj|BAD23011.1|  putative hexose transporter                            214   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    213   4e-61    Cicer arietinum [garbanzo]
ref|XP_003629095.1|  Monosaccharide-sensing protein                     212   1e-60    
gb|EAY88138.1|  hypothetical protein OsI_09573                          211   2e-60    Oryza sativa Indica Group [Indian rice]
dbj|BAA85398.1|  unnamed protein product                                211   3e-60    Oryza sativa Japonica Group [Japonica rice]
gb|AAN17390.1|  Putative sugar transporter protein                      211   3e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   4e-60    
ref|XP_003614108.1|  Monosaccharide-sensing protein                     210   6e-60    Medicago truncatula
ref|XP_002453100.1|  hypothetical protein SORBIDRAFT_04g038460          206   7e-60    
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  210   9e-60    Medicago truncatula
gb|EAY88374.1|  hypothetical protein OsI_09831                          210   9e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   2e-59    Cicer arietinum [garbanzo]
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             206   3e-58    
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              205   4e-58    
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   1e-57    
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    203   2e-57    Glycine max [soybeans]
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    199   8e-57    
ref|NP_001173250.1|  Os03g0128900                                       185   1e-54    
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             196   1e-54    Selaginella moellendorffii
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             195   2e-54    Selaginella moellendorffii
ref|XP_003612412.1|  Monosaccharide-sensing protein                     192   3e-53    
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   5e-51    Oryza brachyantha
ref|XP_001761207.1|  predicted protein                                  185   8e-51    
ref|XP_001784511.1|  predicted protein                                  182   8e-50    
ref|XP_001773057.1|  predicted protein                                  182   1e-49    
emb|CAD58959.1|  sugar transporter                                      181   2e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010237535.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   4e-49    
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   3e-48    Brachypodium distachyon [annual false brome]
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        176   1e-47    
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        172   3e-46    
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    172   3e-46    
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             172   4e-46    
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             172   4e-46    
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    171   8e-46    
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        171   9e-46    
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          169   3e-45    
gb|AAM94321.1|  putative sugar transporter                              169   4e-45    
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             167   2e-44    
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             166   3e-44    
ref|XP_001754179.1|  predicted protein                                  165   9e-44    
gb|ABA94777.1|  Sugar transporter, putative, expressed                  164   2e-43    
gb|ABA94776.1|  Sugar transporter, putative, expressed                  164   2e-43    
gb|EEC68553.1|  hypothetical protein OsI_36866                          160   2e-42    
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    156   8e-41    
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    154   3e-40    
gb|EMT01868.1|  Monosaccharide-sensing protein 2                        150   4e-39    
emb|CDY33275.1|  BnaA01g19420D                                          133   7e-36    
gb|AGT16371.1|  hexose transporter                                      136   1e-33    
ref|WP_010332110.1|  major facilitator transporter                      119   4e-28    
ref|WP_024123064.1|  major facilitator transporter                      118   9e-28    
ref|WP_003326676.1|  MULTISPECIES: major facilitator transporter        117   2e-27    
ref|WP_010790115.1|  Major myo-inositol transporter IolT                117   2e-27    
ref|WP_044159562.1|  major facilitator transporter                      117   3e-27    
ref|WP_006165530.1|  sugar transporter                                  117   3e-27    
ref|WP_012945458.1|  major facilitator transporter                      117   3e-27    
ref|XP_003533841.1|  PREDICTED: probable inositol transporter 2-l...    117   4e-27    
ref|WP_008420814.1|  sugar transporter                                  116   4e-27    
ref|WP_021480749.1|  major facilitator transporter                      116   5e-27    
ref|WP_024571920.1|  major facilitator transporter                      116   6e-27    
ref|WP_041351268.1|  major facilitator transporter                      116   6e-27    
ref|WP_041333343.1|  major facilitator transporter                      116   6e-27    
ref|WP_042975185.1|  major facilitator transporter                      116   6e-27    
ref|WP_038429742.1|  MULTISPECIES: major facilitator transporter        116   6e-27    
ref|WP_017697351.1|  major facilitator transporter                      116   6e-27    
ref|WP_032726992.1|  major facilitator transporter                      116   6e-27    
ref|WP_015384820.1|  hypothetical protein                               116   6e-27    
ref|WP_015251080.1|  hypothetical protein                               116   6e-27    
ref|WP_014478156.1|  major facilitator transporter                      116   6e-27    
ref|WP_003227903.1|  major facilitator transporter                      116   6e-27    
emb|CAB07473.1|  ywtG                                                   116   7e-27    
ref|WP_003243731.1|  major facilitator transporter                      116   7e-27    
ref|WP_033884193.1|  major facilitator transporter                      116   7e-27    
ref|WP_029318758.1|  major facilitator transporter                      116   7e-27    
ref|WP_007141639.1|  major facilitator transporter                      116   7e-27    
dbj|BAI87225.1|  hypothetical protein BSNT_10227                        115   7e-27    
ref|WP_014115401.1|  major facilitator transporter                      115   7e-27    
ref|WP_014665603.1|  major facilitator transporter                      115   7e-27    
ref|WP_040081624.1|  major facilitator transporter                      115   7e-27    
gb|KFF55288.1|  major facilitator transporter                           115   7e-27    
gb|EPS65606.1|  hypothetical protein M569_09171                         112   1e-26    
ref|WP_019259642.1|  major facilitator transporter                      115   1e-26    
ref|WP_003235555.1|  sugar transporter family protein                   115   1e-26    
gb|AFW59276.1|  hypothetical protein ZEAMMB73_154299                    117   1e-26    
ref|WP_019715918.1|  major facilitator transporter                      115   1e-26    
ref|WP_039181947.1|  major facilitator transporter                      115   2e-26    
gb|KDE28343.1|  major facilitator superfamily transporter               114   2e-26    
ref|WP_003219605.1|  MULTISPECIES: major facilitator transporter        114   2e-26    
ref|WP_041115547.1|  major facilitator transporter                      114   2e-26    
ref|WP_034281160.1|  major facilitator transporter                      114   2e-26    
ref|WP_034624608.1|  major facilitator transporter                      114   2e-26    
ref|WP_024423665.1|  MULTISPECIES: major facilitator transporter        114   2e-26    
ref|WP_025093928.1|  major facilitator transporter                      114   2e-26    
ref|WP_044333342.1|  major facilitator transporter                      114   2e-26    
ref|WP_034318471.1|  major facilitator transporter                      114   3e-26    
gb|ABV63905.1|  MFS family major facilitator transporter                114   3e-26    
ref|WP_041815974.1|  major facilitator transporter                      114   3e-26    
ref|WP_041087948.1|  major facilitator transporter                      114   3e-26    
ref|WP_034660203.1|  major facilitator transporter                      114   3e-26    
ref|WP_039075310.1|  major facilitator transporter                      114   3e-26    
ref|WP_044140081.1|  major facilitator transporter                      114   3e-26    
ref|WP_003213753.1|  major facilitator transporter                      114   3e-26    
ref|WP_012945178.1|  major facilitator transporter                      114   3e-26    
ref|WP_013644894.1|  major facilitator transporter                      114   4e-26    
ref|WP_007109838.1|  sugar transporter                                  113   4e-26    
ref|XP_002308798.1|  sugar transporter family protein                   114   5e-26    
ref|WP_026588992.1|  major facilitator transporter                      113   5e-26    
ref|WP_015321733.1|  MFS transporter, sugar porter family               113   6e-26    
gb|KDE57191.1|  major facilitator transporter                           113   6e-26    
ref|WP_010328819.1|  major facilitator transporter                      113   6e-26    
ref|XP_004502238.1|  PREDICTED: inositol transporter 1-like             113   6e-26    
gb|KFK22027.1|  hypothetical protein AALP_AAs71925U000400               113   7e-26    
ref|XP_004293378.1|  PREDICTED: inositol transporter 4-like             114   7e-26    
ref|WP_039963088.1|  major facilitator transporter                      113   7e-26    
ref|WP_024718707.1|  MULTISPECIES: major facilitator transporter        113   7e-26    
ref|WP_035702628.1|  major facilitator transporter                      113   7e-26    
ref|WP_026050159.1|  major facilitator transporter                      113   7e-26    
ref|WP_025208099.1|  major facilitator transporter                      113   7e-26    
ref|WP_006110627.1|  sugar transporter                                  113   7e-26    
gb|KIL28067.1|  hypothetical protein B4133_3537                         113   7e-26    
ref|WP_005555141.1|  sugar transporter                                  113   7e-26    
ref|XP_003601664.1|  hypothetical protein MTR_3g084110                  113   7e-26    
gb|EIL85661.1|  major myo-inositol transporter IolT                     113   7e-26    
ref|WP_008893404.1|  sugar transporter                                  113   8e-26    
ref|WP_012944770.1|  major facilitator transporter                      112   1e-25    
gb|KDE31071.1|  major facilitator superfamily transporter               112   1e-25    
ref|XP_003595539.1|  Carbohydrate transporter/sugar porter              114   1e-25    
gb|AHG00573.1|  major facilitator transporter                           112   1e-25    
gb|EMI14151.1|  carbohydrate transporter                                112   1e-25    
ref|WP_006665058.1|  sugar transporter                                  112   1e-25    
ref|XP_011084172.1|  PREDICTED: inositol transporter 1                  112   1e-25    
ref|WP_018661922.1|  major facilitator transporter                      112   2e-25    
emb|CCC56913.1|  D-xylose proton-symporter                              112   2e-25    
ref|WP_025731032.1|  major facilitator transporter                      112   2e-25    
ref|WP_037544280.1|  major facilitator transporter                      111   2e-25    
ref|WP_020453166.1|  MULTISPECIES: putative carbohydrate transpor...    111   2e-25    
gb|AES71915.2|  sugar porter (SP) family MFS transporter                112   3e-25    
ref|WP_002460768.1|  major facilitator transporter                      111   3e-25    
ref|WP_002492575.1|  major facilitator transporter                      111   3e-25    
ref|WP_031314734.1|  major facilitator transporter                      111   3e-25    
ref|WP_043926519.1|  major facilitator transporter                      111   3e-25    
gb|ETI82942.1|  MFS transporter, sugar porter family protein            111   3e-25    
ref|WP_038109522.1|  major facilitator transporter                      111   3e-25    
gb|EKF35927.1|  major facilitator superfamily transporter               111   3e-25    
ref|WP_034738771.1|  major facilitator transporter                      111   3e-25    
ref|WP_006185197.1|  sugar transporter                                  111   3e-25    
gb|EFH84814.1|  sugar transporter                                       111   4e-25    
ref|WP_042737659.1|  major facilitator transporter                      111   4e-25    
ref|WP_040446630.1|  hypothetical protein                               111   4e-25    
ref|WP_006431848.1|  sugar transporter                                  110   4e-25    
ref|WP_022793052.1|  major facilitator transporter                      111   4e-25    
ref|WP_032876096.1|  major facilitator transporter                      111   4e-25    
ref|WP_003185812.1|  MULTISPECIES: major facilitator transporter        111   4e-25    
ref|WP_014305946.1|  MULTISPECIES: major facilitator transporter        111   4e-25    
ref|WP_032857593.1|  major facilitator transporter                      110   4e-25    
ref|WP_003151349.1|  major facilitator transporter                      111   4e-25    
ref|WP_019853934.1|  hypothetical protein                               111   4e-25    
ref|WP_015418357.1|  putative carbohydrate transporter                  110   4e-25    
ref|WP_007407509.1|  MULTISPECIES: major facilitator transporter        110   4e-25    
ref|WP_032867483.1|  major facilitator transporter                      110   4e-25    
ref|WP_025285372.1|  major facilitator transporter                      110   4e-25    
gb|AAU25275.2|  Sugar transporter YwtG                                  111   4e-25    
ref|XP_010686705.1|  PREDICTED: inositol transporter 4-like isofo...    112   5e-25    
ref|WP_021494857.1|  major facilitator transporter                      110   5e-25    
ref|WP_017418788.1|  MULTISPECIES: major facilitator transporter        110   5e-25    
ref|WP_011201747.1|  major facilitator transporter                      110   5e-25    
ref|WP_026580203.1|  major facilitator transporter                      110   5e-25    
ref|WP_038460090.1|  MULTISPECIES: major facilitator transporter        110   5e-25    
ref|WP_035337833.1|  major facilitator transporter                      110   5e-25    
gb|AAF91431.1|  putative Na+/myo-inositol symporter                     112   5e-25    
ref|WP_016937738.1|  major facilitator transporter                      110   6e-25    
ref|WP_044801938.1|  major facilitator transporter                      110   6e-25    
ref|WP_038557856.1|  major facilitator transporter                      110   6e-25    
ref|WP_008455808.1|  sugar transporter                                  110   6e-25    
ref|WP_006639311.1|  sugar transporter YwtG                             110   6e-25    
ref|WP_031379305.1|  MULTISPECIES: major facilitator transporter        110   6e-25    
ref|WP_025853557.1|  major facilitator transporter                      110   7e-25    
ref|WP_026059771.1|  IolT                                               110   7e-25    
ref|XP_003603886.1|  Mannitol transporter                               110   7e-25    
ref|XP_006652450.1|  PREDICTED: inositol transporter 1-like             110   7e-25    
ref|XP_007138452.1|  hypothetical protein PHAVU_009G210200g             111   7e-25    
ref|WP_006826745.1|  sugar transporter                                  110   8e-25    
ref|WP_013353817.1|  MULTISPECIES: major facilitator transporter        110   8e-25    
ref|WP_014643164.1|  major facilitator transporter                      110   8e-25    
ref|WP_043977680.1|  major facilitator transporter                      110   8e-25    
ref|WP_006053328.1|  major facilitator transporter                      110   9e-25    
ref|WP_014862590.1|  major facilitator transporter                      110   9e-25    
emb|CEG72789.1|  hypothetical protein RMATCC62417_08279                 110   1e-24    
ref|WP_044466668.1|  major facilitator transporter                      109   1e-24    
ref|XP_006858666.1|  hypothetical protein AMTR_s00066p00070660          110   1e-24    
gb|ACJ85869.1|  unknown                                                 109   1e-24    
ref|WP_002444810.1|  major facilitator transporter                      109   1e-24    
emb|CEI96832.1|  hypothetical protein RMCBS344292_10983                 110   1e-24    
gb|AAO74897.1|  putative Na+/myo-inositol symporter                     110   1e-24    
ref|XP_004509557.1|  PREDICTED: inositol transporter 1-like             108   2e-24    
gb|KDO43485.1|  hypothetical protein CISIN_1g010848mg                   109   2e-24    
ref|WP_041017256.1|  major facilitator transporter                      109   2e-24    
gb|KFK37169.1|  hypothetical protein AALP_AA4G222700                    109   2e-24    
ref|WP_013879135.1|  major facilitator transporter                      109   2e-24    
ref|WP_040734328.1|  sugar transporter                                  109   2e-24    
gb|KHN25361.1|  Polyol transporter 5                                    109   2e-24    
ref|XP_003524151.1|  PREDICTED: probable inositol transporter 2         110   2e-24    
emb|CDR33502.1|  putative D-xylose-proton symporter                     109   2e-24    
gb|KHN05290.1|  Putative inositol transporter 2                         110   2e-24    
ref|XP_002524977.1|  sugar transporter, putative                        110   2e-24    
ref|XP_003533843.1|  PREDICTED: probable inositol transporter 2-like    110   3e-24    
gb|KJB67352.1|  hypothetical protein B456_010G187000                    108   3e-24    
ref|WP_003551797.1|  major facilitator transporter                      108   3e-24    
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             109   3e-24    
ref|XP_006352346.1|  PREDICTED: inositol transporter 4-like isofo...    109   3e-24    
ref|XP_007026522.1|  Inositol transporter 1 isoform 1                   108   4e-24    
ref|XP_002263742.1|  PREDICTED: inositol transporter 1                  108   4e-24    
ref|WP_035166342.1|  major facilitator transporter                      108   4e-24    
ref|XP_010671818.1|  PREDICTED: inositol transporter 1-like isofo...    108   4e-24    
ref|XP_004509515.1|  PREDICTED: inositol transporter 1-like             108   4e-24    
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter        108   5e-24    
ref|NP_001287931.1|  transporter; Itr                                   109   5e-24    
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               108   5e-24    
ref|XP_003534735.1|  PREDICTED: inositol transporter 4-like             109   5e-24    
ref|XP_005454221.1|  PREDICTED: proton myo-inositol cotransporter...    109   5e-24    
ref|WP_040615275.1|  major facilitator transporter                      107   5e-24    
ref|XP_005454219.1|  PREDICTED: proton myo-inositol cotransporter...    109   5e-24    
ref|WP_037956567.1|  major facilitator transporter                      107   5e-24    
ref|WP_003610086.1|  major facilitator transporter                      107   6e-24    
ref|WP_041339107.1|  major facilitator transporter                      107   6e-24    
gb|ABR16512.1|  unknown                                                 109   6e-24    
ref|XP_005454218.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|XP_005454220.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|XP_005454217.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|XP_003580119.1|  PREDICTED: probable inositol transporter 2         109   6e-24    
gb|EDP46643.1|  D-xylose-proton symporter                               107   6e-24    
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               108   6e-24    
ref|XP_004990085.1|  solute carrier family 2                            109   6e-24    
ref|XP_010733779.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|XP_008289622.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|WP_033195997.1|  major facilitator transporter                      107   6e-24    
ref|XP_009351477.1|  PREDICTED: inositol transporter 4-like isofo...    107   6e-24    
ref|XP_010733780.1|  PREDICTED: proton myo-inositol cotransporter...    109   6e-24    
ref|XP_010733776.1|  PREDICTED: proton myo-inositol cotransporter...    109   7e-24    
ref|WP_030183952.1|  sugar transporter                                  107   7e-24    
ref|XP_008289630.1|  PREDICTED: proton myo-inositol cotransporter...    109   7e-24    
ref|XP_006494180.1|  PREDICTED: inositol transporter 1-like             108   7e-24    
ref|WP_021296563.1|  hypothetical protein                               107   7e-24    
ref|XP_008289638.1|  PREDICTED: proton myo-inositol cotransporter...    108   7e-24    
ref|XP_010733777.1|  PREDICTED: proton myo-inositol cotransporter...    109   8e-24    
ref|WP_002467669.1|  major facilitator transporter                      107   8e-24    
ref|XP_008309517.1|  PREDICTED: proton myo-inositol cotransporter...    109   8e-24    
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               108   8e-24    
ref|WP_002494579.1|  major facilitator transporter                      107   8e-24    
ref|WP_040058206.1|  major facilitator transporter                      107   8e-24    



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELALDASVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ TAPSWRLMLGVLSIPSL+YF L V
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTAPSWRLMLGVLSIPSLIYFVLVV  180

Query  602  FYLPE  616
             YLPE
Sbjct  181  LYLPE  185



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ T+PSWRLMLGVLS+PSL+YF LTV
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTSPSWRLMLGVLSVPSLIYFVLTV  180

Query  602  FYLPE  616
             YLPE
Sbjct  181  LYLPE  185



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGL+VAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLIVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ TAPSWRLMLGVLSIPSL+YF L V
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTAPSWRLMLGVLSIPSLIYFVLVV  180

Query  602  FYLPE  616
             YLPE
Sbjct  181  LYLPE  185



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELQLGAAIEGLIVAMSLIGATLITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDLIGRRPMLISSSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMS+  +PSWRLMLGVLS+PSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSLLPSPSWRLMLGVLSVPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGA +VAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGAT+ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLILSS+FYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDWIGRRPMLILSSIFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGS GMFLAYCMIFGMS+ +  SWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSAGMFLAYCMIFGMSLGSLTSWRLMLGVLSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGS GMFLAYCMIFGMS+ T+PSWRLMLGVLS+PSL+YF LTV
Sbjct  121  ETAPSEIRGSLNTLPQFTGSSGMFLAYCMIFGMSLMTSPSWRLMLGVLSVPSLIYFVLTV  180

Query  602  FYLPE  616
             YLPE
Sbjct  181  LYLPE  185



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KJB14182.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=548

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KJB14183.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=557

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KDO85211.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=592

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGA +VAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV VA++AT+GNFLQGWDNATIAGAVVY+KKEL LE  +EGLVVAMSLIGATLITTC
Sbjct  1    MKGAVFVALSATVGNFLQGWDNATIAGAVVYMKKELDLEATVEGLVVAMSLIGATLITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SGSI+DW+GRRPMLILSS FYF SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTL PLYIS
Sbjct  61   SGSISDWIGRRPMLILSSSFYFFSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLTPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF GS GMFLAYCMIFGMS+ T+P+WRLMLGVLSIPSL+YFALTV
Sbjct  121  ETAPSEIRGSLNTLPQFAGSAGMFLAYCMIFGMSLMTSPNWRLMLGVLSIPSLIYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAATIGNFLQGWDNATIAGA+VYIKK+LVLE+ +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLVLESSVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+++DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLIISSVLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTV
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLSYCMVFGMSLLPSPSWRLMLGVLSIPSLIYFVLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG +ADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGATLITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATLITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG ++DWLGRRPMLI+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPVSDWLGRRPMLIISSLLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLLYFALTV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGA ++AIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MNGAALIAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATLITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSIGRRPMLIASSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFLAYCM+F MS+  +PSWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMVFSMSLAASPSWRLMLGVLSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYF LTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFTLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGA +VAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IG+FLQGWDNATIAGA+VYIK +L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAVLVAIAACIGSFLQGWDNATIAGAIVYIKDDLDLQTTVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DWLGRRPMLI+SSM YF+SGLIM+WSPNVYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLIMIWSPNVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG+LNTLPQFTGSGGMFL+YCM+FGMS+T++PSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSDIRGMLNTLPQFTGSGGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSLLYFALTI  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGAV+VAIAA IGNFLQGW NATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWGNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            MNGA +VAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKNDLDLGTSVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DWLGRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV VAIAATIGNFLQGWDNATIAGA++YIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVWVAIAATIGNFLQGWDNATIAGAIIYIKEDLDLGTTVEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWVGRRPMLILSSLLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPIYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCMIFGMS+  +PSWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMIFGMSLLASPSWRLMLGVLSIPSILYFVLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAI A IG+FLQGWDNATIAGA+VYIKK+L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAVLVAITACIGSFLQGWDNATIAGAIVYIKKDLNLQTTVEGLVVAMSLIGATTITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+DWLGRRPMLI+SS  YF+SGLIMLWSP+VYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSTLYFVSGLIMLWSPDVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG+LNTLPQFTGSGGMFL+YCM+FGMS+T++PSWRLMLGVLSIPSL+YFALT+
Sbjct  121  ETAPSEIRGMLNTLPQFTGSGGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSLIYFALTI  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_008351570.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=216

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 174/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>dbj|BAK00015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   303 bits (777),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SGSI+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGSISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG+LNTLPQF GSGGMFL+YCM+FGMS+TT+PSWR+MLG+LSIPSLLYF LTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMVFGMSLTTSPSWRMMLGILSIPSLLYFVLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_010266258.1| PREDICTED: monosaccharide-sensing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=653

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 174/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTDSPSWRLMLGVLSIPSVVYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSILYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG+LNTLPQF GSGGMFL+YCMIFGMS+T +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMIFGMSLTASPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSVLYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG+LNTLPQF GSGGMFL+YCMIFGMS+T +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMIFGMSLTASPSWRLMLGILSIPSLLYFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTL+PLYIS
Sbjct  61   SGPISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLIPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG+LNTLPQF GSGGMFL+YCM+FGMS+TT+PSWR+MLG+LSIPSLLYF LTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMVFGMSLTTSPSWRMMLGILSIPSLLYFVLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   301 bits (770),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV VAI A+IGNFLQGWDNATIAGA++YIKK+L L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIVASIGNFLQGWDNATIAGAILYIKKDLALHTTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG LNTLPQF+GSGGMFL+YCM+FGMS+T +PSWR+MLG+LSIPSL YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFGMSLTVSPSWRVMLGILSIPSLFYFILTV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|KJB79727.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=592

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+  +P WRLMLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFWMSLMDSPKWRLMLGVLSIPSLLYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 174/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTDSPSWRLMLGVLSIPSVVYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_006364349.1| PREDICTED: monosaccharide-sensing protein 2-like [Solanum tuberosum]
Length=257

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IG+FLQGWDNATIAG+++YIKKE  LET   MEGL+VAMSL+GA L+T
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGSILYIKKEFNLETQPTMEGLIVAMSLVGAVLMT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPN+YVLL+ARLL+GFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNIYVLLLARLLNGFGVGLAVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCVGMFFSYCMVFGMSLMSSPTWRLMLGVLSIPSILYFIL  180

Query  596  TVFYLPE  616
            T+FY PE
Sbjct  181  TIFYFPE  187



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+  +P WRLMLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFWMSLMDSPKWRLMLGVLSIPSLLYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GA +VAI A+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAALVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWVGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMDNPHWRVMLGVLSIPSLLYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 175/187 (94%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKREFNLESEPTIEGLIVATSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+I+DWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYFLSGVVMLWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+TTAPSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTTAPSWRLMLGVLFIPSLIYLAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TLFYLPE  187



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAG+++YIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGSILYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG LNTLPQF+GSGGMFL+YCM+F MS++ +PSWR+MLGVLSIPSL YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFVMSLSPSPSWRIMLGVLSIPSLFYFLLTV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGNFLQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVALAAAIGNFLQGWDNATIAGSILYIKREFQLESEPTIEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SSM YFLS L+MLWSPNVY+LL ARLLDGFGIGLAVTLVPLY
Sbjct  61   TCSGPISDWLGRRPMLIISSMLYFLSSLVMLWSPNVYILLFARLLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQFTGS GMF +YCM+F MS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPTEIRGLLNTLPQFTGSAGMFFSYCMVFAMSLTPAPSWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   295 bits (756),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = +2

Query  101  GNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPM  280
            GNFLQGWDNATIAGA+VYIK++L LET +EGLVVAMSLIGATL+TTCSG I+D +GRRPM
Sbjct  14   GNFLQGWDNATIAGAIVYIKEDLSLETTIEGLVVAMSLIGATLVTTCSGPISDLIGRRPM  73

Query  281  LILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNT  460
            LI+SSMFYF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+YISETAP++IRGLLNT
Sbjct  74   LIMSSMFYFVSGLVMLWSPNVYVLLVARLIDGFGIGLAVTLVPVYISETAPADIRGLLNT  133

Query  461  LPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
             PQF GS  MFLAYCMIFGMS+ T+P+WR+MLGVLSIPSL+YFAL +FYLPE
Sbjct  134  FPQFAGSFAMFLAYCMIFGMSLMTSPNWRVMLGVLSIPSLVYFALAIFYLPE  185



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV VAIAATIGNFLQGWDNATIAGA+VYI  +  L++ +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIAATIGNFLQGWDNATIAGAIVYITDDFALDSSVEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+++DWLGRRPMLI SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLITSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRG LNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVLSI SL+YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFLGSGGMFLSYCMVFGMSLLASPSWRLMLGVLSILSLIYFVLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KDO68405.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=560

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPE
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPE  187



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  65   NGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  244
             GAV+VAIAATIGN LQGWDNATIAGA+VYI KE  L + +EGLVVAMSLIGAT+ITTCS
Sbjct  3    KGAVLVAIAATIGNLLQGWDNATIAGAIVYITKEFDLGSSLEGLVVAMSLIGATIITTCS  62

Query  245  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  424
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTL+PLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLIPLYISE  122

Query  425  TAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVF  604
            TAP +IRG LNTLPQF GSGG+FL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTVF
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGLFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLIYFGLTVF  182

Query  605  YLPE  616
            YLPE
Sbjct  183  YLPE  186



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+ A IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAIGNLLQGWDNATIAASVLYIKKEFKLESEPAVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI+SS+ YF SG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCSGAIADWLGRRPVLIISSVLYFFSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTKSPSWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+ A +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAVGNLLQGWDNATIAGAVLYIKREFQLESEPTIEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+I+DWLGRRPMLI+SS+ Y +SG++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYCVSGIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T APSWRLMLGVLSIPS+ Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTKAPSWRLMLGVLSIPSVAYLAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  65   NGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  244
             GAV+VA+AATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCS
Sbjct  3    KGAVLVAVAATIGNLLQGWDNATIAGAIVYITEDFSLGSSLEGLVVAMSLIGATFITTCS  62

Query  245  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  424
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYISE  122

Query  425  TAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVF  604
            TAP +IRG LNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTVF
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLIYFGLTVF  182

Query  605  YLPE  616
            YLPE
Sbjct  183  YLPE  186



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = +2

Query  44   DSGLLRMNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  217
            D   ++M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  218  GATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAV  397
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAV
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAV  143

Query  398  TLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPS  577
            TLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPS
Sbjct  144  TLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPS  203

Query  578  LLYFALTVFYLPE  616
            L +F LT+FYLPE
Sbjct  204  LFFFGLTIFYLPE  216



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VAIAA IGNFLQGWDNATIA AVVYIK+E  L   +EGLVVA SLIGAT+ITTC
Sbjct  1    MKGAALVAIAAAIGNFLQGWDNATIAAAVVYIKREEHLGASVEGLVVATSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+I+D +GRRPML+LSS+FYF+ GLIMLWSPNVY+LL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDAVGRRPMLVLSSVFYFIGGLIMLWSPNVYILLLARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPS+IRGLLNTLPQFTGSGGMFL+YCMIFGMS++ +PSWRLMLGVLSIPSLLYF LTV
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLSYCMIFGMSLSPSPSWRLMLGVLSIPSLLYFVLTV  180

Query  602  FYLPE  616
             +LPE
Sbjct  181  LFLPE  185



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYIK ++ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNDMNLATSVQGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLI SS+ YF+SGLIM+WSPNVYVL +ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIFSSILYFISGLIMVWSPNVYVLCLARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS++ +PSWR MLGVLS+PSLLY A  +
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLSYCMVFGMSLSASPSWRGMLGVLSVPSLLYLAFAM  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   293 bits (751),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 164/176 (93%), Gaps = 2/176 (1%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  268
            +IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG+++DW+G
Sbjct  13   SIGNLLQGWDNATIAGAVLYIKKEFKLETEPTVEGLIVAMSLIGATIITTFSGAVSDWIG  72

Query  269  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  448
            RRP+LILSS+ YFLSGL+MLWSPNV++LL+ARL+DGFGIGLAVTLVPLYISETAP EIRG
Sbjct  73   RRPILILSSVLYFLSGLVMLWSPNVHILLLARLIDGFGIGLAVTLVPLYISETAPPEIRG  132

Query  449  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LLNTLPQF+GSGGMFL+YCM+FGMS+ + P WRLMLGVLSIPSL+YFALT+FYLPE
Sbjct  133  LLNTLPQFSGSGGMFLSYCMVFGMSLMSNPDWRLMLGVLSIPSLVYFALTIFYLPE  188



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYIK E+ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNEMNLATSVQGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I DWLGRRPMLI SS+ YF+SGLIMLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPITDWLGRRPMLIFSSILYFISGLIMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPS+LY A  V
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLSYCMVFAMSLSESPSWRGMLGVLSIPSVLYLAFAV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|AAP54842.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=445

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKKEFKLESDPAVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TC+G+IADWLGRRP+LI+SS+ YFLSG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCAGAIADWLGRRPVLIISSVLYFLSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T  PSWRLMLG+LSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTKLPSWRLMLGILSIPSLVYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = +2

Query  44   DSGLLRMNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLI  217
            D   ++M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLI
Sbjct  24   DRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLI  83

Query  218  GATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAV  397
            GAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAV
Sbjct  84   GATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAV  143

Query  398  TLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPS  577
            TLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPS
Sbjct  144  TLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPS  203

Query  578  LLYFALTVFYLPE  616
            L +F LT+FYLPE
Sbjct  204  LFFFGLTIFYLPE  216



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFIL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFAMSLSDAPSWRGMLGVLSIPSLVYLFFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFAMSLSDAPSWRGMLGVLSIPSLVYLFFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWR+MLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRVMLGVLFIPSIIYFLL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  268
            TIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT SG ++D LG
Sbjct  12   TIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLG  71

Query  269  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  448
            RRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRG
Sbjct  72   RRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYISETAPPEIRG  131

Query  449  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LLNTLPQFTGSGGMF++YCM+F MS+  AP+WRLMLGVLSIPSLLYFALTVFYLPE
Sbjct  132  LLNTLPQFTGSGGMFMSYCMVFSMSLMEAPNWRLMLGVLSIPSLLYFALTVFYLPE  187



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  268
            TIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT SG ++D LG
Sbjct  12   TIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLG  71

Query  269  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  448
            RRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRG
Sbjct  72   RRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYISETAPPEIRG  131

Query  449  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LLNTLPQFTGSGGMF++YCM+F MS+  AP+WRLMLGVLSIPSLLYFALTVFYLPE
Sbjct  132  LLNTLPQFTGSGGMFMSYCMVFSMSLMEAPNWRLMLGVLSIPSLLYFALTVFYLPE  187



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>gb|KJB12352.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=592

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_008349018.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=254

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTXPQFLGSGGMFLSYCMVFGMSLTDSASWRLMLGILSIPSLVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +2

Query  56   LRMNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATL  229
            ++M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+
Sbjct  3    VKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLENDPTLEGLIVAMSLIGATI  62

Query  230  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP  409
            ITT SG ++DW+GRRPMLILSS+ YF SGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVP
Sbjct  63   ITTFSGPVSDWVGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVP  122

Query  410  LYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYF  589
            LYISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLS+PSL++F
Sbjct  123  LYISETAPSEIRGQLNTLPQFSGSGGMFLSYCMVFGMSLLPLPDWRIMLGVLSVPSLVFF  182

Query  590  ALTVFYLPE  616
             LTVFYLPE
Sbjct  183  GLTVFYLPE  191



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  50   GLLRMNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGA  223
            G  +M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGA
Sbjct  40   GGKKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGA  99

Query  224  TLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTL  403
            T+ITT SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTL
Sbjct  100  TIITTFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTL  159

Query  404  VPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLL  583
            VPLYISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL 
Sbjct  160  VPLYISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLF  219

Query  584  YFALTVFYLPE  616
            +F LTVFYLPE
Sbjct  220  FFVLTVFYLPE  230



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   290 bits (743),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIISSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPE
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPE  187



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPE
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPE  187



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPE
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPE  187



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAI A+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  2    MQGAVLVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTIEGLIVAMSLIGATIIT  61

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++D +GRRP+LILSS+ YFLSGL+MLWSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  62   TFSGAVSDCIGRRPILILSSVLYFLSGLVMLWSPNVYILLLARLIDGFGIGLAVTLVPVY  121

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+ ++P WRLMLGVLSIPSL+Y AL
Sbjct  122  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMSSPDWRLMLGVLSIPSLVYLAL  181

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  182  TVFYLPE  188



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFISGLVMLWSPNVYVLLLARLLDGFGVGLAVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFSYCMVFGMSLKSSPTWRLMLGVLSIPSVLYFVL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFHLESQPTLEGLIVATSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI+SS+ YFLSG++MLWSPNVY LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLIISSILYFLSGILMLWSPNVYFLLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS++ +P+WRLMLGVLSIPS++YF  
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLSESPNWRLMLGVLSIPSVIYFLF  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            TIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCSG+I+DW+GR+
Sbjct  12   TIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTCSGAISDWIGRK  71

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYISETAP++IRG L
Sbjct  72   PMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYISETAPADIRGSL  131

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NTLPQF GSGGMFL+YCM+FGMS+  +P+WRLMLGV+SIPS++YFALTVFYLPE
Sbjct  132  NTLPQFLGSGGMFLSYCMVFGMSLMNSPNWRLMLGVISIPSIIYFALTVFYLPE  185



>gb|KJB77474.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=629

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNFLQGWDNATIAGAVLYIKKEFDLESEPTIEGLIVATSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ YF+  L MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFVGALTMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMF++YCM+FGMS+  +PSWRLMLGVL IPSLLY AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFISYCMVFGMSLMQSPSWRLMLGVLFIPSLLYSAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFKLESDPTMEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYIISGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+ T P+WRLMLGVL IPS +YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLMTLPNWRLMLGVLFIPSFIYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFL  LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLGSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>emb|CAA90628.1| sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   288 bits (737),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPS++YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLMESPSWRLMLGVLSIPSIVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV VA+AATIGNFLQGWDNATIAG +VYIK++L L + +EGLVVAMSLIGAT+ITT 
Sbjct  1    MRGAVFVALAATIGNFLQGWDNATIAGGIVYIKEDLDLGSTVEGLVVAMSLIGATVITTS  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLI+SS+ YF+ GL+MLWSPNVYVL + RLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIMSSILYFIGGLVMLWSPNVYVLCLGRLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP ++RGLLNTLPQFTGSGGMFLAYCMIFGMS++ +P+WR+MLGVLSIPS++YF   V
Sbjct  121  ETAPPDVRGLLNTLPQFTGSGGMFLAYCMIFGMSLSDSPNWRIMLGVLSIPSVIYFLFMV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   288 bits (736),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA+IGN LQGWDNATIAGAV+YIKKE  LET   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAASIGNLLQGWDNATIAGAVLYIKKEFKLETQPTMEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++D +GRRPMLI+SS+ YF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDMVGRRPMLIISSVLYFVSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVL +PSLLYF L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMANPDWRVMLGVLFVPSLLYFLL  180

Query  596  TVFYLPE  616
            T+FY+PE
Sbjct  181  TMFYMPE  187



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   288 bits (736),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            MNGAV+VA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+D LGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDCLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWR+MLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRVMLGVLFIPSIIYFLL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNVYVLL+ARLLDGFGIGL+VTL+P+Y
Sbjct  61   MCSGPISDLLGRRPLLIISSVLYFVSGLIMLWSPNVYVLLLARLLDGFGIGLSVTLIPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWRLMLGVL IPS++YF L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRLMLGVLFIPSIIYFLL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA +GNF+QGWDNATIAG+V+YIK+E  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAVVGNFVQGWDNATIAGSVLYIKREFNLQTQPTVEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SGS+ADWLGRRPML++SS+ YFL GL+MLW+PNVYVLL+ RLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGSVADWLGRRPMLVISSVLYFLGGLVMLWAPNVYVLLLGRLLDGFGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQF GS GMFL+YCM+FGMS+  +PSWRLMLG+LSIPSL YFAL
Sbjct  121  ISETAPTEIRGLLNTLPQFAGSAGMFLSYCMVFGMSLQDSPSWRLMLGILSIPSLAYFAL  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  AVFFLPE  187



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  25   MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  84

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  85   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  144

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  145  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  204

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  205  TVFFLPE  211



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAV LVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNVYVLLLARLLDGFGVGLAVILVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFSYCMVFGMSLMSSPTWRLMLGVLSIPSILYFVL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSL+Y  L+V
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRGMLGVLSIPSLVYLCLSV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AATIGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAATIGNLLQGWDNATIAGAVLYIKKEFDLEGQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPM+I+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   TFSGPVSDSIGRRPMMIISSILYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLIPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLS+PSL+Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSVPSLVYIGL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAG+V+YIK+E  L+    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGSVLYIKREFDLQRQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DWLGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMVFGMSLTNSPSWRLMLGVLSIPSMIYFVL  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  AVFFLPE  187



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMF++YCM+FGMS+  +PSWRLMLGVLS+PSL+YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMSYCMVFGMSLMESPSWRLMLGVLSVPSLIYFVL  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  MVFFLPE  187



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMF++YCM+FGMS+  +PSWRLMLGVLS+PSL+YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMSYCMVFGMSLMESPSWRLMLGVLSVPSLIYFVL  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  MVFFLPE  187



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  596  TVFYLPE  616
            TVF LPE
Sbjct  181  TVFLLPE  187



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VA+AATIGNFLQGWDNATIAG+++YIKKEL L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVALAATIGNFLQGWDNATIAGSILYIKKELELSTAMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG+++D +GRRP+L+LS+  YF+  L+MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDAVGRRPLLMLSASLYFIGSLVMLWSPNVYILLLARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ET+P EIRGLLNTLPQFTGSGGMFL+YCMIFGMS+  +PSWR+MLGVL IPS+ Y     
Sbjct  121  ETSPPEIRGLLNTLPQFTGSGGMFLSYCMIFGMSLMASPSWRIMLGVLGIPSVFYLLFAF  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFFSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MRGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFKLESEPTIEGLIVAMSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DWLGRRPM+I+SS+ YF+S +IMLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMMIISSVLYFISSIIMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  +PSWRLMLGVLSIPS+ YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLRDSPSWRLMLGVLSIPSVAYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 2/174 (1%)
 Frame = +2

Query  101  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            GN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG ++D LGRR
Sbjct  14   GNLLQGWDNATIAGAVLYIKKEFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLGRR  73

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP +IRGLL
Sbjct  74   PMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYISETAPPDIRGLL  133

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NTLPQFTGSGGMF +YCM+F MS+  APSWRLMLGVLSIPSL+YFALTV YLPE
Sbjct  134  NTLPQFTGSGGMFFSYCMVFTMSLKEAPSWRLMLGVLSIPSLVYFALTVLYLPE  187



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIA AV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAAAVLYIKEEFDLDNEPTLEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG I+DW+GRRPMLI SS+ YF+S LIM WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWIGRRPMLIFSSILYFVSALIMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQF+GSGGMF+ YCM+FGMS+   PSWR+MLGVL IPSL YFAL
Sbjct  121  ISETAPAEIRGLLNTLPQFSGSGGMFVTYCMVFGMSLMANPSWRVMLGVLFIPSLFYFAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TLFYLPE  187



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFKLEGQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DW+GRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWIGRRPMLIISSVLYFISGLIMFWSPNVYMLLLARLIDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+   P WRLMLGVLS+PSLLYF L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFAMSLNIRPDWRLMLGVLSVPSLLYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAVMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+D +GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGVISDSIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP++IRG LNTLPQF GSGGMFL+YCM+FGMS+  +P+WRLMLGVLSIPS+++FALTV
Sbjct  121  ETAPADIRGSLNTLPQFLGSGGMFLSYCMVFGMSLMNSPNWRLMLGVLSIPSIIFFALTV  180

Query  602  FYLPE  616
            FYLPE
Sbjct  181  FYLPE  185



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  596  TVFYLPE  616
            TVF LPE
Sbjct  181  TVFLLPE  187



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  596  TVFYLPE  616
            TVF LPE
Sbjct  181  TVFLLPE  187



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 2/186 (1%)
 Frame = +2

Query  65   NGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  238
            +GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  239  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  418
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  419  SETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALT  598
            SETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFALT
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFALT  182

Query  599  VFYLPE  616
            VFYLPE
Sbjct  183  VFYLPE  188



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GA++VA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAILVAVAAAIGNLLQGWDNATIAGSILYIKREFQLESQPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D LGRRPMLI+SS+ YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSLLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 2/186 (1%)
 Frame = +2

Query  65   NGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  238
            +GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  239  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  418
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  419  SETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALT  598
            SETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFALT
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFALT  182

Query  599  VFYLPE  616
            VFYLPE
Sbjct  183  VFYLPE  188



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD +GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSVGRRPMLIASAILYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPTPDWRLMLGVLSIPSLIYFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  268
            +IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+ITT SG ++DW+G
Sbjct  12   SIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIG  71

Query  269  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  448
            RRPMLILSS+ YF+S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLYISETAP EIRG
Sbjct  72   RRPMLILSSVLYFVSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLYISETAPPEIRG  131

Query  449  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL++PSL +F LT+F+LPE
Sbjct  132  LLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAVPSLFFFGLTIFFLPE  187



>ref|XP_010906859.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=549

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AATIGN LQGWDN+TIAGAV++IK+E  LE+   +EGL++AMSLIGAT+IT
Sbjct  1    MRGAVLVALAATIGNLLQGWDNSTIAGAVLFIKREFQLESEPTIEGLIIAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DW GRRPMLI +++F FLSGL+MLWSPNVY+LL+ARL++GFG+GLAVTLVP+Y
Sbjct  61   TFSGAVSDWFGRRPMLIAAAVFTFLSGLVMLWSPNVYILLLARLINGFGVGLAVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+F MS+ + P WR+MLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFVMSLMSNPDWRVMLGVLSIPSLIYLAL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GA +VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
              SG+I+DW GRRPMLI+SS+FYF SGL+MLWSPNVY+LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYFFSGLVMLWSPNVYILLLARLIDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+     WR+MLGVLSIPSL YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMVFGMSLMVQHDWRVMLGVLSIPSLFYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL  PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFAPSLIFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   MEGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAMEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+Y  L
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLSYCMVFGMSLTESASWRLMLGILSIPSLVYIIL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV  A+AAT+GN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFAALAATMGNLLQGWDNATIAGAVIYIKREFSLETQPTLEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI+SS+ YFL GL+MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIISSILYFLGGLVMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  AP WRLMLGV+SIPSLLY  L
Sbjct  121  ISETAPPEIRGQLNTLPQFTGSGGMFLSYCMVFGMSLMEAPRWRLMLGVISIPSLLYLGL  180

Query  596  TVFYLPE  616
             VFYLPE
Sbjct  181  MVFYLPE  187



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV++A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTGS GMFL+YCM+FGMS+T APSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLSYCMVFGMSLTQAPSWRLMLGVLSIPSLAYFFL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TLFYLPE  187



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y  L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLXL  180

Query  596  TVFYLPE  616
            TVF LPE
Sbjct  181  TVFLLPE  187



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLQSEPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG ++DWLGRRPMLILSS+ Y LSGL+MLWSPNV VLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLILSSVLYCLSGLVMLWSPNVSVLLLARLMDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTG+ GMF++YCM+F MS+  +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGAAGMFMSYCMVFAMSLKDSPSWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
             + +LPE
Sbjct  181  AILFLPE  187



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 170/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNV VLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   MCSGPISDMLGRRPLLIISSVLYFISGLIMLWSPNVSVLLLARLLDGFGIGLAVTLIPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWRLMLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRLMLGVLFIPSIIYFLL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+ +LPE
Sbjct  181  TLLFLPE  187



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+ +LPE
Sbjct  181  TLLFLPE  187



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA +VA+AATIGNFLQGWDNATIAGA+VYI  +L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINNDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSL+Y  L+V
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRGMLGVLSIPSLVYLFLSV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEXAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLW    Y+LL+AR LDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWXXXXYILLLARXLDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GAV+VAI ATIGN LQGWDNATIAGAV++IK+EL LE+   +EGL+VAMSLIGA L+T
Sbjct  1    MSGAVLVAIGATIGNLLQGWDNATIAGAVLFIKRELKLESDPTVEGLIVAMSLIGAVLVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T +G +ADWLGRRPMLI+SS+ YF+SGL+M WSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFAGGVADWLGRRPMLIVSSVLYFVSGLVMFWSPNVYVLLLGRLLDGFGVGLAVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISET+P EIRGLLNTLPQF GS GMFL+YCM+FGMS+T++PSWRLMLGVLSIPS+ YFA+
Sbjct  121  ISETSPPEIRGLLNTLPQFCGSLGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSIAYFAV  180

Query  596  TVFYLPE  616
             V YLPE
Sbjct  181  AVLYLPE  187



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLSYCMVFGMSLTDSASWRLMLGILSIPSLVYFVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAG+++YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAGSILYIKKEFKLDSEPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWVGRRPMLIISSILYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQF+GSGGMF++YCM+F MS+     WR+MLGVLSIPSLLYFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFSGSGGMFISYCMVFAMSLMVNSDWRVMLGVLSIPSLLYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLESQPLIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVVVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SGS++D  GRRPMLI+SS+FYFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGSVSDMFGRRPMLIISSVFYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FG+S+T +PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLSYCMVFGVSLTQSPSWRLMLGVLSIPSLAYFFL  180

Query  596  TVFYLPE  616
             +FYLPE
Sbjct  181  ALFYLPE  187



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV++A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTGS GMFL+YCM+FGMS+T APSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLSYCMVFGMSLTQAPSWRLMLGVLSIPSLAYFFL  180

Query  596  TVFYLPE  616
             +FYLPE
Sbjct  181  ALFYLPE  187



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLILSS+ YF S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDLIGRRPMLILSSILYFCSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   280 bits (716),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVMVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+ AD +GRRPML+ S++ YF+SGL+MLW+P+VY+LL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAAADCVGRRPMLVASAVLYFVSGLVMLWAPSVYILLLARLIDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPKPDWRLMLGVLSIPSLIYFGL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV++A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL YF  
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLAYFFF  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TLFYLPE  187



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV++A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL YF  
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLAYFFF  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TLFYLPE  187



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VAI A+IGN LQGWDNATIA AV+YIKKE  L  E  +EGL+V+MSLIGAT++T
Sbjct  1    MSGAVLVAIVASIGNLLQGWDNATIAAAVLYIKKEFQLQNEPTVEGLIVSMSLIGATIVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLILSS+ YF SGLIMLWSPNVYVLL+AR +DGFGIGLAVTLVPLY
Sbjct  61   TFSGPLSDSIGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARFVDGFGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE APSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS++ +P WR+MLGVL+IPSL +F L
Sbjct  121  ISEIAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLSPSPDWRIMLGVLAIPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL++FAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSLGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIFFAL  180

Query  596  TVFYLPE  616
            T+ +LPE
Sbjct  181  TLLFLPE  187



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FG+S+T +PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLSYCMVFGVSLTQSPSWRLMLGVLSIPSLAYFFL  180

Query  596  TVFYLPE  616
             +FYLPE
Sbjct  181  ALFYLPE  187



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +AD LGRRPMLILSS  YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSFLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDRVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YF+S ++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFVSSIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  APSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQEAPSWRLMLGVLSIPSILYFVLAAFFLPE  187



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+G+V+VA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  LE    MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLEGAPTMEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG ++D  GRRPM+I+SS+ +F S LIMLWSPNVYVLL+ RLLDGFG GLAVTLVPLY
Sbjct  61   TCSGPVSDRFGRRPMMIISSICFFFSALIMLWSPNVYVLLLGRLLDGFGSGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRG LNTLPQFTGSGGMF+AYCM+FGMS+   PSWRLMLG+L +PS LYFAL
Sbjct  121  ISETAPTDIRGSLNTLPQFTGSGGMFVAYCMVFGMSLMEKPSWRLMLGILVVPSALYFAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG ++D LGRRPMLI+SS+ YF+  L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGPLSDLLGRRPMLIISSILYFVGSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+F +S+T AP+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFSYCMVFAISLTKAPNWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++TTCSG ++D+LGRRP
Sbjct  17   NLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVTTCSGPLSDFLGRRP  76

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            MLI+SS+ YF S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLN
Sbjct  77   MLIISSVLYFASSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLN  136

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQFTGS GMF +YCM+F MS+T AP+WRLMLGVLSIPSL+YFALT+F+LPE
Sbjct  137  TLPQFTGSAGMFFSYCMVFAMSLTKAPNWRLMLGVLSIPSLIYFALTLFFLPE  189



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSL GAT++T
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLFGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG++AD +GRRPMLI S++ YF+SGL MLW+P+VYVLL+ARL+DG GIGLAVTLVPLY
Sbjct  61   TFSGALADSIGRRPMLIASAVLYFVSGLFMLWAPSVYVLLLARLIDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPKPDWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+G+V+VA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+I+DWLGRR +LI SS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLIFSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GA +VAI A+IGN LQGWDNATI+ A++YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DW+GR PMLILSS+ YF+S LIMLWSPNVYVLL+ARL++GFG+GLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRLPMLILSSVLYFVSSLIMLWSPNVYVLLLARLINGFGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL++PSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLALPSLFFFGL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAVIVA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D LGRRPMLI+SS+ YF+S L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSVLYFVSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP EIRGLLNTLPQFTGS GMF +YCM+FGMS+T +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLTKSPSWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+  LPE
Sbjct  181  TILLLPE  187



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+G+V+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFDLQSQPKIEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++DWLGRRPMLI SS+ YFLSGL+MLW+PNV +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIASSILYFLSGLVMLWAPNVEILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVLS PS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMDSPSWRLMLGVLSAPSIVYFVL  180

Query  596  TVFYLPE  616
             V +LPE
Sbjct  181  AVLFLPE  187



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 160/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAI A IGN LQG DNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAITAAIGNMLQGVDNATIAGAVMYIKREFHLETQPAVEGLVVATSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +AD +GRRPMLI SS+ YFL GL+MLWSPNVYVLLIARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADIVGRRPMLIASSLLYFLGGLVMLWSPNVYVLLIARLIDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNT PQFTGS GMF+AYCMIF M++   PSWR MLGVL+ PSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTFPQFTGSAGMFMAYCMIFTMTLHPGPSWRTMLGVLAGPSLIYLAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VAI A IGN LQGWDN+ IAG+++YIKKE  LE    +EGL++A SLIG TLIT
Sbjct  1    MKGAVAVAIVAAIGNLLQGWDNSVIAGSLLYIKKEFNLERKPTLEGLIIATSLIGGTLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI+SS+ +F SGL+MLW+PNVY+LL+ARLLDGFG GLAVTLVP+Y
Sbjct  61   TVSGPVSDRVGRRPMLIMSSVLFFFSGLVMLWAPNVYMLLVARLLDGFGTGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSGGMFLSYCMVFGMSLVKSPSWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGAVLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMF++YCM+F MS++ + SWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFISYCMVFYMSLSVSTSWRLMLGVLSIPSVLYFILTV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GA++VA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGALLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRGLLNTLPQFTGSGGMF++YCM+F MS++ + SWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFISYCMVFYMSLSVSTSWRLMLGVLSIPSVLYFILTV  180

Query  602  FYLPE  616
            F+LPE
Sbjct  181  FFLPE  185



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISET+P EIRG LNTLPQFTGSGGMF++YCMIF M+++ +P+WR+MLGVL +PSLLY  +
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMSYCMIFAMTLSPSPNWRIMLGVLFVPSLLYLFV  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISET+P EIRG LNTLPQFTGSGGMF++YCMIF M+++ +P+WR+MLGVL +PSLLY  +
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMSYCMIFAMTLSPSPNWRIMLGVLFVPSLLYLFV  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA+IGN LQGWDNATIA AV+YIK+E  LE+   MEGL+VAMSLIGA +IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAVAVLYIKREFNLESEPTMEGLIVAMSLIGAMIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
              SG+I+DW GRRPMLI+SS+FY  SGL+MLWSPNV +LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYLFSGLVMLWSPNVCILLLARLIDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM FGMS+     WR+MLGVLSIPSL YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMAFGMSLMVQHDWRVMLGVLSIPSLFYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TIFFLPE  187



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  268
            T+G+ L GWDNATIAGAV+YIKKE  LE+   +EGL+VA S+IGATLITTCSG IAD LG
Sbjct  12   TVGDLLYGWDNATIAGAVLYIKKEFNLESSPTLEGLIVATSIIGATLITTCSGPIADRLG  71

Query  269  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  448
            RRPM+I+SS+ +F+S LIMLWSPNVYVLL  RLLDGFG GLAVTL PLYISETAP++IRG
Sbjct  72   RRPMMIISSVCFFVSALIMLWSPNVYVLLFGRLLDGFGSGLAVTLGPLYISETAPTDIRG  131

Query  449  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
             LNTLPQFTGSGGMFLAYCM+FGMS+   PSWRLMLG+L +PS +YF LTVF+LPE
Sbjct  132  SLNTLPQFTGSGGMFLAYCMVFGMSLMETPSWRLMLGILFVPSTVYFLLTVFFLPE  187



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VA+AA IGN LQGWDN+ IAG+VVYIKKE  LE+    EGL+ A SLIGAT IT
Sbjct  1    MRGAVFVAVAAAIGNLLQGWDNSVIAGSVVYIKKEFELESEPTFEGLIAASSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG  +DWLGRR MLI+SS+ +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSVLFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+   P+WRLMLGV+SIPSLLYFAL
Sbjct  121  ISEIAPPDIRGRLNTLPQFTGSGGMFLSYCMVFGMSLMDLPNWRLMLGVVSIPSLLYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   267 bits (682),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VAIAA +GN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAASVLYIKREFNLESQPAVEGLIVAMSLIGATLVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG++ADW+GRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGAVADWIGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+F +S+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFAGSGGMFLSYCMVFVLSLTEAPSWRLMLGVLSIPSLVYFAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M+GAV VAIAATIGNFLQGWDNATIAGAV+YIKKE  LE+   MEG+++AM+LIG+T+IT
Sbjct  1    MSGAVWVAIAATIGNFLQGWDNATIAGAVLYIKKEFHLESDPKMEGILLAMALIGSTIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSGS++DWLGRR M+I S++ + +S +IMLWSPN+YVLL+ARL+DGFG GLAVTLVPLY
Sbjct  61   TCSGSVSDWLGRRLMMISSAICFIVSAVIMLWSPNIYVLLLARLVDGFGGGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+E RGLLNT+PQF  + GMFL+YCM+FGMS+  +PSWRLMLGVL +PS+LY AL
Sbjct  121  ISETAPTETRGLLNTVPQFAVAAGMFLSYCMVFGMSLAESPSWRLMLGVLLVPSVLYLAL  180

Query  596  TVFYLPE  616
            ++ YLPE
Sbjct  181  SILYLPE  187



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +2

Query  56   LRMNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATL  229
            LRM GAV+VAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+
Sbjct  45   LRMRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATV  104

Query  230  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP  409
            ITT SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP
Sbjct  105  ITTFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVP  164

Query  410  LYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYF  589
            +YISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR MLG+L +PSL+Y 
Sbjct  165  VYISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYL  224

Query  590  ALTVFYLPE  616
             LTV +LPE
Sbjct  225  VLTVMFLPE  233



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 169/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IG+ LQGWD+AT+AGAV+YI +E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGSLLQGWDSATMAGAVLYINREFKLEADPTIEGLIVAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            + SG+++DW+GRRP+LI++++  FLSGL+MLWSPNVY+LL+ARL+ GFG+G+AVTLVP+Y
Sbjct  61   SFSGALSDWVGRRPVLIVAAVLTFLSGLVMLWSPNVYILLLARLIYGFGVGIAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRGLLNTLPQF GSGGMFL+YC++FGMS+ + P WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFCGSGGMFLSYCVVFGMSLMSNPDWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            TVFYLPE
Sbjct  181  TVFYLPE  187



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 164/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VA SLIGAT +T
Sbjct  1    MGGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVATSLIGATAVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T +G++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DG GIGLA+T+VPLY
Sbjct  61   TIAGAVADSIGRRPVLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGLGIGLALTIVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRG LNTLPQF  +GGMFL+YCM+FGMS+   P+WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTEIRGSLNTLPQFNATGGMFLSYCMVFGMSLFPKPNWRIMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
             VFYLPE
Sbjct  181  AVFYLPE  187



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VA+AA IGN LQGWDN+ IAG+V+YIKKE  LE+    EGL+VA SLIGAT+IT
Sbjct  1    MRGAVYVAVAAAIGNMLQGWDNSVIAGSVLYIKKEFSLESKPTFEGLIVATSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG  +DWLGRR MLI+SS+ +FLSGL+MLWSPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIMSSLLFFLSGLVMLWSPNVYVLLYARLLDGFGTGLAVTLVPAY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP +IRG LNTLPQFTGS GMFL+YCM+FGMS+   P+WR+MLGVLSIPSL Y  L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSAGMFLSYCMVFGMSLMDTPNWRMMLGVLSIPSLAYLVL  180

Query  596  TVFYLPE  616
            TV YLPE
Sbjct  181  TVLYLPE  187



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGV+SIPSL+YF+L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVVSIPSLVYFSL  180

Query  596  TVFYLPE  616
             VFYLPE
Sbjct  181  AVFYLPE  187



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGV+SIPSL+YF+L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLSYCMVFGMSMMDSPSWRLMLGVVSIPSLVYFSL  180

Query  596  TVFYLPE  616
             VFYLPE
Sbjct  181  AVFYLPE  187



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 164/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYLVL  180

Query  596  TVFYLPE  616
            TV +LPE
Sbjct  181  TVMFLPE  187



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 165/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSE+RG LNTLPQF GSGGMFL+YCM+F MS+  +PSWRLMLG LSIP+++Y AL
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLSYCMVFFMSMMDSPSWRLMLGTLSIPAVIYLAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 165/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSE+RG LNTLPQF GSGGMFL+YCM+F MS+  +PSWRLMLG LSIP+++Y AL
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLSYCMVFFMSMMDSPSWRLMLGTLSIPAVIYLAL  180

Query  596  TVFYLPE  616
            T+F+LPE
Sbjct  181  TLFFLPE  187



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PS+++F L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSIVFFFL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VA+AA +GN LQGWDN+TIAG+++YIKKE  L+T   MEGL+ AMSLIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNSTIAGSLLYIKKEFNLQTQPTMEGLIAAMSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D  GRRP++I+S++ YFLSGL+M W+PNVYVLL+ RLL+GFGIGLAVT+VP+Y
Sbjct  61   TFSGPVSDIYGRRPLMIISAIMYFLSGLVMFWAPNVYVLLLGRLLNGFGIGLAVTIVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRG LNT PQF GSGGMF++YCM+FGMS+  +P WR+MLGVLSIPS+ Y  L
Sbjct  121  ISETAPSEIRGQLNTFPQFMGSGGMFVSYCMVFGMSLMDSPKWRVMLGVLSIPSIAYLVL  180

Query  596  TVFYLPE  616
            T+FYLPE
Sbjct  181  TIFYLPE  187



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQFTGS GMF +YCM+FGMS+T +PSWR MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFXSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYLVL  180

Query  596  TVFYLPE  616
            TV +LPE
Sbjct  181  TVMFLPE  187



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 164/187 (88%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V++LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMITSSILYFTSGLVMLWAPDVHILLLARLLDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR+MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRMMLGLLFMPSLIYLVL  180

Query  596  TVFYLPE  616
            T  +LPE
Sbjct  181  TFMFLPE  187



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 148/174 (85%), Gaps = 2/174 (1%)
 Frame = +2

Query  101  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            GN LQGWDNAT+AGA++YIKKE   E    MEGL VAMSLIGATLIT CSG I+DWLGRR
Sbjct  14   GNLLQGWDNATMAGAIIYIKKEFEWENEPTMEGLSVAMSLIGATLITLCSGGISDWLGRR  73

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI+SSMFYF+SG++MLWSPNVY LL ARLLDGFGIGLAVT VPLYISE +P EIRG+L
Sbjct  74   PMLIVSSMFYFVSGVLMLWSPNVYSLLCARLLDGFGIGLAVTFVPLYISEMSPPEIRGVL  133

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            +TL QFT S G+FL+Y  +F MS+T + SWRLMLGVL  PSL+YFALT+FYLPE
Sbjct  134  STLSQFTYSSGIFLSYSFVFCMSLTESSSWRLMLGVLFAPSLIYFALTLFYLPE  187



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSGS++DWLGRRP+LI+SS+ YFLSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSLSDWLGRRPILIISSLLYFLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLP F+G  GMFL+YCM+FGMS+TT P+WRLMLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLSYCMVFGMSLTTLPNWRLMLGVLSIPSLVYLAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA +GN LQGWDNATIAGAV+Y+K+E  LE+   +EGL+VA SLIGAT IT
Sbjct  1    MKGAVLVAIAAAVGNLLQGWDNATIAGAVLYVKREFHLESQPTVEGLIVATSLIGATFIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG  +D  GRRPML+LSS+ YF+SG++MLW+P+V +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TISGPASDSFGRRPMLLLSSILYFVSGIVMLWAPSVEILLLARLLDGFGIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQFTGS GMFL+YCM+F MS+  +PSWRLMLG+LS+PS++YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSVGMFLSYCMVFTMSLMDSPSWRLMLGILSLPSVVYFFL  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  AVFFLPE  187



>ref|XP_002532480.1| sugar transporter, putative [Ricinus communis]
 gb|EEF29904.1| sugar transporter, putative [Ricinus communis]
Length=536

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = +2

Query  101  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            GN LQGWDNATIAG+++YIK+E  L+T   MEGL+ A++LIGAT+IT  +G ++D LGRR
Sbjct  14   GNMLQGWDNATIAGSLLYIKREFNLQTQPTMEGLIAAVALIGATIITIFTGPVSDLLGRR  73

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI+S++ YFLSGL+M+W+PNVY+L++ R+LDGFG GLAVTLVP+YISETAP EIRG L
Sbjct  74   PMLIISAIMYFLSGLVMVWAPNVYILILGRVLDGFGTGLAVTLVPVYISETAPPEIRGQL  133

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NT PQF GSGGMF++YCM+FGMS+   P+WRLMLGVLSIPS+ Y ALT+ +LPE
Sbjct  134  NTFPQFMGSGGMFVSYCMVFGMSLMDTPNWRLMLGVLSIPSIGYLALTILFLPE  187



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  LET+  +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLETHPAIEGLVVATSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG +AD +GRRPMLI SS+ YFL GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADMVGRRPMLIASSILYFLGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GM ++Y MIF M++   PSWR+MLGVL  PSL+Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSWGMCMSYTMIFVMTLKADPSWRIMLGVLFAPSLVYLVL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDRVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVLAAFFLPE  187



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDRVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVLAAFFLPE  187



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDRVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVLAAFFLPE  187



>gb|KEH36403.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=645

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAVIVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP EIRG LNTLPQF GS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+  LPE
Sbjct  181  TLLLLPE  187



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   256 bits (653),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M+GAV+VA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSGS++DWLGRRP+LI+SS+ Y LSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSMSDWLGRRPILIISSLLYCLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLP F+G  GMFL+YCM+FGMS+TT P+WRLMLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLSYCMVFGMSLTTLPNWRLMLGVLSIPSLVYLAL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQKSPSWRLMLGVLSIPSVLYFLLAAFFLPE  187



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS L+M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSLVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSVLYFILAAFFLPE  187



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQKSPSWRLMLGVLSIPSVLYFLLAAFFLPE  187



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGPVSDRVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R ML+LSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLVLSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++F MS+  +PSWRLMLGVLSIPS++YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFAMSLQESPSWRLMLGVLSIPSIIYFVLAAFFLPE  187



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +2

Query  98   IGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLITTCSGSIADWLGR  271
            IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+ITT SG ++D +GR
Sbjct  13   IGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMITTFSGPVSDKVGR  72

Query  272  RPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGL  451
            R MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+YISETAPSEIRGL
Sbjct  73   RSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGL  132

Query  452  LNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            LNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L  F+LPE
Sbjct  133  LNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVLAAFFLPE  187



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M+GAVIVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISE AP EIRG LNTLPQF GS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  596  TVFYLPE  616
            T+  LPE
Sbjct  181  TLLLLPE  187



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = +2

Query  140  GAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  313
            G+++YIKKE  LE    +EGL+VAMSLIGAT++TTCSG+++D LGRRPMLI+SSM YF+S
Sbjct  14   GSIMYIKKEFQLENEPTVEGLIVAMSLIGATVVTTCSGALSDLLGRRPMLIISSMLYFVS  73

Query  314  GLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMF  493
             L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLNTLPQFTGS GMF
Sbjct  74   SLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLNTLPQFTGSLGMF  133

Query  494  LAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
             +YCM+FGMS+  APSWR+MLGVLSIPSL++FALT+ +LPE
Sbjct  134  FSYCMVFGMSLMKAPSWRIMLGVLSIPSLIFFALTLLFLPE  174



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  206  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  385
            MSLIGAT ITTCSG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGI
Sbjct  1    MSLIGATAITTCSGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGI  60

Query  386  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  565
            GLAVTLVP+YISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL
Sbjct  61   GLAVTLVPVYISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVL  120

Query  566  SIPSLLYFALTVFYLPE  616
            SIPSLLYFA TVFYLPE
Sbjct  121  SIPSLLYFAFTVFYLPE  137



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  LE +  MEGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLEAHPAMEGLVVATSLIGATVIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI SS+ YF +GL+MLWSPNV+VLL++RL+DGF IGLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIASSLLYFAAGLLMLWSPNVHVLLLSRLVDGFAIGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+F M++   P WRLMLGVLS+ SL Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFAMTLAPQPDWRLMLGVLSLLSLAYLLL  180

Query  596  TVFYLPE  616
            TV YLPE
Sbjct  181  TVLYLPE  187



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 149/185 (81%), Gaps = 25/185 (14%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M GAV+VAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
            SG +ADW                              LI+RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWTHDDN-------------------------LISRLLDGFGIGLAVTLVPVYIS  95

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  96   ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  155

Query  602  FYLPE  616
            F+LPE
Sbjct  156  FFLPE  160



>gb|EYU43535.1| hypothetical protein MIMGU_mgv1a002513mg [Erythranthe guttata]
Length=665

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  206  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  385
            MSLIGAT+ITTCSG+I+D +GRRPMLI+SSMFYFLSG+IMLWSPNVYVLL+ARLLDGFGI
Sbjct  1    MSLIGATVITTCSGTISDSVGRRPMLIVSSMFYFLSGIIMLWSPNVYVLLLARLLDGFGI  60

Query  386  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  565
            GLAVTLVPLYISETAPSEIRG LNTLPQF GSGGMFLAYCM+F MS+  +PSWRLMLGVL
Sbjct  61   GLAVTLVPLYISETAPSEIRGQLNTLPQFLGSGGMFLAYCMVFSMSLLPSPSWRLMLGVL  120

Query  566  SIPSLLYFALTVFYLPE  616
            SIPSLLYFA TVFYLPE
Sbjct  121  SIPSLLYFAFTVFYLPE  137



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 160/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLETQPALEGLVVATSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPMLI SS+ YF  GLIM+WSPNV VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDNVGRRPMLIASSLLYFAGGLIMMWSPNVVVLLLARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSFGMFFSYCMIFYMTLAPSPSWRFMLGVLSLPSLAYLAL  180

Query  596  TVFYLPE  616
            TV YLPE
Sbjct  181  TVLYLPE  187



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 148/174 (85%), Gaps = 2/174 (1%)
 Frame = +2

Query  101  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            GN LQGWDNATIAGA++YIK+E  LE+   +EGL+VA+SL+GA L+TTCSG++AD +GRR
Sbjct  14   GNLLQGWDNATIAGAILYIKREFHLESEPAVEGLIVAISLLGAILVTTCSGAMADCIGRR  73

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PML++SS FY +SGL+M WSPN+Y LL+AR + GFG+GL VTLVPLY+SE AP EIRGLL
Sbjct  74   PMLVMSSHFYLISGLLMFWSPNLYALLLARFVGGFGVGLTVTLVPLYVSELAPPEIRGLL  133

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NTLPQF+GS GMF++Y ++FG+S+  +PSWRLMLGVLSIPSL+Y  + +  LPE
Sbjct  134  NTLPQFSGSCGMFVSYSLVFGLSLMHSPSWRLMLGVLSIPSLVYVXVAILLLPE  187



>ref|XP_010029563.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56481.1| hypothetical protein EUGRSUZ_I02209 [Eucalyptus grandis]
Length=738

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAATIG  LQGWD +TIAG+V+YIK E  L+    +EGL+VAMSLIG+T IT
Sbjct  1    MRGAVLVAIAATIGTMLQGWDGSTIAGSVLYIKGEFDLQEQPTIEGLIVAMSLIGSTAIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D LGRRPM+I+ S+  F S LIMLW+PNVYVLL+ RL  GFGIG+A+TLVP+Y
Sbjct  61   TFSGPLSDSLGRRPMMIICSVLSFASALIMLWAPNVYVLLLGRLFSGFGIGIAITLVPIY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAPSEIRG LNT+PQF  S GMFL+YC++FG+S+  +PSWRLMLG  S+PSL+YF L
Sbjct  121  ISETAPSEIRGQLNTIPQFANSSGMFLSYCLVFGVSLMESPSWRLMLGFFSLPSLIYFLL  180

Query  596  TVFYLPE  616
            TVF+LPE
Sbjct  181  TVFFLPE  187



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIAR  364
            MEGLVVAMSLIGAT+ITTCSG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +AR
Sbjct  1    MEGLVVAMSLIGATVITTCSGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLAR  60

Query  365  LLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSW  544
            LLDGFGIGLAVTLVP+YISETAPS+IRG LNTLPQF+GSGGMFL+YCM+F MS++ +PSW
Sbjct  61   LLDGFGIGLAVTLVPVYISETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFVMSLSPSPSW  120

Query  545  RLMLGVLSIPSLLYFALTVFYLPE  616
            R+MLGVLSIPSL YF LTVF+LPE
Sbjct  121  RIMLGVLSIPSLFYFLLTVFFLPE  144



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQ TGS GMFL+YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLSYCMIFYMTLGDSPSWRFMLGVLSVPSLAYLAL  180

Query  596  TVFYLPE  616
            TV YLPE
Sbjct  181  TVLYLPE  187



>ref|XP_006662557.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=717

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = +2

Query  143  AVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSG  316
            AV+YIKKE  L  E  +EGL+VAMSLIGAT++T+  G +AD +GRRPMLI S++ YF+SG
Sbjct  4    AVLYIKKEFNLQSEPLIEGLIVAMSLIGATVVTSFCGVVADSVGRRPMLIASAVLYFVSG  63

Query  317  LIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFL  496
            L+MLW+P+VYVLL+ARL+DGFGIGLAVTLVP+YISET+PS+IRGLLNTLPQF+GSGGMFL
Sbjct  64   LVMLWAPSVYVLLLARLIDGFGIGLAVTLVPMYISETSPSDIRGLLNTLPQFSGSGGMFL  123

Query  497  AYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            +YCM+FGMS+   P WR+MLGVLSIPS +YFALTVFYLPE
Sbjct  124  SYCMVFGMSLMPQPEWRVMLGVLSIPSFIYFALTVFYLPE  163



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRG LNTLPQ TGS GMFL+YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLSYCMIFYMTLGDSPSWRFMLGVLSVPSLAYLAL  180

Query  596  TVFYLPE  616
            TV YLPE
Sbjct  181  TVLYLPE  187



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GA +VA+AA +GN LQGWDNATIAG+++YIK++  L+    ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLDAQPALQGLVVATSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPML+ SS+ Y L+GL+MLWSP V VLL+ARL+DGF +GLAVTLVP+Y
Sbjct  61   TFSGPLSDHVGRRPMLVASSLLYALAGLLMLWSPTVGVLLLARLVDGFAVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP E+RGLL+TLPQ TGS GMFL+YCM+F M++  +P+WRLM+GVL +PSLLY A+
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLSYCMVFAMTLAPSPNWRLMMGVLVLPSLLYVAV  180

Query  596  TVFYLPE  616
             VF+LPE
Sbjct  181  AVFFLPE  187



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  235
            M GA +VA+AA +GN LQGWDNATIAG+++YIK++  L  +  ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLHGQPALQGLVVATSLIGATLIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SGS++D +GRRPML+ SS+ Y L+G++MLWSP V VLL+ARL+ GF +GLAVTL+P+Y
Sbjct  61   TFSGSLSDRVGRRPMLVASSLLYTLAGMLMLWSPTVGVLLLARLVGGFAVGLAVTLIPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP E+RGLL+TLPQ TGS GMFLAYCM+F M++  +P+WR+M+GVL +PSL+Y A+
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLAYCMVFAMTLAPSPNWRVMMGVLVLPSLVYVAV  180

Query  596  TVFYLPE  616
             + +LPE
Sbjct  181  AMLFLPE  187



>gb|KHG04802.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22590.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=690

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  206  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  385
            MSLIGAT ITTCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+
Sbjct  1    MSLIGATCITTCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGV  60

Query  386  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  565
            GLAVTLVP+YISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS++  P+WRLMLGVL
Sbjct  61   GLAVTLVPVYISETAPPEIRGLLNTLPQFTGSIGMFFSYCMVFGMSLSELPNWRLMLGVL  120

Query  566  SIPSLLYFALTVFYLPE  616
            SIPSL+YF LT+F+LPE
Sbjct  121  SIPSLIYFILTIFFLPE  137



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = +2

Query  104  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  277
            N LQGWDNATIAG+++YIK+E  LE +  +EGLVVA SLIGAT++TT SG ++D +GRRP
Sbjct  16   NMLQGWDNATIAGSLLYIKREFRLEGHPALEGLVVATSLIGATVVTTFSGPLSDSVGRRP  75

Query  278  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  457
            ML+ SS+ Y L+GL+MLWSPNV +LL++RL+ G  +GLAVTLVP+YISETAP+E RG LN
Sbjct  76   MLVASSLLYALAGLLMLWSPNVQLLLLSRLVGGLAVGLAVTLVPVYISETAPAETRGRLN  135

Query  458  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            TLPQ TGS GMFL YC +F ++++++P WRLMLGV+ +P+LLY  + V++LPE
Sbjct  136  TLPQLTGSAGMFLGYCFVFAVTLSSSPDWRLMLGVVFLPALLYVGVAVWFLPE  188



>gb|KHG00737.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=726

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 35/185 (19%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  241
            M G V+VA+AA IGNFLQGWD ATIAG                                 
Sbjct  30   MGGPVLVAVAAAIGNFLQGWDTATIAGY--------------------------------  57

Query  242  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  421
               I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+YIS
Sbjct  58   ---ISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVYIS  114

Query  422  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  601
            ETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFALTV
Sbjct  115  ETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFALTV  174

Query  602  FYLPE  616
            F+LPE
Sbjct  175  FFLPE  179



>ref|XP_003537696.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
 gb|KHN41803.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=722

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            T+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG+++D +GRR
Sbjct  12   TLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFITGTIVTLFSGTVSDLVGRR  71

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP++IRG L
Sbjct  72   PMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAPADIRGQL  131

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NTL QF  SGGMF AY ++F MS++ +PSWRLMLGV+ IP++ YF L VFYLPE
Sbjct  132  NTLTQFACSGGMFFAYILVFSMSLSDSPSWRLMLGVIFIPAIAYFLLAVFYLPE  185



>ref|XP_003517121.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=722

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            T+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++ D +GRR
Sbjct  12   TLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFIIGTVVTIFSGTVCDLVGRR  71

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP++IRG L
Sbjct  72   PMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAPADIRGQL  131

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NTL QF  SGGMFLAY ++F MS++ +PSWRLMLGV+ IP++ YF L VFYLPE
Sbjct  132  NTLTQFACSGGMFLAYILVFSMSLSDSPSWRLMLGVIFIPAVAYFLLAVFYLPE  185



>ref|XP_007158028.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
 gb|ESW30022.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
Length=720

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   TIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRR  274
            TIGN L GWD++TIA  + YIKK+ +L+  +EGL+V+MS I  T++T  SG+++D +GRR
Sbjct  12   TIGNLLMGWDSSTIAAGMTYIKKDFILDATIEGLIVSMSFITGTVVTIFSGAVSDMVGRR  71

Query  275  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  454
            PMLI SS+ +FLSGLIM W+PNV V+L+AR+++G  I LAVTL PLYISE AP++IRG L
Sbjct  72   PMLITSSVMFFLSGLIMFWAPNVAVILVARIVNGVAIALAVTLNPLYISEVAPADIRGQL  131

Query  455  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPE  616
            NT  QF  SGGM LAY M+F MS+T +PSWRLMLGV+SIP++ Y  L VFYLPE
Sbjct  132  NTFTQFACSGGMLLAYIMVFSMSLTDSPSWRLMLGVISIPAVAYILLAVFYLPE  185



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  62   MNGavivaiaaTIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  235
            M GAV+VAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNLLQGWDNATIAGAVIYIKREFHLETQPAVEGLLVATSLIGATIIT  60

Query  236  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  415
            T SG ++D +GRRPML+ SS+ YF  GLIMLWSPNV VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDIVGRRPMLVASSLLYFAGGLIMLWSPNVLVLLLARLVDGFGVGLAVTLVPVY  120

Query  416  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  595
            ISETAP EIRGLLNTLPQFTGS GMF +YCMIF M++   PSWR MLGVL +PSL Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSFGMFFSYCMIFYMTLGDHPSWRFMLGVLFLPSLAYLAL  180

Query  596  TVFYLPE  616
            T+ YLPE
Sbjct  181  TLLYLPE  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090