BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS167F01

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    125   5e-29   
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-29   Cucumis sativus [cucumbers]
ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    124   9e-29   Sesamum indicum [beniseed]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Cucumis melo [Oriental melon]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    124   1e-28   Gossypium raimondii
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Tarenaya hassleriana [spider flower]
emb|CDP14623.1|  unnamed protein product                                123   2e-28   Coffea canephora [robusta coffee]
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    122   5e-28   
emb|CBI39439.3|  unnamed protein product                                121   7e-28   Vitis vinifera
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    121   8e-28   Vitis vinifera
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-27   Nicotiana tomentosiformis
gb|KHG00472.1|  hypothetical protein F383_20103                         120   1e-27   Gossypium arboreum [tree cotton]
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    120   1e-27   Nicotiana sylvestris
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    120   2e-27   Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Glycine max [soybeans]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    120   2e-27   Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Glycine max [soybeans]
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    119   5e-27   
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    119   5e-27   Arabis alpina [alpine rockcress]
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             119   5e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          119   6e-27   
ref|XP_002518223.1|  receptor protein kinase, putative                  117   2e-26   Ricinus communis
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    117   3e-26   Brassica rapa
emb|CDY20032.1|  BnaA09g02190D                                          117   3e-26   Brassica napus [oilseed rape]
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    116   4e-26   Solanum tuberosum [potatoes]
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    116   5e-26   Solanum lycopersicum
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    115   9e-26   Populus euphratica
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    115   9e-26   Medicago truncatula
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    115   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    115   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    115   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    115   1e-25   Brassica rapa
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                114   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    114   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             113   6e-25   Capsella rubella
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    113   7e-25   Citrus sinensis [apfelsine]
emb|CDY00141.1|  BnaC09g01600D                                          112   9e-25   
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             112   1e-24   Citrus clementina [clementine]
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    112   1e-24   Eucalyptus grandis [rose gum]
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    112   1e-24   
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    110   4e-24   Populus euphratica
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    110   5e-24   Fragaria vesca subsp. vesca
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    109   2e-23   Malus domestica [apple tree]
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    109   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             108   2e-23   
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-23   Cicer arietinum [garbanzo]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-23   Pyrus x bretschneideri [bai li]
gb|EPS70115.1|  hypothetical protein M569_04636                         105   3e-22   Genlisea aurea
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    102   3e-21   Elaeis guineensis
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         100   2e-20   Jatropha curcas
gb|KJB67930.1|  hypothetical protein B456_010G218400                  99.4    3e-20   Gossypium raimondii
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg           98.6    5e-20   
gb|KJB67929.1|  hypothetical protein B456_010G218400                  98.6    6e-20   Gossypium raimondii
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein     98.2    8e-20   Arabis alpina [alpine rockcress]
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  98.2    8e-20   Prunus mume [ume]
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...  96.3    1e-19   
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...  97.4    2e-19   Nicotiana sylvestris
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein     97.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598            97.1    2e-19   Selaginella moellendorffii
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079           96.7    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...  96.7    3e-19   Vitis vinifera
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...  96.3    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...  96.3    4e-19   Brassica rapa
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...  95.9    5e-19   Populus euphratica
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg           95.9    5e-19   
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...  95.9    5e-19   Populus euphratica
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg           95.9    5e-19   Capsella rubella
gb|KJB73018.1|  hypothetical protein B456_011G209800                  95.9    5e-19   Gossypium raimondii
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g           95.9    6e-19   
gb|KHG09451.1|  hypothetical protein F383_09289                       95.5    6e-19   Gossypium arboreum [tree cotton]
gb|KHG03607.1|  hypothetical protein F383_26757                       95.5    6e-19   Gossypium arboreum [tree cotton]
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...  95.5    7e-19   Populus euphratica
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g           95.5    7e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  95.5    7e-19   
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...  95.5    7e-19   Nicotiana tomentosiformis
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...  95.1    9e-19   
emb|CBI25352.3|  unnamed protein product                              94.7    1e-18   Vitis vinifera
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...  95.1    1e-18   Solanum tuberosum [potatoes]
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...  95.1    1e-18   
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...  94.7    1e-18   Elaeis guineensis
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...  94.7    1e-18   Morus notabilis
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...  94.4    1e-18   Cucumis melo [Oriental melon]
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...  94.4    1e-18   Citrus sinensis [apfelsine]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...  94.4    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...  94.4    2e-18   Cucumis sativus [cucumbers]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg           94.4    2e-18   
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...  94.4    2e-18   Phoenix dactylifera
emb|CDX72142.1|  BnaC08g27320D                                        94.4    2e-18   
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                 94.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...  94.0    2e-18   Populus euphratica
gb|AAL49790.1|  unknown protein                                       94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688            94.0    2e-18   
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...  94.0    2e-18   Populus euphratica
emb|CDY27220.1|  BnaA09g35820D                                        94.0    2e-18   Brassica napus [oilseed rape]
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...  94.0    2e-18   Solanum tuberosum [potatoes]
gb|EEC75203.1|  hypothetical protein OsI_11455                        94.0    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...  94.0    2e-18   Cucumis sativus [cucumbers]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...  93.6    3e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21644.1|  hypothetical protein JCGZ_03315                       93.6    3e-18   Jatropha curcas
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg           93.6    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...  93.6    3e-18   
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...  93.6    3e-18   
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...  93.2    4e-18   Elaeis guineensis
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...  93.2    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...  93.2    4e-18   Setaria italica
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...  93.2    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...  93.2    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...  93.2    4e-18   Populus euphratica
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...  93.2    5e-18   Solanum lycopersicum
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...  93.2    5e-18   
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...  91.7    5e-18   
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...  92.8    5e-18   Solanum lycopersicum
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...  92.4    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...  92.4    8e-18   
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...  92.4    8e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...  92.0    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg           92.0    1e-17   Prunus persica
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  92.0    1e-17   
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...  92.0    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...  92.0    1e-17   Prunus mume [ume]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...  92.0    1e-17   
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg              91.7    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160        91.7    1e-17   Sorghum bicolor [broomcorn]
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...  91.7    2e-17   Glycine max [soybeans]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...  91.3    2e-17   Cucumis melo [Oriental melon]
gb|EPS70735.1|  hypothetical protein M569_04020                       91.3    2e-17   Genlisea aurea
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...  91.7    2e-17   
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...  90.9    2e-17   Eucalyptus grandis [rose gum]
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...  90.9    3e-17   Nicotiana sylvestris
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...  90.5    4e-17   Fragaria vesca subsp. vesca
ref|XP_002520879.1|  ATP binding protein, putative                    90.5    4e-17   Ricinus communis
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...  90.5    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  90.5    4e-17   
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...  90.1    5e-17   Cicer arietinum [garbanzo]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g           89.7    5e-17   Phaseolus vulgaris [French bean]
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg              89.7    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...  89.7    6e-17   Sesamum indicum [beniseed]
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg           89.7    6e-17   
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...  89.7    7e-17   Citrus sinensis [apfelsine]
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...  89.7    7e-17   Prunus mume [ume]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg           89.7    7e-17   
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                 89.7    7e-17   Citrus sinensis [apfelsine]
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...  89.4    7e-17   Solanum lycopersicum
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...  89.4    7e-17   Glycine max [soybeans]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...  89.4    8e-17   Glycine max [soybeans]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...  89.4    8e-17   Tarenaya hassleriana [spider flower]
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...  89.0    1e-16   Brachypodium distachyon [annual false brome]
ref|NP_001050035.1|  Os03g0335500                                     89.0    1e-16   
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein      89.0    1e-16   Medicago truncatula
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...  88.6    1e-16   Ricinus communis
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...  88.6    1e-16   
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809           84.0    2e-16   
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...  88.2    2e-16   
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...  88.2    2e-16   Cucumis sativus [cucumbers]
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  88.2    2e-16   Sesamum indicum [beniseed]
emb|CBI18033.3|  unnamed protein product                              87.8    2e-16   Vitis vinifera
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...  87.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...  87.8    2e-16   Vitis vinifera
ref|XP_003605286.1|  Receptor-like protein kinase                     87.4    3e-16   Medicago truncatula
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...  87.4    3e-16   Eucalyptus grandis [rose gum]
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...  87.4    4e-16   Nicotiana tomentosiformis
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...  87.4    4e-16   
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...  87.4    4e-16   Oryza brachyantha
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...  87.4    4e-16   Nicotiana sylvestris
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370        87.4    4e-16   Amborella trichopoda
dbj|BAK06250.1|  predicted protein                                    87.0    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g           87.0    5e-16   Phaseolus vulgaris [French bean]
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...  87.0    5e-16   Cucumis melo [Oriental melon]
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...  86.7    6e-16   
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...  86.7    6e-16   Solanum tuberosum [potatoes]
gb|KJB71525.1|  hypothetical protein B456_011G127000                  86.7    7e-16   Gossypium raimondii
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...  86.7    7e-16   Glycine max [soybeans]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...  86.7    8e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...  86.3    8e-16   Pyrus x bretschneideri [bai li]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...  86.3    8e-16   Glycine soja [wild soybean]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...  86.3    8e-16   Glycine max [soybeans]
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g           85.9    1e-15   Phaseolus vulgaris [French bean]
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...  85.9    1e-15   Cicer arietinum [garbanzo]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...  85.9    1e-15   
gb|EAZ26832.1|  hypothetical protein OsJ_10748                        85.9    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...  85.5    2e-15   Tarenaya hassleriana [spider flower]
emb|CDP13903.1|  unnamed protein product                              85.1    2e-15   Coffea canephora [robusta coffee]
dbj|BAB92869.1|  putative receptor-like protein kinase                85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                        85.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_003623626.1|  Receptor-like protein kinase                     83.6    6e-15   
gb|AES79844.2|  LRR receptor-like kinase family protein               83.6    6e-15   Medicago truncatula
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...  83.6    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001771841.1|  predicted protein                                83.6    7e-15   
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...  83.6    8e-15   Brassica rapa
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...  83.6    8e-15   Sesamum indicum [beniseed]
emb|CDY04822.1|  BnaAnng00040D                                        83.6    8e-15   
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...  83.2    9e-15   Fragaria vesca subsp. vesca
ref|XP_001769840.1|  predicted protein                                82.4    2e-14   
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...  82.0    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...  82.0    2e-14   Setaria italica
gb|ACN33819.1|  unknown                                               81.6    3e-14   Zea mays [maize]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...  81.6    3e-14   
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350        81.3    4e-14   
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880           81.3    4e-14   
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg           80.9    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...  80.5    7e-14   Elaeis guineensis
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                  80.5    8e-14   Arabis alpina [alpine rockcress]
ref|NP_195809.1|  leucine-rich receptor-like protein kinase           80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor   78.6    1e-13   
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg           79.7    1e-13   Capsella rubella
dbj|BAB85306.1|  putative receptor-like protein kinase                79.3    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76307.1|  hypothetical protein OsI_04242                        79.3    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...  79.3    2e-13   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...  79.3    2e-13   
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...  79.3    2e-13   
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...  79.0    2e-13   
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...  78.2    4e-13   Zea mays [maize]
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...  78.2    5e-13   Morus notabilis
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  77.4    7e-13   
dbj|BAF79960.1|  receptor-like kinase                                 77.4    8e-13   Marchantia polymorpha
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...  77.0    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240        75.9    2e-12   Sorghum bicolor [broomcorn]
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...  75.1    4e-12   Setaria italica
dbj|BAJ85468.1|  predicted protein                                    74.7    5e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055847.2|  Os05g0478300                                     74.3    7e-12   
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480        73.6    1e-11   Sorghum bicolor [broomcorn]
dbj|BAD15537.1|  hypothetical protein                                 70.1    2e-11   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...  72.4    3e-11   
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...  72.0    4e-11   
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189           72.0    4e-11   
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  71.2    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...  68.9    4e-10   Brachypodium distachyon [annual false brome]
gb|EEE64100.1|  hypothetical protein OsJ_18931                        66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  66.2    2e-09   Zea mays [maize]
emb|CDX85183.1|  BnaC07g24940D                                        63.2    2e-08   
gb|KDO45821.1|  hypothetical protein CISIN_1g002063mg                 62.0    6e-08   Citrus sinensis [apfelsine]
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                 62.0    6e-08   Citrus sinensis [apfelsine]
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1     62.0    6e-08   Populus euphratica
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg           62.0    6e-08   Citrus clementina [clementine]
ref|XP_002980098.1|  hypothetical protein SELMODRAFT_30384            61.6    9e-08   
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...  61.6    9e-08   Citrus sinensis [apfelsine]
gb|KHG21726.1|  Serine/threonine-protein kinase BRI1-like 1           61.2    1e-07   Gossypium arboreum [tree cotton]
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  60.8    1e-07   Nicotiana sylvestris
gb|KJB63147.1|  hypothetical protein B456_009G455100                  60.8    2e-07   Gossypium raimondii
ref|XP_002992683.1|  hypothetical protein SELMODRAFT_40400            60.5    2e-07   
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   Cucumis melo [Oriental melon]
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     60.1    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           59.7    3e-07   Prunus persica
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   Cicer arietinum [garbanzo]
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   Cucumis sativus [cucumbers]
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  59.3    4e-07   Prunus mume [ume]
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           59.3    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  59.3    4e-07   
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  59.3    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  58.9    5e-07   Fragaria vesca subsp. vesca
emb|CDY14823.1|  BnaC04g48200D                                        58.5    7e-07   Brassica napus [oilseed rape]
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388           57.8    8e-07   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558            58.2    1e-06   Selaginella moellendorffii
emb|CDP14870.1|  unnamed protein product                              57.8    1e-06   Coffea canephora [robusta coffee]
emb|CDY47962.1|  BnaA04g24400D                                        57.8    1e-06   Brassica napus [oilseed rape]
ref|XP_009590363.1|  PREDICTED: probable inactive leucine-rich re...  57.8    1e-06   Nicotiana tomentosiformis
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  57.8    1e-06   Brassica rapa
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051            57.8    1e-06   Selaginella moellendorffii
ref|XP_002978660.1|  hypothetical protein SELMODRAFT_109190           57.8    1e-06   
ref|XP_002891052.1|  hypothetical protein ARALYDRAFT_890947           57.4    2e-06   Arabidopsis lyrata subsp. lyrata
gb|EPS67146.1|  hypothetical protein M569_07630                       57.4    2e-06   Genlisea aurea
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1     57.4    2e-06   Populus euphratica
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  57.4    2e-06   Vitis vinifera
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           57.4    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009415416.1|  PREDICTED: probably inactive leucine-rich re...  57.0    2e-06   
ref|XP_009415415.1|  PREDICTED: probably inactive leucine-rich re...  57.0    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  57.0    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_002984595.1|  hypothetical protein SELMODRAFT_120629           57.0    2e-06   
emb|CAI64397.1|  putative leucine-rich repeat protein                 54.3    3e-06   Triticum aestivum [Canadian hard winter wheat]
gb|ACI95776.1|  PAN1                                                  56.6    3e-06   Zea mays [maize]
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  56.6    3e-06   
ref|XP_007020300.1|  BRI1 like                                        57.0    3e-06   
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  56.2    4e-06   Vitis vinifera
ref|XP_002309364.2|  leucine-rich repeat transmembrane protein ki...  56.2    4e-06   
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  55.8    5e-06   
ref|XP_010919346.1|  PREDICTED: receptor-like protein kinase HSL1     56.2    5e-06   
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...  55.8    5e-06   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  55.8    6e-06   
ref|XP_002994469.1|  hypothetical protein SELMODRAFT_432389           55.5    7e-06   
emb|CBI22711.3|  unnamed protein product                              55.8    7e-06   
ref|XP_011033374.1|  PREDICTED: putative leucine-rich repeat rece...  55.8    7e-06   
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    7e-06   
ref|XP_002309766.2|  hypothetical protein POPTR_0007s01340g           55.5    7e-06   
ref|XP_002511511.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  55.5    8e-06   
gb|KHG18466.1|  Receptor-like protein kinase HSL1                     55.5    9e-06   
ref|XP_002891051.1|  predicted protein                                55.5    9e-06   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   55.1    1e-05   
ref|XP_002864814.1|  leucine-rich repeat family protein               55.1    1e-05   
ref|XP_007025533.1|  HAESA-like 1 isoform 2                           55.1    1e-05   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           55.1    1e-05   
gb|KHG10910.1|  Receptor-like protein kinase HSL1                     55.1    1e-05   
ref|XP_011027770.1|  PREDICTED: receptor-like protein kinase HSL1     55.1    1e-05   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              55.1    1e-05   
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                55.1    1e-05   
gb|KHN29479.1|  Receptor-like protein 12                              55.1    1e-05   
ref|XP_009379722.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  55.1    1e-05   
ref|XP_003534623.2|  PREDICTED: LRR receptor-like serine/threonin...  55.1    1e-05   
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     54.7    1e-05   
ref|XP_008388751.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  55.1    1e-05   
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  54.7    1e-05   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...  54.7    1e-05   
ref|XP_002305776.1|  leucine-rich repeat receptor-like protein ki...  54.7    1e-05   
ref|XP_007159606.1|  hypothetical protein PHAVU_002G251400g           54.7    2e-05   
emb|CAH67463.1|  OSIGBa0159I10.8                                      54.7    2e-05   
ref|NP_180206.1|  leucine-rich repeat-containing protein              54.3    2e-05   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  54.3    2e-05   
emb|CDX84346.1|  BnaC03g51540D                                        54.3    2e-05   
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                      54.3    2e-05   
emb|CDY00321.1|  BnaA06g22220D                                        54.3    2e-05   
ref|XP_003553344.2|  PREDICTED: probably inactive leucine-rich re...  54.3    2e-05   
ref|XP_010093960.1|  Receptor-like protein kinase HSL1                54.3    2e-05   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           54.3    2e-05   
gb|KDP21105.1|  hypothetical protein JCGZ_21576                       54.3    2e-05   
ref|XP_004485840.1|  PREDICTED: receptor-like protein kinase HSL1...  54.3    2e-05   
ref|XP_009149170.1|  PREDICTED: leucine-rich repeat receptor-like...  54.3    2e-05   
ref|XP_001759642.1|  predicted protein                                54.3    2e-05   
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  54.3    2e-05   
ref|XP_004485839.1|  PREDICTED: receptor-like protein kinase HSL1...  54.3    2e-05   
ref|XP_009149171.1|  PREDICTED: leucine-rich repeat receptor-like...  54.3    2e-05   
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           54.3    2e-05   
gb|KDP21014.1|  hypothetical protein JCGZ_21485                       54.3    2e-05   
ref|XP_011042612.1|  PREDICTED: LRR receptor-like serine/threonin...  54.3    2e-05   
gb|KJB57488.1|  hypothetical protein B456_009G166500                  54.3    2e-05   
emb|CBI22599.3|  unnamed protein product                              53.9    2e-05   
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    2e-05   
ref|XP_010484821.1|  PREDICTED: putative receptor-like protein ki...  53.9    2e-05   
ref|XP_010063204.1|  PREDICTED: receptor-like protein kinase BRI1...  54.3    2e-05   
gb|ACJ86048.1|  unknown                                               53.1    2e-05   
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           53.9    2e-05   
gb|ABK93925.1|  unknown                                               53.9    2e-05   
ref|XP_006411490.1|  hypothetical protein EUTSA_v10017834mg           53.9    2e-05   
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  53.9    2e-05   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  53.9    3e-05   
ref|XP_009419181.1|  PREDICTED: probably inactive leucine-rich re...  53.9    3e-05   
ref|XP_010662782.1|  PREDICTED: probable LRR receptor-like serine...  53.9    3e-05   
ref|XP_002462033.1|  hypothetical protein SORBIDRAFT_02g013100        53.9    3e-05   
ref|XP_003569550.1|  PREDICTED: probable LRR receptor-like serine...  53.9    3e-05   
ref|XP_007148036.1|  hypothetical protein PHAVU_006G175100g           53.9    3e-05   
ref|XP_003599315.1|  Receptor-like kinase                             53.9    3e-05   
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  53.9    3e-05   
gb|KJB31630.1|  hypothetical protein B456_005G199100                  53.9    3e-05   
dbj|BAK02926.1|  predicted protein                                    53.9    3e-05   
ref|XP_003627471.1|  LRR receptor-like serine/threonine-protein k...  51.6    3e-05   
emb|CDY16762.1|  BnaA09g06200D                                        53.5    3e-05   
ref|XP_010508595.1|  PREDICTED: probable inactive leucine-rich re...  53.5    3e-05   
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   53.5    3e-05   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  53.5    3e-05   
dbj|BAJ86449.1|  predicted protein                                    53.5    3e-05   
gb|EEE55167.1|  hypothetical protein OsJ_02982                        53.5    3e-05   
ref|XP_003541722.1|  PREDICTED: receptor-like protein kinase HSL1...  53.5    3e-05   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    3e-05   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           53.5    3e-05   
gb|EEC71258.1|  hypothetical protein OsI_03238                        53.5    4e-05   
ref|XP_007159172.1|  hypothetical protein PHAVU_002G215100g           53.5    4e-05   
emb|CDY48481.1|  BnaC05g13410D                                        53.5    4e-05   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       53.5    4e-05   
ref|XP_006595408.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  53.5    4e-05   
ref|XP_009804334.1|  PREDICTED: leucine-rich repeat receptor-like...  53.5    4e-05   
ref|XP_006442219.1|  hypothetical protein CICLE_v10018604mg           53.5    4e-05   
gb|KEH17413.1|  LRR receptor-like kinase family protein               53.5    4e-05   
gb|KDO44090.1|  hypothetical protein CISIN_1g001274mg                 53.5    4e-05   
ref|XP_006478014.1|  PREDICTED: leucine-rich repeat receptor-like...  53.5    4e-05   
ref|XP_003636865.1|  Receptor-like kinase                             53.1    4e-05   
emb|CDX87267.1|  BnaC09g05820D                                        53.1    5e-05   
gb|EYU20716.1|  hypothetical protein MIMGU_mgv1a021843mg              53.1    5e-05   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    5e-05   
ref|XP_004969518.1|  PREDICTED: probable LRR receptor-like serine...  53.1    5e-05   
gb|KHN28617.1|  Putative LRR receptor-like serine/threonine-prote...  53.1    5e-05   
dbj|BAB10839.1|  receptor-like protein kinase                         52.8    5e-05   
ref|XP_011047761.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    5e-05   
ref|XP_009397143.1|  PREDICTED: inactive receptor-like serine/thr...  52.8    6e-05   
ref|XP_003636791.1|  Protein STRUBBELIG-RECEPTOR FAMILY               52.8    6e-05   
emb|CAN70971.1|  hypothetical protein VITISV_009202                   53.1    6e-05   
gb|EPS69772.1|  hypothetical protein M569_04990                       52.8    6e-05   
ref|XP_010662779.1|  PREDICTED: LRR receptor-like serine/threonin...  51.6    6e-05   
ref|XP_003602344.1|  Kinase-like protein                              52.8    7e-05   
ref|XP_008390699.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    7e-05   
ref|XP_002263001.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    7e-05   
ref|XP_008390700.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    7e-05   
emb|CBI21827.3|  unnamed protein product                              52.8    7e-05   
ref|XP_006659459.1|  PREDICTED: receptor-like protein kinase-like     52.8    7e-05   
ref|XP_006372760.1|  hypothetical protein POPTR_0017s04790g           52.8    7e-05   
gb|KEH36609.1|  LRR receptor-like kinase                              52.4    8e-05   
ref|XP_006362388.1|  PREDICTED: probable LRR receptor-like serine...  52.4    8e-05   
emb|CDY06072.1|  BnaA09g37080D                                        52.4    8e-05   
ref|XP_009116483.1|  PREDICTED: probable inactive leucine-rich re...  52.4    8e-05   
gb|KHN35706.1|  LRR receptor-like serine/threonine-protein kinase...  52.4    8e-05   
ref|XP_008652405.1|  PREDICTED: probable LRR receptor-like serine...  52.4    8e-05   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  52.4    8e-05   
ref|XP_007136453.1|  hypothetical protein PHAVU_009G046600g           52.4    8e-05   
ref|XP_002890776.1|  hypothetical protein ARALYDRAFT_473063           52.4    8e-05   
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...  52.4    8e-05   
ref|XP_010414755.1|  PREDICTED: receptor-like protein 12              52.4    9e-05   
emb|CAH66725.1|  H0404F02.1                                           52.4    9e-05   
ref|XP_008443337.1|  PREDICTED: probable LRR receptor-like serine...  52.4    9e-05   
gb|KHG14766.1|  LRR receptor-like serine/threonine-protein kinase...  52.4    9e-05   
gb|EEE61543.1|  hypothetical protein OsJ_15867                        52.4    9e-05   
ref|XP_002517850.1|  Receptor protein kinase CLAVATA1 precursor, ...  52.4    9e-05   
gb|AEW49518.1|  putative LRR-RLK protein XIAO                         52.4    9e-05   
ref|XP_009394202.1|  PREDICTED: receptor-like protein kinase HSL1     52.4    9e-05   
gb|EPS65172.1|  hypothetical protein M569_09607                       50.1    1e-04   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   
ref|XP_010999746.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
gb|EYU38215.1|  hypothetical protein MIMGU_mgv1a000518mg              52.4    1e-04   
ref|XP_002509423.1|  protein with unknown function                    52.4    1e-04   
ref|XP_010112590.1|  LRR receptor-like serine/threonine-protein k...  52.0    1e-04   
ref|XP_010316819.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
ref|XP_001775671.1|  predicted protein                                52.0    1e-04   
gb|KHN28133.1|  LRR receptor-like serine/threonine-protein kinase...  52.0    1e-04   
emb|CBI39866.3|  unnamed protein product                              52.0    1e-04   
gb|KJB39878.1|  hypothetical protein B456_007G035200                  52.0    1e-04   
ref|XP_010483983.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   
ref|XP_009607758.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
emb|CDX71991.1|  BnaC08g28830D                                        51.2    1e-04   
gb|KCW74513.1|  hypothetical protein EUGRSUZ_E03228                   52.0    1e-04   
gb|EPS73267.1|  hypothetical protein M569_01488                       52.0    1e-04   
ref|XP_006346065.1|  PREDICTED: receptor-like protein kinase BRI1...  52.0    1e-04   
dbj|BAJ84911.1|  predicted protein                                    52.0    1e-04   
ref|XP_002265525.3|  PREDICTED: receptor-like protein kinase BRI1...  52.0    1e-04   
ref|XP_002966565.1|  hypothetical protein SELMODRAFT_407578           52.0    1e-04   
gb|KDP36603.1|  hypothetical protein JCGZ_08370                       51.6    1e-04   
ref|XP_010276980.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
gb|KJB34896.1|  hypothetical protein B456_006G089100                  52.0    1e-04   
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...  52.0    1e-04   
ref|XP_010276978.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
ref|XP_003572363.2|  PREDICTED: probable inactive leucine-rich re...  51.6    1e-04   
ref|XP_010276982.1|  PREDICTED: probable LRR receptor-like serine...  52.0    1e-04   
ref|XP_010057361.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  52.0    1e-04   
ref|XP_007149806.1|  hypothetical protein PHAVU_005G100400g           52.0    1e-04   
gb|KDO62658.1|  hypothetical protein CISIN_1g047929mg                 51.6    1e-04   
ref|XP_006384063.1|  hypothetical protein POPTR_0004s05680g           51.6    2e-04   
ref|XP_003575565.2|  PREDICTED: receptor protein kinase-like prot...  51.6    2e-04   
ref|XP_002534282.1|  receptor protein kinase, putative                51.6    2e-04   
ref|XP_006850125.1|  hypothetical protein AMTR_s00022p00229730        51.6    2e-04   
ref|XP_007043701.1|  HAESA-like 1 isoform 2                           51.6    2e-04   
ref|XP_009410928.1|  PREDICTED: probable LRR receptor-like serine...  51.6    2e-04   
gb|KJB69554.1|  hypothetical protein B456_011G030400                  51.6    2e-04   
gb|KDO59946.1|  hypothetical protein CISIN_1g0130042mg                51.2    2e-04   
gb|EMT28034.1|  Putative LRR receptor-like serine/threonine-prote...  51.6    2e-04   
ref|XP_007043700.1|  HAESA-like 1 isoform 1                           51.6    2e-04   
ref|XP_003543996.2|  PREDICTED: LRR receptor-like serine/threonin...  51.6    2e-04   
ref|XP_010525796.1|  PREDICTED: putative leucine-rich repeat rece...  51.6    2e-04   
ref|XP_003621481.1|  Receptor-like protein kinase                     51.6    2e-04   
ref|XP_010915498.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7  51.2    2e-04   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  51.6    2e-04   
ref|XP_004150213.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_009786947.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    2e-04   
ref|XP_010444123.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    2e-04   
gb|KEH18521.1|  DNA-directed RNA polymerase                           51.6    2e-04   
ref|XP_011101397.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
dbj|BAK04048.1|  predicted protein                                    49.3    2e-04   
ref|XP_011101396.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_010529060.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
gb|AIZ46839.1|  leucine-rich repeat receptor-like protein CLAVATA2    51.2    2e-04   
ref|XP_011085985.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  51.2    2e-04   
ref|XP_006439659.1|  hypothetical protein CICLE_v10019379mg           51.2    2e-04   
ref|XP_002982402.1|  hypothetical protein SELMODRAFT_116152           51.2    2e-04   
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    2e-04   
ref|XP_010459245.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    2e-04   
ref|XP_010265781.1|  PREDICTED: probable inactive leucine-rich re...  51.2    2e-04   
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...  51.2    2e-04   
ref|XP_004504296.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-04   
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    2e-04   
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1     51.2    3e-04   
emb|CAD41303.2|  OSJNBa0020J04.8                                      51.2    3e-04   
ref|XP_009608359.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
ref|XP_006493855.1|  PREDICTED: somatic embryogenesis receptor ki...  50.8    3e-04   
ref|XP_001777608.1|  predicted protein                                50.8    3e-04   
ref|XP_001768500.1|  predicted protein                                50.8    3e-04   
dbj|BAD10183.1|  putative leucine-rich repeat/receptor protein ki...  50.8    3e-04   
gb|KHN23315.1|  Putative LRR receptor-like serine/threonine-prote...  50.8    3e-04   
ref|XP_003527998.2|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
ref|XP_002891053.1|  leucine-rich repeat family protein               50.8    3e-04   
ref|XP_008442870.1|  PREDICTED: receptor-like protein kinase HSL1     50.8    3e-04   
ref|XP_002880782.1|  hypothetical protein ARALYDRAFT_901383           50.8    3e-04   
ref|XP_009626861.1|  PREDICTED: leucine-rich repeat receptor-like...  50.8    3e-04   
ref|XP_009410031.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    3e-04   
gb|EMT07205.1|  Putative LRR receptor-like serine/threonine-prote...  50.8    3e-04   
ref|XP_010057112.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
ref|XP_004231550.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...  50.8    3e-04   
ref|XP_010057111.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
gb|KFK28003.1|  hypothetical protein AALP_AA8G459000                  50.4    3e-04   
ref|XP_010650298.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    3e-04   
ref|XP_010315618.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
ref|XP_009410030.1|  PREDICTED: receptor-like protein 12 isoform X1   50.8    3e-04   
ref|XP_010057110.1|  PREDICTED: probable LRR receptor-like serine...  50.8    3e-04   
emb|CAN71913.1|  hypothetical protein VITISV_032859                   50.8    3e-04   
emb|CDY26259.1|  BnaA06g11580D                                        50.8    3e-04   
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  50.4    3e-04   
ref|XP_002456123.1|  hypothetical protein SORBIDRAFT_03g030925        49.3    3e-04   
ref|XP_007159453.1|  hypothetical protein PHAVU_002G238900g           50.4    4e-04   



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  537  KIGRXLEKLEHLNV  578
            +IGR LEKL+HL V
Sbjct  91   RIGRGLEKLQHLKV  104



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  537  KIGRXLEKLEHLNV  578
            +IGR LEKL+HL V
Sbjct  91   RIGRGLEKLQHLKV  104



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
            +G  G E+LQLNDDVLGLIV KSG QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22   TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  510  DLHGLGLSGKIGRXLEKLEHLNV  578
             L GLGLSGKIGR LEKL+ L V
Sbjct  82   SLDGLGLSGKIGRGLEKLQSLKV  104



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLNDDVLGLIVFKS +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43   QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  537  KIGRXLEKLEHLNV  578
            KIGR LEKL+HL V
Sbjct  103  KIGRGLEKLQHLTV  116



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S QLNDD+LGLIVFKS + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29   SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  531  SGKIGRXLEKLEHLNV  578
            SG+IGR LEKL+HL V
Sbjct  89   SGRIGRGLEKLQHLKV  104



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  333  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  513  LHGLGLSGKIGRXLEKLEHLNV  578
            L GLGLSGKIG+ L+KLE+L V
Sbjct  88   LDGLGLSGKIGKGLQKLEYLKV  109



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G A S QLNDDVLGLIVFK+ + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23   GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GLGLSGKIGR ++KL+HL V
Sbjct  83   GLGLSGKIGRGVQKLQHLKV  102



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  348  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  527
            +SL LNDDVLGLIVFKS + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L GLG
Sbjct  37   DSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDGLG  96

Query  528  LSGKIGRXLEKLEHLNV  578
            LSGK+GR LEKL+ L V
Sbjct  97   LSGKMGRGLEKLQDLKV  113



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  267  IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSED  443
            + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFKS ++DP+S+L +W+ED
Sbjct  4    MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  444  DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+ L+KL++L V
Sbjct  64   DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKV  108



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL++L V
Sbjct  68   GKIGRGLEKLQNLKV  82



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34   IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL++L V
Sbjct  94   GKIGRGLEKLQNLKV  108



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  333  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  513  LHGLGLSGKIGRXLEKLEHLNV  578
            L+GL LSGKIGR LEKL+ L V
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQV  105



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  333  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  513  LHGLGLSGKIGRXLEKLEHLNV  578
            L GLGLSGKIG+ L+KL +L V
Sbjct  89   LDGLGLSGKIGKGLQKLMYLKV  110



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  333  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  513  LHGLGLSGKIGRXLEKLEHLNV  578
            L+GL LSGKIGR LEKL+ L V
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQV  105



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL+HL V
Sbjct  91   GKIGRGLEKLQHLTV  105



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL+HL V
Sbjct  91   GKIGRGLEKLQHLTV  105



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL+HL V
Sbjct  91   GKIGRGLEKLQHLTV  105



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534  GKIGRXLEKLEHLNV  578
            GKIGR LEKL+HL V
Sbjct  91   GKIGRGLEKLQHLTV  105



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            ++QLNDDVLGLIVFKS +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34   AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  531  SGKIGRXLEKLEHL  572
            SG+IG+ LEKL+HL
Sbjct  94   SGRIGKGLEKLQHL  107



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  348  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  527
             S+QLNDDVLGLIVFKS +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   NSIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLS  88

Query  528  LSGKIGRXLEKLEHLNV  578
            L+GKIGR ++KL+HL V
Sbjct  89   LTGKIGRGIQKLQHLKV  105



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKIGR ++KL+HL V
Sbjct  85   GLALTGKIGRGIQKLQHLKV  104



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SLQLNDDVLGLIVFK+G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33   SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  531  SGKIGRXLEKLEHLNV  578
            SGKIGR LEKL++L  
Sbjct  93   SGKIGRGLEKLQNLQA  108



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            ++QLNDDVLGLIVFKS + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27   TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  531  SGKIGRXLEKLEHLNV  578
            SGK+G+ L+KL+HL V
Sbjct  87   SGKLGKGLQKLQHLKV  102



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  519  GLGLSGKIGRXLEKLEHL  572
            GLGL+GKIGR ++KL+HL
Sbjct  85   GLGLTGKIGRGIQKLQHL  102



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  519  GLGLSGKIGRXLEKLEHL  572
            GLGL+GKIGR ++KL+HL
Sbjct  85   GLGLTGKIGRGIQKLQHL  102



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  531  SGKIGRXLEKLEHLNV  578
            SGKIGR LEKL+ L V
Sbjct  87   SGKIGRGLEKLQSLKV  102



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  531  SGKIGRXLEKLEHLNV  578
            SGKIGR LEKL+ L V
Sbjct  87   SGKIGRGLEKLQSLKV  102



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +3

Query  276  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  449
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS ++DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  450  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            SPC+W F++C+P +GRVS+V L GLGLSG++G+ L+KL+H+  
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKT  103



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  336  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            A    ++QLNDDVLGLIVFKS +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE+ L
Sbjct  55   ANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSELSL  114

Query  516  HGLGLSGKIGRXLEKLEHL  572
             GLGLSGK+GR LEKL+HL
Sbjct  115  DGLGLSGKLGRSLEKLQHL  133



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKIGR ++KL+HL V
Sbjct  87   GLALTGKIGRGIQKLQHLKV  106



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = +3

Query  276  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  449
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS + DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  450  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            SPC+W F++C+P +GRVS+V L GLGLSG++G+ L+KL+H+  
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKT  103



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKIGR ++KL+HL V
Sbjct  87   GLALTGKIGRGIQKLQHLKV  106



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S QLNDDVLGLIVFKS + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25   GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKIGR ++KL+HL V
Sbjct  85   GLSLTGKIGRGIQKLQHLKV  104



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +3

Query  336  AGGAES-LQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
            AGGA + LQLNDDVLGLIVFKSG   DP   L +W+EDDDSPCAW FVKC+  N RVSEV
Sbjct  22   AGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRVSEV  81

Query  510  DLHGLGLSGKIGRXLEKLEHLNV  578
             L GL LSGKIGR LEKL+ L V
Sbjct  82   SLDGLSLSGKIGRGLEKLQSLKV  104



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +++QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKIGR ++KL+HL V
Sbjct  87   GLALTGKIGRGIQKLQHLKV  106



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SLQLNDDVLGLIVFK+ + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32   SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  531  SGKIGRXLEKLEHLNV  578
            SGKIGR LEKL++L V
Sbjct  92   SGKIGRGLEKLQNLQV  107



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKI R ++KL+HL V
Sbjct  87   GLALTGKINRGIQKLQHLKV  106



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  531  SGKIG-RXLEKLEHLNV  578
            SGKIG R L KL+HL V
Sbjct  100  SGKIGTRGLRKLQHLKV  116



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25   GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  519  GLGLSGKIGRXLEKLEHL  572
            GLGL+G IGR ++KL+HL
Sbjct  85   GLGLTGTIGRGIQKLQHL  102



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  531  SGKIG-RXLEKLEHLNV  578
            SGKIG R L KL+HL V
Sbjct  100  SGKIGTRGLRKLQHLKV  116



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G   S QLNDDVLGLIVFKS + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32   GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GLGLSGKIGR LEKL+ L V
Sbjct  92   GLGLSGKIGRGLEKLDRLKV  111



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +3

Query  273  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  446
            +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK+ + DP+S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  447  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+ L+KL+HL  
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKT  109



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +3

Query  273  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  446
            +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK+ + DP S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  447  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+ L+KL+HL  
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKT  109



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +QLN DVLGL+VFKS + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26   VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  534  GKIGRXLEKLEHLNV  578
            GK G+ L+ L+HL V
Sbjct  86   GKPGKGLQNLQHLKV  100



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLN+DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  537  KIGRXLEKLEHLNV  578
            KIG+ L+ L++L V
Sbjct  92   KIGKGLQNLQNLKV  105



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  339  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
            G  +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26   GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  519  GLGLSGKIGRXLEKLEHLNV  578
            GL L+GKI R ++KL+ L V
Sbjct  86   GLALTGKINRGIQKLQRLKV  105



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  348  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  527
            +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  528  LSGKIGRXLEKLEHLNV  578
            L+GKI R ++KL+ L V
Sbjct  89   LTGKINRGIQKLQRLKV  105



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            ++QLNDDVLGLI+FKS + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33   AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  531  SGKIGRXLEKLEHL  572
            SGK+GR  EKL+HL
Sbjct  93   SGKLGRGFEKLQHL  106



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +3

Query  339  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  516  HGLGLSGKIGRXLEKLEHLNV  578
             GL LSGKIGR ++KL++L V
Sbjct  84   DGLALSGKIGRGIQKLQYLKV  104



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +3

Query  339  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  516  HGLGLSGKIGRXLEKLEHLNV  578
             GL LSGKIGR ++KL++L V
Sbjct  84   DGLALSGKIGRGIQKLQYLKV  104



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLN DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  537  KIGRXLEKLEHLNV  578
            KIG+ L+ L++L V
Sbjct  92   KIGKGLQNLQNLKV  105



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFKS V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGKI
Sbjct  2    NDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGKI  61

Query  543  GRXLEKLEHL  572
            GR LEKL++L
Sbjct  62   GRGLEKLQYL  71



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            A S  LNDDVLGLIVFK+ +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19   ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  525  GLSGKIGRXLEKLEHL  572
             LSGKIGR L +L+ L
Sbjct  79   SLSGKIGRGLLQLQSL  94



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V L  L LS
Sbjct  30   IKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHVLLDNLSLS  89

Query  534  GKIGRXLEKLEHLNV  578
            GK+ + L+KL+HL V
Sbjct  90   GKLSKGLQKLQHLEV  104



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  35   SPSLNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  94

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +LE L
Sbjct  95   SGRIGRGLLQLEFL  108



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG
Sbjct  24   SLNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSG  83

Query  537  KIGRXLEKLEHL  572
             IGR L +L+ L
Sbjct  84   HIGRGLLQLQSL  95



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  37   SPSLNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  96

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +LE L
Sbjct  97   SGRIGRGLLQLEFL  110



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26   LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQFL  96



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG
Sbjct  30   SLNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSG  89

Query  537  KIGRXLEKLEHL  572
             +GR L +L+ L
Sbjct  90   HVGRGLLQLQSL  101



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  543  GRXLEKLEHL  572
            GR L +L++L
Sbjct  84   GRGLLRLQNL  93



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  342  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
            GA +  LNDDVLGLIVFKS VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  522  LGLSGKIGRXLEKLEHL  572
             GLSG+I R L +L+ L
Sbjct  79   FGLSGRISRGLLRLQFL  95



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  85   IGRGLLQLQFL  95



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  342  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
            G E++  NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L G
Sbjct  40   GDETVSWNDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDG  99

Query  522  LGLSGKIGRXLEKLEHLNV  578
            L LSG IGR L KLE L  
Sbjct  100  LALSGTIGRGLLKLERLKT  118



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  85   IGRGLLQLQFL  95



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSG
Sbjct  25   SLNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSG  84

Query  537  KIGRXLEKLEHL  572
            KIGR L +L+ L
Sbjct  85   KIGRGLLQLQFL  96



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  543  GRXLEKLEHL  572
            GR L +L++L
Sbjct  84   GRGLLRLQNL  93



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  89   IGRGLLQLQSL  99



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  540  IGRXLEKLEHLNV  578
            IGR L +L+ L V
Sbjct  84   IGRGLLRLQFLQV  96



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  540  IGRXLEKLEHL  572
            IGR L +LE L
Sbjct  87   IGRGLLQLEFL  97



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  540  IGRXLEKLEHLNV  578
            IGR L +L+ L V
Sbjct  84   IGRGLLRLQFLQV  96



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  540  IGRXLEKLEHL  572
            IGR L +LE L
Sbjct  87   IGRGLLQLEFL  97



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +L+ L
Sbjct  88   SGRIGRGLLQLKFL  101



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG I
Sbjct  25   NDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGHI  84

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  85   GRGLLRLQFLQV  96



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +L+ L
Sbjct  88   SGRIGRGLLQLKFL  101



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  41   SPSLNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  100

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +LE L
Sbjct  101  SGRIGRGLLQLEFL  114



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG
Sbjct  22   SINDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSG  81

Query  537  KIGRXLEKLEHLNV  578
             IGR L +L+ L V
Sbjct  82   HIGRGLLRLQFLQV  95



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG
Sbjct  22   SINDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSG  81

Query  537  KIGRXLEKLEHLNV  578
             IGR L +L+ L V
Sbjct  82   HIGRGLLRLQFLQV  95



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIV K+ +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  84   IGRGLLQLQSL  94



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  342  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
            GA +  LNDDVLGLIVFKS V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  522  LGLSGKIGRXLEKLEHL  572
             GLSG+I R L +L+ L
Sbjct  79   FGLSGRISRGLLRLKFL  95



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQSL  96



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSG
Sbjct  25   SLNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSG  84

Query  537  KIGRXLEKL  563
            KIGR L +L
Sbjct  85   KIGRGLLQL  93



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  525  GLSGKIGRXLEKLEHL  572
            GLSGKI R L +L+ L
Sbjct  83   GLSGKISRGLMRLQFL  98



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQSL  96



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            A S  LNDDVLGLIVFK+ +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19   AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  525  GLSGKIGRXLEKLEHL  572
             LSGKIGR L +L+ L
Sbjct  79   SLSGKIGRGLLQLQSL  94



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG
Sbjct  31   SLNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSG  90

Query  537  KIGRXLEKLEHL  572
            ++GR L +L+ L
Sbjct  91   RLGRGLLQLQFL  102



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  531  SGKIGRXLEKLEHL  572
            SG++GR L +LE L
Sbjct  88   SGRLGRGLFQLEFL  101



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G
Sbjct  31   SLNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTG  90

Query  537  KIGRXLEKLEHL  572
            +IGR L +L+ L
Sbjct  91   RIGRGLLQLQFL  102



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  85   IGRGLLQLQFL  95



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  531  SGKIGRXLEKLEHL  572
            SG++GR L +LE L
Sbjct  88   SGRLGRGLFQLEFL  101



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G
Sbjct  53   SLNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTG  112

Query  537  KIGRXLEKLEHL  572
            +IGR L +L+ L
Sbjct  113  RIGRGLLQLQFL  124



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIV K+ ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  84   IGRGLLQLQSL  94



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540  IGRXLEKL  563
            IGR L +L
Sbjct  89   IGRGLLQL  96



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G
Sbjct  31   SLNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTG  90

Query  537  KIGRXLEKLEHL  572
            +IGR L +L+ L
Sbjct  91   RIGRGLLQLQFL  102



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  540  IGRXLEKLEHLN  575
            IGR L +L+ L+
Sbjct  90   IGRGLMQLQFLD  101



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LN DVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  85   IGRGLLQLQFL  95



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L GL LSG I
Sbjct  1    NDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDGLALSGTI  60

Query  543  GRXLEKLEHLNV  578
            GR L KLE L  
Sbjct  61   GRGLLKLERLKT  72



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  540  IGRXLEKLEHLN  575
            IGR L +L+ L+
Sbjct  90   IGRGLMQLQFLD  101



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540  IGRXLEKL  563
            IGR L +L
Sbjct  89   IGRGLLQL  96



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFKS VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG
Sbjct  25   SLNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSG  84

Query  537  KIGRXLEKLEHL  572
            +I R L +L+ L
Sbjct  85   RISRGLLRLQFL  96



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  333  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            G G A +  L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + 
Sbjct  21   GGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLS  80

Query  513  LHGLGLSGKIGR  548
            L G GLSGK+GR
Sbjct  81   LAGFGLSGKLGR  92



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  84   GRGLLRLQFLQI  95



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+I
Sbjct  26   NDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQI  85

Query  543  GRXLEKLEHL  572
             R L +L+ L
Sbjct  86   SRSLLRLQFL  95



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +3

Query  330  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
            S + G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+EV
Sbjct  15   SNSVGSLNPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTEV  74

Query  510  DLHGLGLSGKIGRXLEKLEHL  572
             L G  LSG+IGR L +L+ L
Sbjct  75   MLDGFSLSGRIGRGLLQLQFL  95



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  88   IGRGLLQLQFL  98



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  543  GR  548
            GR
Sbjct  84   GR  85



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  88   IGRGLLQLQFL  98



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQSL  96



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  540  IGRXLEKLEHL  572
            IGR + +L+ L
Sbjct  85   IGRGVLQLKFL  95



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVLGLIVFK+ V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  546  RXLEKLEHL  572
            R L +LE L
Sbjct  92   RGLLRLEAL  100



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG
Sbjct  30   SLNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSG  89

Query  537  KIGRXLEKLEHL  572
             IGR L +L+ L
Sbjct  90   HIGRGLLQLQAL  101



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG
Sbjct  30   SLNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSG  89

Query  537  KIGRXLEKLEHL  572
             IGR L +L+ L
Sbjct  90   HIGRGLLQLQAL  101



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG
Sbjct  27   SLNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSG  86

Query  537  KIGRXLEKLEHL  572
            +IGR L +L+ L
Sbjct  87   RIGRGLLQLQFL  98



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  525  GLSGKIGRXLEKLEHL  572
            GLSGKI R L +L+ L
Sbjct  83   GLSGKISRGLMRLQFL  98



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG
Sbjct  27   SLNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSG  86

Query  537  KIGRXLEKLEHL  572
            +IGR L +L+ L
Sbjct  87   RIGRGLLQLQFL  98



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG
Sbjct  30   SLNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSG  89

Query  537  KIGRXLEKLEHL  572
             IGR L +L+ L
Sbjct  90   HIGRGLLQLQAL  101



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFKS +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG
Sbjct  25   SLNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSG  84

Query  537  KIGRXLEKLEHL  572
            +I R L +L+ L
Sbjct  85   RISRGLLRLQFL  96



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDV GLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30   LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  90   IGRGLMQLQFL  100



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  546  RXLEKLEHL  572
            R L +LE L
Sbjct  92   RGLLRLEAL  100



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query  327  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
            +  A     + LNDDVLGLIVFKS + DP + L++W+EDD S C+W +++C+P+ GRV  
Sbjct  22   SQAANEDSEVGLNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIG  80

Query  507  VDLHGLGLSGKIGRXLEKLEHLNV  578
            + L GLGLSG++G+ L+KL+ L V
Sbjct  81   LSLTGLGLSGRLGKGLQKLQELKV  104



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLI FK+G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26   LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  540  IGRXLEKLEHLNV  578
            +GR L +L+ L+ 
Sbjct  86   LGRGLLRLQFLDT  98



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  84   GRGLLRLQFLQI  95



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQSL  96



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVF++ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  89   IGRGLLQLQFL  99



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  84   GRGLLRLQFLQI  95



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  L
Sbjct  35   SPSLNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSL  94

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L +LE L
Sbjct  95   SGRIGRGLLQLEFL  108



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC-AWNFVKCHPANGRVSEVDLHGLG  527
            S  LNDDVLGLIVFK+ VQDP   LA+W+E+DDSPC  W  VKC+P + RVS++ L G G
Sbjct  24   SPSLNDDVLGLIVFKADVQDPDGKLASWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFG  83

Query  528  LSGKIGRXLEKLEHL  572
            LSGK+GR L +L+ L
Sbjct  84   LSGKLGRGLLQLQFL  98



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  546  RXLEKLEHL  572
            R L +LE L
Sbjct  92   RGLLRLEAL  100



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            L  NDDVLGLI+FK+G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28   LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  534  GKIGRXLEKLEHLNV  578
            G I R L +L+ L +
Sbjct  88   GHIDRGLLRLQFLQI  102



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            +DDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG I
Sbjct  24   SDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  84   GRGLLRLQFLQI  95



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  342  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
            G+ +  LNDDVLGLIVFK+ +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1    GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  522  LGLSGKIGRXLEKLEHL  572
              L+GK+GR L +L+ L
Sbjct  61   FSLTGKLGRGLLQLQFL  77



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLI+FK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  540  IGRXLEKLEHL  572
            IGR + +L+ L
Sbjct  88   IGRGILQLQFL  98


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  375  LGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXL  554
            L +  F   ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+IGR +
Sbjct  297  LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGRIGRGI  356

Query  555  EKLEHL  572
             +L+ L
Sbjct  357  LQLQFL  362



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG
Sbjct  26   SLNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSG  85

Query  537  KIGRXLEKLEHL  572
             +GR L +L+ L
Sbjct  86   HLGRGLLQLQFL  97



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            A +L  NDD+LGL+VFK+ +QDP  +L +W+E+DDSPC WN +KC+P + RVS++ L G 
Sbjct  21   ALNLSFNDDILGLMVFKADIQDPLGNLVSWNEEDDSPCNWNGIKCNPRSNRVSQIVLDGF  80

Query  525  GLSGKI  542
            GLSGKI
Sbjct  81   GLSGKI  86



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG
Sbjct  25   SLNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSG  84

Query  537  KIGRXLEKLEHL  572
             IGR L +L+ L
Sbjct  85   HIGRGLLQLQSL  96



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  342  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
            G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22   GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  522  LGLSGKIGRXLEKLEHL  572
              LSG+IGR L +L+ L
Sbjct  82   FSLSGRIGRGLLQLQFL  98



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32   LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  540  IGRXLEKLEHL  572
            IGR L +L+ +
Sbjct  92   IGRGLLQLQSI  102



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  86   IGRGLLQLQSL  96



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  530
             LNDDVLGLIVFK+ +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  L
Sbjct  22   SLNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSL  81

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L++L+ L
Sbjct  82   SGRIGRGLQRLQFL  95



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  530
             LNDDVLGLIVFK+ ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  L
Sbjct  31   SLNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSL  90

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L++L+ L
Sbjct  91   SGRIGRGLQRLQFL  104



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  VKC P + RVSE+ L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLTDPQSRLTSWNEEDDSACNWVGVKCDPTSNRVSELLLDGFSLSGHL  87

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  88   GRSLIRLQSLKV  99



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC-AWNFVKCHPANGRVSEVDLHGLGLS  533
             LNDDVLGLIVFK+ +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLS
Sbjct  24   SLNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLS  83

Query  534  GKIGRXLEKLEHL  572
            GK+GR L +L+ L
Sbjct  84   GKLGRGLLQLQFL  96



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  28   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  87

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  88   GRGLLRLQFLQV  99



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  86   GRGLLRLQFLQV  97



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  537  KIGRXLEKLEHLNV  578
            +IG+ L+ L+HL V
Sbjct  92   RIGKGLQNLQHLKV  105



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  537  KIGRXLEKLEHLNV  578
            +IG+ L+ L+HL V
Sbjct  69   RIGKGLQNLQHLKV  82



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  86   GRGLLRLQFLQV  97



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDV+GLIVFK+G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  84   GRSLLRLQFLKV  95



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  530
             LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  L
Sbjct  24   SLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSL  83

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L++L+ L
Sbjct  84   SGRIGRGLQRLQFL  97



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  530
             LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  L
Sbjct  31   SLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSL  90

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L++L+ L
Sbjct  91   SGRIGRGLQRLQFL  104



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  88   IGRGLLQLQFL  98



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
            +G G      LNDDVLGLIVFK+ V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20   AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  510  DLHGLGLSGKIGR  548
             L G GLSGK+GR
Sbjct  80   SLDGFGLSGKLGR  92



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  540  IGR  548
            +GR
Sbjct  90   LGR  92



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  530
             LNDDVLGLIVFK+ ++DP   L +W+EDD+S C  +W  VKC+P + RV EV+L+G  L
Sbjct  38   SLNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEVNLNGFSL  97

Query  531  SGKIGRXLEKLEHL  572
            SG+IGR L++L+ L
Sbjct  98   SGRIGRGLQRLQFL  111



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGHI  86

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  87   GRGLIRLQFLQI  98



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLI FK+G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  24   NDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  84   GRGLLRLQFLQV  95



>ref|XP_002990527.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
 gb|EFJ08404.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
Length=193

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+ + DP   LA+WSED  SP  W  ++C P +G V++V L GL LSG +
Sbjct  16   NDDVLGLIVFKADLHDPRRALASWSEDSASPRNWTGIQCSPQSGTVTQVTLDGLELSGPL  75

Query  543  GRXLEKLEHLN  575
            GR L KL+HL 
Sbjct  76   GRGLLKLDHLQ  86



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  540  IGRXLEKLEHL  572
            +GR L +L+ L
Sbjct  85   LGRGLLQLQFL  95



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  540  IGRXLEKLEHL  572
            +GR L +L+ L
Sbjct  85   LGRGLLQLQFL  95



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC-AWNFVKCHPANGRVSEVDLHGLG  527
            S  LNDDVLGLIVFK+ ++DP   L++W+EDDDSPC  W  VKC+P + RVSE+ L G G
Sbjct  22   SPSLNDDVLGLIVFKADIRDPDQKLSSWNEDDDSPCNNWIGVKCNPRSNRVSELVLDGFG  81

Query  528  LSGKIGR  548
            LSGK+GR
Sbjct  82   LSGKLGR  88



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  24   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  84   GRGLLRLQFLRI  95



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  540  IGRXL  554
            +GR L
Sbjct  86   LGRGL  90



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  51   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  110

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L +
Sbjct  111  GRGLLRLQFLRI  122



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            +++   N+D+LGLIVFK+G++DP + L++W+EDD SPC W  VKC P+  RVS + L G 
Sbjct  22   SQNQPFNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGF  81

Query  525  GLSGKIGRXLEKLEHLNV  578
             LSG IG+ L +L+ L +
Sbjct  82   SLSGHIGKSLMRLQFLQI  99



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGHI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  84   GRGLLRLQFLQV  95



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  39   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  98

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  99   GRSLLRLQFLRV  110



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  543  GR  548
            GR
Sbjct  91   GR  92



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  546  R  548
            R
Sbjct  92   R  92



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  83

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  84   GRSLLRLQFLRV  95



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSG
Sbjct  28   SLNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSG  87

Query  537  KIGRXLEKLEHL  572
            KIGR L +L+ L
Sbjct  88   KIGRGLVRLQFL  99



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  543  GR  548
            GR
Sbjct  91   GR  92



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  543  GRXLEKLEHLNV  578
             R L +L+ L +
Sbjct  88   DRGLLRLQFLQI  99



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E+ L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELHLDGFALNGR  84

Query  540  IGRXLEKLEHL  572
            +GR L +L+ L
Sbjct  85   LGRGLLQLQFL  95



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIVFK+ +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  91   IGRGLLQLQAL  101



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDV+GLIV K+G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  41   NDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  100

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  101  GRSLLRLQFLKV  112



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLI FK+G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  27   NDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  86

Query  543  GRXLEKLEHLNV  578
            GR L +L  L V
Sbjct  87   GRGLLRLPFLQV  98



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  543  GRXLEKLEHLNV  578
             R L +L+ L +
Sbjct  88   DRGLLRLQSLQI  99



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LND+VLGLIVFK+ ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30   LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  540  IGRXLEKLEHL  572
            + R L++L  L
Sbjct  90   LPRGLDRLPAL  100



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LNDDVLGLIV K+ +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  540  IGRXLEKLEHL  572
            IGR L +L+ L
Sbjct  91   IGRGLLQLQAL  101



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  543  GRXLEKLEHLNV  578
             R L +L+ L +
Sbjct  91   DRGLLRLQFLQI  102



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  543  GRXLEKLEHLNV  578
             R L +L+ L +
Sbjct  91   DRGLLRLQFLQI  102



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLI FK+G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG I
Sbjct  40   NDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGHI  99

Query  543  GRXLEKLEHLNV  578
             R L KL+ L +
Sbjct  100  DRGLLKLQFLQI  111



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDD+LGLIVFK+G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG +
Sbjct  31   NDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGHV  90

Query  543  GRXLEKLEHLNV  578
             R L +L+ L +
Sbjct  91   DRGLLRLQFLQI  102



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            +++   N+D+LGLIVFK+G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23   SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  525  GLSGKIGRXLEKLEHLNV  578
             L G I R L +L+ L +
Sbjct  83   SLYGHINRGLMRLQFLQI  100



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  540  IGR  548
            +GR
Sbjct  90   LGR  92



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPC-AWNFVKCHPANGRVSEVDLHGLGLSGK  539
            NDDVLGLIVFK+G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG 
Sbjct  29   NDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSGH  88

Query  540  IGRXLEKLEHLNV  578
            IGR L +L+ L  
Sbjct  89   IGRGLLRLQSLQT  101



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +NDDVLGLIVFK+ VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL L+
Sbjct  1    MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGLSLA  58



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +3

Query  327  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  507  VDLHGLGLSGKIGRXLEKLEHLN  575
            + L GLGLSG++ R L++L  L 
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQ  97



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +3

Query  327  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  507  VDLHGLGLSGKIGRXLEKLEHLN  575
            + L GLGLSG++ R L++L  L 
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQ  97



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG I
Sbjct  31   NDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGHI  90

Query  543  GRXLEKLEHL  572
             R L +L+ L
Sbjct  91   DRGLLRLQFL  100



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG I
Sbjct  37   NDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGHI  96

Query  543  GRXLEKLEHL  572
             R L +L+ L
Sbjct  97   DRGLLRLQFL  106



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  336  AGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
            AGGA+    LND+VLGLIVFKS ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31   AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  513  LHGLGLSGKIGRXLEKLEHL  572
            L  L LSG + R L++L  L
Sbjct  91   LASLSLSGPLPRGLDRLPAL  110



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            ++DDVLGL+ FK+G+ DP   L +W +DD SPCAW  + C    GRVSE++L GL L+G+
Sbjct  4    MSDDVLGLMAFKAGLSDPTGALHSWRQDDASPCAWVGIVCDRLTGRVSELNLVGLFLAGQ  63

Query  540  IGRXLEKLEHLNV  578
            IGR L KL+ L +
Sbjct  64   IGRGLAKLDELQI  76



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  22   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  81

Query  525  GLSGKIGRXLEKLEHLNV  578
             LSG IGR L +L+ L+ 
Sbjct  82   SLSGHIGRGLLRLQSLHT  99



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  V+C     RVSE+ L G  LSG +
Sbjct  39   NDDVLGLIVFKAGLTDPLSRLTSWNEEDDSACNWVGVRCDQDTNRVSELILDGFSLSGHL  98

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L V
Sbjct  99   GRSLIRLQFLRV  110



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  345  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  23   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  82

Query  525  GLSGKIGRXLEKLEHLNV  578
             LSG IGR L +L+ L+ 
Sbjct  83   SLSGHIGRGLLRLQSLHT  100



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG +
Sbjct  27   NDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGHV  86

Query  543  GRXLEKLE  566
             R L +L+
Sbjct  87   NRGLLRLQ  94



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            ++DDVLGL+ FK+G+ DP   L +W EDD SPCAW  + C    GRVSE++L G  L G+
Sbjct  13   MSDDVLGLMAFKAGLHDPTEALRSWREDDASPCAWAGIVCDRVTGRVSELNLVGFSLIGQ  72

Query  540  IGRXLEKLEHL  572
            IGR L KL+ L
Sbjct  73   IGRGLIKLDEL  83



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  372  VLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRX  551
            VLGLIVFK+ ++DP   L +W+EDD+  C W  VKC+P + RVSE++L GL LSGK+GR 
Sbjct  36   VLGLIVFKADIKDPNGKLRSWNEDDNDSCKWYGVKCNPRSNRVSELNLDGLSLSGKLGRG  95

Query  552  LEKLEHL  572
            L +L+ L
Sbjct  96   LLQLQSL  102



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38   MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  534  GKIGRXLEKLEHLN  575
            G + R L++L  L 
Sbjct  98   GPMPRGLDRLPALQ  111



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  534  GKIGRXLEKLEHLN  575
            G++ R L++L  L 
Sbjct  94   GRMPRGLDRLGALQ  107



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141  MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  534  GKIGRXLEKLEHLN  575
            G++ R L++L  L 
Sbjct  201  GRMPRGLDRLGALQ  214



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  534  GKIGRXLEKLEHLN  575
            G + R L++L  L 
Sbjct  93   GSMPRGLDRLPALQ  106



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG I
Sbjct  26   NDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGHI  85

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L+ 
Sbjct  86   GRGLLRLQFLHT  97



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGHI  86

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  87   GRGLLRLQFL  96



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  336  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            A G     LND+VLGLIVFKS ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  516  HGLGLSGKIGRXLEKLEHLNV  578
              L LSG + R L++L +L  
Sbjct  87   DSLSLSGPLPRGLDRLPYLET  107



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  336  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            A   ++   NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21   AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  516  HGLGLSGKIGRXLEKLEHL  572
             G  LSG IGR L +L  L
Sbjct  81   DGFSLSGHIGRGLLRLNFL  99



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHI  84

Query  543  GRXLEKLEHLNV  578
            GR L +L+ L+ 
Sbjct  85   GRGLLRLQFLHT  96



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  531  SGKIGRXLEKLEHLN  575
            SG++ R L++L  L 
Sbjct  93   SGRMPRDLDRLPALQ  107



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  85   GRGLLRLQFL  94



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  546  RXLEKLEHL  572
            R L +L+ L
Sbjct  89   RALLRLDAL  97



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  546  RXLEKLEHL  572
            R L +L+ L
Sbjct  89   RALLRLDAL  97



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  85   GRGLLRLQFL  94



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  85   GRGLLRLQFL  94



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  85   GRGLLRLQFL  94



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDSFSLSGHI  84

Query  543  GRXLEKLEHL  572
            GR L +L+ L
Sbjct  85   GRGLLRLQFL  94



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  531  SGKIGRXLEKLEHLN  575
            SG++ R L++L  L 
Sbjct  93   SGRMPRDLDRLPALQ  107



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  363  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            NDDV GLIVFK+G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG I
Sbjct  24   NDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGHI  83

Query  543  GRXLEKLEHL  572
             + L +L+ L
Sbjct  84   DKGLLRLQFL  93



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  336  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
            A G     LND+VLGLIVFKS ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  516  HGLGLSGKIGRXLEKLEHL  572
              L LSG + R L++L +L
Sbjct  85   DSLSLSGPLPRGLDRLPYL  103



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +3

Query  357  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
            +++D+V+ L+VFK+GV DP S L++W++ D  PC W  + C  A GRV+++ L GL LSG
Sbjct  35   RISDEVMALLVFKAGVIDPNSVLSSWNDIDMDPCHWTGITCSSATGRVTDITLVGLSLSG  94

Query  537  KIGRXLEKLEHLNV  578
             I R L KLE L  
Sbjct  95   TIARALVKLEELQT  108



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            LND+V+GLIVFK+ ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49   LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  540  IGRXLEKL  563
            + R L++L
Sbjct  109  LPRGLDRL  116



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            L DDVL L+VFK+ V DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  26   LTDDVLALVVFKTDVSDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  85

Query  540  IGR  548
            + R
Sbjct  86   LPR  88



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            DDVL L+VFK+GV DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG++
Sbjct  26   DDVLALVVFKTGVSDPSGRLATWTEDDDRPCSWPGVGCDARTGRVTSLSLPAASLSGRL  84



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            +N++VLGL+VF+S + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30   VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  540  IG--RXLEKLEHLN  575
             G  R L++L  L 
Sbjct  90   SGVPRGLDRLPRLQ  103



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    GRV  V L   GLSG+
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGRVDAVALPSAGLSGR  82

Query  540  IGR  548
            + R
Sbjct  83   LPR  85



>ref|XP_002439964.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
 gb|EES18394.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
Length=944

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            ++DDVL L+V KSG+ DP+  LA WSED D  CAW  V C P  GRV+ +DL    L+G+
Sbjct  47   VSDDVLALVVLKSGLSDPSGRLAPWSEDADRACAWPGVSCDPRTGRVAALDLPAASLAGR  106

Query  540  IGR  548
            + R
Sbjct  107  LPR  109



>dbj|BAD15537.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD16121.1| hypothetical protein [Oryza sativa Japonica Group]
Length=260

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    GRV  V L  +G  G+
Sbjct  146  VNDDVLALVVFKSGVSDPGGLLAPWSEDADRACAWPRVSCDARTGRVDVVALPAVGFFGR  205

Query  540  IGR  548
            + R
Sbjct  206  LPR  208



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            L DDVL L+VFK  + DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  27   LTDDVLALVVFKMDISDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  86

Query  540  I  542
            +
Sbjct  87   L  87



>ref|XP_004961741.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=942

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
            ++DDVL L+V KSG+ DPA  LA WSED D  C+W  V C P  GRV+ ++L    L+G+
Sbjct  46   VSDDVLALVVLKSGLSDPAGRLAPWSEDADRACSWPGVSCDPRTGRVAALELPAASLAGR  105

Query  540  IGR  548
            + R
Sbjct  106  LPR  108



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            DP   LA+WSED  SPC W  ++C P +GRV++V L GL LSG +GR L KL+HL V
Sbjct  1    DPRRALASWSEDSASPCNWTGIQCSPQSGRVTQVTLDGLELSGPLGRGLLKLDHLQV  57



>ref|XP_010232495.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Brachypodium 
distachyon]
Length=947

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L    LSG++
Sbjct  29   DDVLALVVFKTGVADPLGRLAAWTEDDDRPCSWPGVGCDARTGRVTSLSLAAESLSGRL  87



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 5/79 (6%)
 Frame = +3

Query  354  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            + +N++VLGL+VF+S + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35   MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  534  -----GKIGRXLEKLEHLN  575
                 G I R L++L  L 
Sbjct  95   STSGTGGIPRGLDRLPALQ  113



>gb|EEE64100.1| hypothetical protein OsJ_18931 [Oryza sativa Japonica Group]
Length=875

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  360  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    G V  V L   GLS
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGPVDAVALPSAGLS  80



>ref|XP_008649763.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Zea mays]
 gb|AFW78385.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=938

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  366  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
            DDVL L+V KSG+ DPA  LA WSED D  CAW  V C     RV+ +DL    L+G++ 
Sbjct  44   DDVLALVVLKSGLFDPAGRLAPWSEDADRACAWPGVSCDSRTDRVAALDLPAASLAGRLP  103

Query  546  R  548
            R
Sbjct  104  R  104



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  450  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEKLEHLNV  578
            SPC+W +VKC+P   RV+E+ L GL L+GKIGR ++KL+HL V
Sbjct  2    SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKV  44



>gb|KDO45821.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45822.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45823.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=851

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL LN +   LI FKS ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  531  SGKIGRXLEKLEHLNV  578
            SG+I   +  L+ L V
Sbjct  86   SGEISSSISALQSLTV  101



>gb|KDO45819.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45820.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=973

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL LN +   LI FKS ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  531  SGKIGRXLEKLEHLNV  578
            SG+I   +  L+ L V
Sbjct  86   SGEISSSISALQSLTV  101



>ref|XP_011047703.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=986

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  LN D L L   K G+ DP+  L++W++ DD+PC WN V C  +  RV+ +DL  LGL
Sbjct  16   SNSLNQDGLFLQQVKLGLSDPSRALSSWNDRDDTPCGWNGVTCDKSTQRVTSIDLSNLGL  75

Query  531  SGKIGRXLEKLEHL  572
             G     L +L +L
Sbjct  76   MGPFPYFLCRLTNL  89



>ref|XP_006441549.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
 gb|ESR54789.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
Length=973

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL LN +   LI FKS ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  531  SGKIGRXLEKLEHLNV  578
            SG+I   +  L+ L V
Sbjct  86   SGEISSSISALQSLTV  101



>ref|XP_002980098.1| hypothetical protein SELMODRAFT_30384, partial [Selaginella moellendorffii]
 gb|EFJ18968.1| hypothetical protein SELMODRAFT_30384, partial [Selaginella moellendorffii]
Length=1051

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +3

Query  372  VLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRX  551
            V  LI  KS + DP+  L+TW+  D  PCAW  +KCH  + RV  + L  +GLSG +   
Sbjct  1    VASLIAIKSSLHDPSRSLSTWNASDACPCAWTGIKCHTRSLRVKSIQLQQMGLSGTLSPA  60

Query  552  LEKLEHL  572
            +  L  L
Sbjct  61   VGSLAQL  67



>ref|XP_006478192.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=973

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL LN +   LI FKS ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  531  SGKIGRXLEKLEHLNV  578
            SG+I   +  L+ L V
Sbjct  86   SGEISSSISALQSLAV  101



>gb|KHG21726.1| Serine/threonine-protein kinase BRI1-like 1 [Gossypium arboreum]
Length=1211

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFK--SGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            Q NDDV+ L+ FK  S   DP   LA W+ED  SPC+W  V C P +GRV+ ++L   GL
Sbjct  44   QSNDDVIKLMAFKRISVSSDPHGFLANWTEDSPSPCSWRGVSCSPDDGRVTALNLSYSGL  103

Query  531  SGKI  542
             G +
Sbjct  104  VGAL  107



>ref|XP_009769350.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=656

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  527
            +  LN D L L+  KS +  DP   LA+WSE D SPC WN +KC   N +V  + L    
Sbjct  22   TFALNSDGLSLLALKSAISSDPTEFLASWSESDSSPCHWNGIKCDDQNQKVISISLSAKN  81

Query  528  LSGKIGRXLEKLEHLNV  578
            L+G I   +  L +L++
Sbjct  82   LTGYIPSEIGALSNLSI  98



>gb|KJB63147.1| hypothetical protein B456_009G455100 [Gossypium raimondii]
Length=1211

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +3

Query  357  QLNDDVLGLIVFK--SGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            Q NDDV+ L+ FK  S   DP   LA W+ED  SPC+W  V C P +GRV+ ++L   GL
Sbjct  44   QSNDDVIKLMAFKRISVSSDPHGVLANWTEDSPSPCSWRGVSCSPDDGRVTALNLSYSGL  103

Query  531  SGKI  542
             G +
Sbjct  104  VGAL  107



>ref|XP_002992683.1| hypothetical protein SELMODRAFT_40400, partial [Selaginella moellendorffii]
 gb|EFJ06268.1| hypothetical protein SELMODRAFT_40400, partial [Selaginella moellendorffii]
Length=1047

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +3

Query  381  LIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRXLEK  560
            LI  KS + DP+  L+TW+  D  PCAW  +KCH  + RV  + L  +GLSG +   +  
Sbjct  1    LIAIKSSLHDPSRSLSTWNASDACPCAWTGIKCHTRSLRVKSIQLQQMGLSGTLSPAVGS  60

Query  561  LEHL  572
            L  L
Sbjct  61   LAQL  64



>ref|XP_008453173.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 isoform X1 [Cucumis melo]
Length=600

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  L +D L L+  KS + D  + L+ WS  D++PC W  + CHP + RVS V+L  + L
Sbjct  21   SFSLTEDGLTLLEIKSTLNDTKNVLSNWSPTDETPCKWTGISCHPEDSRVSSVNLPFMQL  80

Query  531  SGKIGRXLEKLEHL  572
             G I   + KL  L
Sbjct  81   GGIISPSIGKLSRL  94



>ref|XP_009421476.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=994

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL LN + L L+  K G++DP + L+ W+  D +PC W  + C  A   V+ VDL GLGL
Sbjct  18   SLSLNQEGLYLLQAKRGLEDPDNALSDWNPRDSTPCNWTGITCSSAGATVTSVDLTGLGL  77

Query  531  SGKIGRXLEKLEHL  572
            +G     L ++ +L
Sbjct  78   TGPFPASLCRIPNL  91



>ref|XP_007210873.1| hypothetical protein PRUPE_ppa003105mg [Prunus persica]
 gb|EMJ12072.1| hypothetical protein PRUPE_ppa003105mg [Prunus persica]
Length=603

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL L+ D   L+  KS + D  + L+ W   DDSPC W  + CHP + RVS ++L  + L
Sbjct  23   SLALSQDGFTLLEIKSTLNDSKNMLSDWQPSDDSPCKWTGISCHPQDLRVSSINLPYMQL  82

Query  531  SGKIGRXLEKLEHLN  575
             G I   + KL  L 
Sbjct  83   GGTISPSIGKLSRLQ  97



>ref|XP_004508778.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like isoform X1 [Cicer arietinum]
Length=600

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL L+ D L L+  KS + D  + L  W E D+SPCAW  + CHP   RV  ++L  + L
Sbjct  22   SLALSQDGLTLLEIKSTLNDTKNVLGNWQEFDESPCAWTGINCHPGEQRVRSINLPYMQL  81

Query  531  SGKIGRXLEKLEHLN  575
             G I   + KL  L 
Sbjct  82   GGIISPSIGKLSRLQ  96



>ref|XP_004138149.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like [Cucumis sativus]
 ref|XP_004154990.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like [Cucumis sativus]
 gb|KGN63649.1| hypothetical protein Csa_1G008550 [Cucumis sativus]
Length=600

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            S  L +D L L+  KS + D  + L+ WS  D++PC W  + CHP + RVS V+L  + L
Sbjct  21   SFSLTEDGLTLLEIKSTLNDTKNVLSNWSPADETPCKWTGISCHPEDSRVSSVNLPFMQL  80

Query  531  SGKIGRXLEKLEHL  572
             G I   + KL  L
Sbjct  81   GGIISPSIGKLSRL  94



>ref|XP_004508779.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like isoform X2 [Cicer arietinum]
Length=602

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +3

Query  351  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
            SL L+ D L L+  KS + D  + L  W E D+SPCAW  + CHP   RV  ++L  + L
Sbjct  22   SLALSQDGLTLLEIKSTLNDTKNVLGNWQEFDESPCAWTGINCHPGEQRVRSINLPYMQL  81

Query  531  SGKIGRXLEKLEHLN  575
             G I   + KL  L 
Sbjct  82   GGIISPSIGKLSRLQ  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090