BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS167E11

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    211   6e-60   Nicotiana tomentosiformis
ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   1e-59   Nicotiana tomentosiformis
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    206   2e-58   Nicotiana benthamiana
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    206   2e-58   Nicotiana benthamiana
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   6e-58   Nicotiana tomentosiformis
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   6e-58   Nicotiana sylvestris
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   8e-58   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    204   2e-57   Nicotiana benthamiana
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   2e-56   
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   2e-56   Solanum tuberosum [potatoes]
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    200   5e-56   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    195   3e-54   Fragaria vesca subsp. vesca
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    194   6e-54   Nicotiana benthamiana
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    189   8e-54   
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   2e-53   Cucumis melo [Oriental melon]
gb|ADN33858.1|  ATP-dependent clp protease                              192   3e-53   Cucumis melo subsp. melo
ref|XP_010099042.1|  Chaperone protein ClpC                             188   6e-53   
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    189   4e-52   
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    189   6e-52   Prunus mume [ume]
emb|CBI15747.3|  unnamed protein product                                187   8e-52   Vitis vinifera
emb|CDO98310.1|  unnamed protein product                                187   2e-51   Coffea canephora [robusta coffee]
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             187   2e-51   Prunus persica
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    186   6e-51   Solanum lycopersicum
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    186   7e-51   
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    185   1e-50   Solanum tuberosum [potatoes]
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    185   2e-50   Vitis vinifera
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         183   5e-50   Jatropha curcas
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           182   1e-49   Gossypium arboreum [tree cotton]
gb|KJB19711.1|  hypothetical protein B456_003G116200                    180   3e-49   Gossypium raimondii
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    181   4e-49   Cucumis melo [Oriental melon]
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    180   9e-49   Cucumis sativus [cucumbers]
gb|KJB19710.1|  hypothetical protein B456_003G116200                    180   9e-49   Gossypium raimondii
gb|KJB19712.1|  hypothetical protein B456_003G116200                    180   9e-49   Gossypium raimondii
ref|XP_007038115.1|  CLPC                                               180   9e-49   
gb|EPS63111.1|  hypothetical protein M569_11677                         168   1e-48   Genlisea aurea
ref|XP_002511102.1|  ATP-dependent clp protease, putative               179   2e-48   Ricinus communis
gb|AAD02267.1|  ClpC protease                                           178   2e-48   Spinacia oleracea
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    178   3e-48   Solanum tuberosum [potatoes]
gb|KJB07945.1|  hypothetical protein B456_001G054700                    176   2e-47   Gossypium raimondii
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    176   3e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     172   6e-47   Eucalyptus grandis [rose gum]
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          174   7e-47   Medicago truncatula
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               167   5e-46   Erythranthe guttata [common monkey flower]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    172   7e-46   Eucalyptus grandis [rose gum]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    172   8e-46   Eucalyptus grandis [rose gum]
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    171   1e-45   Cicer arietinum [garbanzo]
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    171   2e-45   Glycine max [soybeans]
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             171   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    170   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    169   4e-45   
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    169   5e-45   Pisum sativum [garden pea]
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   169   5e-45   Glycine soja [wild soybean]
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    169   5e-45   Glycine max [soybeans]
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    168   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    168   1e-44   
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    168   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             168   2e-44   
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    157   2e-44   Phoenix dactylifera
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    167   2e-44   Medicago truncatula
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    167   2e-44   Populus euphratica
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    165   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             165   2e-43   Phaseolus vulgaris [French bean]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             165   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    165   2e-43   Nelumbo nucifera [Indian lotus]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    165   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    165   2e-43   Malus domestica [apple tree]
ref|XP_002865831.1|  heat shock protein 93-V                            163   7e-43   
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    163   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    163   1e-42   Populus euphratica
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    163   1e-42   Glycine max [soybeans]
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          163   1e-42   Medicago truncatula
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             161   4e-42   Capsella rubella
gb|AAC04687.1|  ClpC                                                    161   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    160   6e-42   Tarenaya hassleriana [spider flower]
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    160   9e-42   
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   1e-41   Elaeis guineensis
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    160   1e-41   Glycine max [soybeans]
emb|CDX83052.1|  BnaA01g20520D                                          160   1e-41   
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    160   1e-41   Brassica rapa
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    160   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    160   1e-41   Camelina sativa [gold-of-pleasure]
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   160   1e-41   Glycine soja [wild soybean]
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    159   3e-41   
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    159   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    157   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    157   1e-40   Tarenaya hassleriana [spider flower]
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                157   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             156   1e-40   
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    157   1e-40   Cicer arietinum [garbanzo]
ref|XP_002877635.1|  AtClpC                                             157   1e-40   
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             156   3e-40   
emb|CDX68504.1|  BnaC01g25820D                                          155   5e-40   
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   7e-40   Sesamum indicum [beniseed]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    154   1e-39   Phoenix dactylifera
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    154   1e-39   Camelina sativa [gold-of-pleasure]
emb|CDY45800.1|  BnaC03g16230D                                          153   4e-39   Brassica napus [oilseed rape]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    153   4e-39   Brassica rapa
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    152   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    152   6e-39   Phoenix dactylifera
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    151   1e-38   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   2e-38   Citrus sinensis [apfelsine]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    148   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    150   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    150   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    150   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    148   2e-37   Elaeis guineensis
ref|NP_566912.2|  Clp ATPase                                            148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190035.1|  Clp ATPase                                         148   2e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87915.1|  AtClpC                                                 148   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             147   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    144   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    144   5e-36   Elaeis guineensis
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254              135   5e-36   
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    144   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05878.1|  BnaC08g20550D                                          142   2e-35   
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    138   6e-34   Brachypodium distachyon [annual false brome]
emb|CAN78847.1|  hypothetical protein VITISV_010724                     138   6e-34   Vitis vinifera
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    138   7e-34   Brassica napus [oilseed rape]
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    138   7e-34   Brachypodium distachyon [annual false brome]
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    133   1e-33   Triticum urartu
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    133   6e-33   
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...    129   6e-33   Triticum urartu
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   8e-33   Setaria italica
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   8e-33   Setaria italica
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    134   1e-32   Triticum urartu
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    134   1e-32   Zea mays [maize]
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       133   2e-32   Cucumis sativus [cucumbers]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360             123   3e-32   Chlamydomonas reinhardtii
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          132   5e-32   Sorghum bicolor [broomcorn]
gb|EEC77204.1|  hypothetical protein OsI_15716                          132   7e-32   Oryza sativa Indica Group [Indian rice]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    132   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    132   1e-31   Brachypodium distachyon [annual false brome]
emb|CAE05148.2|  OSJNBa0039C07.4                                        131   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          131   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    130   2e-31   Oryza brachyantha
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    130   2e-31   
ref|WP_032554674.1|  hypothetical protein                               120   3e-31   
ref|WP_032558761.1|  hypothetical protein                               120   3e-31   
dbj|BAJ99801.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_032553896.1|  hypothetical protein                               120   5e-31   
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    129   8e-31   Setaria italica
ref|NP_001169540.1|  uncharacterized protein LOC100383416               129   9e-31   Zea mays [maize]
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     124   1e-30   Monoraphidium neglectum
ref|XP_001756645.1|  predicted protein                                  129   1e-30   
ref|XP_001779162.1|  predicted protein                                  128   2e-30   
ref|NP_001066442.1|  Os12g0230100                                       128   2e-30   
gb|EEC69045.1|  hypothetical protein OsI_37876                          127   6e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             127   6e-30   
gb|EDZ93048.1|  Clp domain protein                                      123   7e-30   Arthrospira maxima CS-328
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              126   1e-29   Volvox carteri f. nagariensis
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    123   1e-29   
gb|AAB67745.1|  ClpC                                                    125   1e-29   Synechococcus elongatus PCC 7942
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             125   2e-29   Selaginella moellendorffii
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     125   2e-29   Nostoc sp. PCC 7524
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    125   2e-29   Nostoc sp. PCC 7120
gb|AFW96628.1|  ATP-dependent Clp family protein                        125   2e-29   Anabaena sp. 90
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     125   2e-29   Monoraphidium neglectum
gb|EHC12174.1|  ATPase AAA-2 domain protein                             125   2e-29   Fischerella thermalis
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             124   3e-29   
ref|WP_044105586.1|  Clp protease ClpX                                  124   3e-29   cyanobacterium endosymbiont of Epithemia turgida
emb|CDX84888.1|  BnaA03g13420D                                          124   3e-29   
gb|ABK95905.1|  unknown                                                 124   3e-29   Populus trichocarpa [western balsam poplar]
ref|WP_039899756.1|  Clp protease ClpX                                  124   3e-29   Microcystis sp. T1-4
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    124   3e-29   Chamaesiphon minutus
ref|WP_038544339.1|  Clp protease ClpX                                  124   4e-29   Synechococcus sp. KORDI-100
ref|WP_028951828.1|  Clp protease ClpX                                  124   4e-29   Synechococcus sp. CC9616
ref|WP_038554285.1|  Clp protease ClpX                                  124   4e-29   Synechococcus sp. KORDI-52
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   Synechococcus sp. CC9605
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   Acaryochloris marina
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   Synechococcus
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   Synechococcus sp. RS9917
ref|WP_015107874.1|  chaperone ATPase                                   124   4e-29   Cyanobium gracile
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Microcystis aeruginosa
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    124   5e-29   
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    124   5e-29   Microcystis
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. WH 8016
ref|WP_041428551.1|  Clp protease ClpX                                  124   5e-29   Synechococcus sp. WH 7803
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Acaryochloris sp. CCMEE 5410
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Microcystis aeruginosa
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Microcystis aeruginosa
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Microcystis aeruginosa
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. WH 5701
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. WH 7805
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. CB0101
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    124   5e-29   Richelia intracellularis
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Cyanobium sp. PCC 7001
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    124   5e-29   Richelia intracellularis
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. CC9311
ref|WP_043691512.1|  Clp protease ClpX                                  124   5e-29   Synechococcus sp. KORDI-49
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   Synechococcus sp. RS9916
ref|WP_028082153.1|  Clp protease ClpX                                  124   5e-29   Dolichospermum circinale
ref|WP_028090149.1|  Clp protease ClpX                                  124   5e-29   Dolichospermum circinale
gb|AHF63374.1|  ATPase                                                  124   5e-29   Synechococcus sp. WH 8109
ref|WP_029638478.1|  Clp protease ClpX [                                124   5e-29   [Scytonema hofmanni] UTEX B 1581
ref|WP_027404746.1|  Clp protease ClpX                                  124   6e-29   Aphanizomenon flos-aquae
ref|NP_050661.1|  Clp protease ATP binding subunit                      124   6e-29   Guillardia theta
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Gloeobacter violaceus
ref|YP_001293474.1|  Clp protease ATP binding subunit                   124   6e-29   Rhodomonas salina
ref|WP_015126250.1|  chaperone ATPase                                   124   6e-29   Synechococcus sp. PCC 6312
ref|WP_027250152.1|  Clp protease ClpX                                  124   6e-29   Planktothrix agardhii
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Synechococcus sp. PCC 7335
ref|WP_015128787.1|  ATPase                                             124   6e-29   Calothrix sp. PCC 7507
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    124   6e-29   Synechococcus
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    124   6e-29   Planktothrix
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Trichormus variabilis
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Trichormus azollae
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        124   6e-29   Anabaena cylindrica
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        124   6e-29   Pseudanabaena biceps
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    124   6e-29   Lyngbya confervoides
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Cyanothece sp. PCC 7425
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        124   6e-29   Gloeobacter kilaueensis
ref|WP_041035515.1|  Clp protease ClpX                                  124   6e-29   Tolypothrix campylonemoides
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Synechococcus sp. RCC307
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    124   6e-29   Leptolyngbya sp. PCC 7375
ref|WP_039200429.1|  Clp protease ClpX                                  124   6e-29   Aphanizomenon flos-aquae
ref|WP_042153862.1|  Clp protease ClpX                                  124   6e-29   Planktothrix agardhii
ref|WP_037222416.1|  Clp protease ClpX                                  124   6e-29   
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Nodularia spumigena
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    124   6e-29   Planktothrix
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    124   6e-29   Rubidibacter lacunae
ref|WP_041458572.1|  Clp protease ClpX                                  124   6e-29   Anabaena sp. 90
ref|WP_041555480.1|  Clp protease ClpX                                  124   6e-29   Nostoc sp. PCC 7524
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Aphanizomenonaceae
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Pseudanabaena sp. PCC 6802
ref|WP_039740335.1|  Clp protease ClpX                                  124   6e-29   
ref|WP_015111477.1|  ATPase                                             124   6e-29   Nostoc sp. PCC 7107
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        124   6e-29   Gloeocapsa sp. PCC 7428
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Scytonema hofmannii
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   Lyngbya sp. PCC 8106
ref|WP_035989117.1|  Clp protease ClpX                                  123   6e-29   Leptolyngbya sp. KIOST-1
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     124   6e-29   Synechococcus elongatus PCC 6301
ref|WP_015166218.1|  ATPase                                             124   6e-29   Pseudanabaena sp. PCC 7367
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Aphanizomenonaceae
ref|WP_044521582.1|  Clp protease ClpX                                  123   6e-29   Nostocaceae
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Geminocystis herdmanii
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Anabaena sp. PCC 7108
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Oscillatoria sp. PCC 10802
ref|WP_015166859.1|  chaperone ATPase                                   123   6e-29   Synechococcus sp. PCC 7502
ref|WP_026097796.1|  Clp protease ClpX                                  123   6e-29   Geitlerinema sp. PCC 7105
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Moorea producens
ref|WP_015227883.1|  chaperone ATPase                                   123   6e-29   Dactylococcopsis salina
ref|WP_035153450.1|  Clp protease ClpX                                  123   6e-29   Calothrix sp. 336/3
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Nostoc punctiforme
gb|KIE07407.1|  Clp protease ClpX                                       123   6e-29   Tolypothrix bouteillei VB521301
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     123   6e-29   Coleofasciculus chthonoplastes
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     123   6e-29   Leptolyngbya sp. Heron Island J
ref|WP_015225278.1|  ATPase                                             123   6e-29   Halothece sp. PCC 7418
ref|WP_027842712.1|  Clp protease ClpX                                  123   7e-29   Mastigocoleus testarum
ref|XP_007509860.1|  predicted protein                                  124   7e-29   Bathycoccus prasinos
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Synechococcus sp. PCC 7336
gb|AGW80480.1|  Clp protease ATP binding subunit                        123   7e-29   Planktothrix agardhii NIVA-CYA 68
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Fortiea contorta
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Mastigocladopsis repens
ref|WP_015117004.1|  chaperone ATPase                                   123   7e-29   Rivularia sp. PCC 7116
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   7e-29   Kamptonema
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Prochlorothrix hollandica
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Trichodesmium erythraeum
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Nodosilinea nodulosa
ref|WP_040943370.1|  Clp protease ClpX                                  123   7e-29   
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    123   7e-29   Oscillatoriales cyanobacterium JSC-12
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Cyanothece sp. PCC 7822
ref|WP_036485541.1|  Clp protease ClpX                                  123   7e-29   Myxosarcina sp. GI1
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   filamentous cyanobacterium ESFC-1
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Calothrix sp. PCC 7103
gb|KIJ80614.1|  Clp protease ClpX                                       123   7e-29   Scytonema tolypothrichoides VB-61278
ref|WP_040939432.1|  Clp protease ClpX                                  123   7e-29   
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Spirulina subsalsa
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   7e-29   Arthrospira
ref|WP_015170572.1|  ATPase                                             123   7e-29   Geitlerinema sp. PCC 7407
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Pleurocapsa sp. PCC 7319
ref|WP_015200797.1|  ATPase                                             123   7e-29   Calothrix parietina
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Candidatus Atelocyanobacterium thalassa
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   cyanobacterium PCC 7702
ref|WP_015185589.1|  chaperone ATPase                                   123   7e-29   Microcoleus sp. PCC 7113
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Leptolyngbya boryana
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Crocosphaera watsonii
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   Synechococcus sp. BL107
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   7e-29   Cyanothece
ref|WP_036000319.1|  Clp protease ClpX                                  123   7e-29   
ref|WP_023066904.1|  istB-like ATP binding family protein               123   7e-29   
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        123   7e-29   
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    123   7e-29   
ref|WP_040054326.1|  Clp protease ClpX                                  123   7e-29   
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   7e-29   
ref|WP_015145231.1|  chaperone ATPase                                   123   7e-29   
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    123   7e-29   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   
ref|WP_015201320.1|  ATPase                                             123   7e-29   
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   
ref|WP_015219504.1|  ATPase                                             123   7e-29   
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     123   7e-29   
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     123   8e-29   
ref|WP_026734190.1|  Clp protease ClpX                                  123   8e-29   
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    123   8e-29   
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    123   8e-29   
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     123   8e-29   
ref|WP_015147858.1|  chaperone ATPase                                   123   8e-29   
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    123   8e-29   
ref|WP_026086125.1|  Clp protease ClpX                                  123   8e-29   
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     123   8e-29   
gb|EEE52971.1|  hypothetical protein OsJ_35634                          123   8e-29   
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     123   8e-29   
ref|WP_026722984.1|  Clp protease ClpX                                  123   8e-29   
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   8e-29   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     123   8e-29   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     123   9e-29   
ref|WP_028949334.1|  Clp protease ClpX                                  123   9e-29   
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     123   1e-28   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    123   1e-28   
ref|WP_036906575.1|  Clp protease ClpX                                  123   1e-28   
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    123   1e-28   
ref|WP_038653496.1|  Clp protease ClpX                                  123   1e-28   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    123   1e-28   
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     123   1e-28   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      123   1e-28   
ref|WP_036909986.1|  Clp protease ClpX                                  123   1e-28   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     122   1e-28   
ref|WP_015157369.1|  ATPase                                             122   1e-28   
ref|WP_039713557.1|  Clp protease ClpX                                  122   1e-28   
ref|WP_036902654.1|  Clp protease ClpX                                  122   1e-28   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    122   2e-28   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    122   2e-28   
ref|WP_015132374.1|  ATPase                                             122   2e-28   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     122   2e-28   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     122   2e-28   
ref|WP_024545676.1|  Clp protease ClpX                                  122   2e-28   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     122   2e-28   
ref|WP_030006722.1|  Clp protease ClpX                                  122   2e-28   
emb|CDY64710.1|  BnaA06g38690D                                          122   2e-28   
ref|XP_002505550.1|  predicted protein                                  122   2e-28   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      122   2e-28   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    122   2e-28   
ref|WP_015223717.1|  ATPase                                             122   2e-28   
ref|WP_032527486.1|  Clp protease ClpX                                  122   3e-28   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     122   3e-28   
ref|WP_041677108.1|  Clp protease ClpX                                  122   3e-28   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     122   3e-28   
ref|WP_019474998.1|  hypothetical protein                               121   3e-28   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              121   3e-28   
ref|WP_032523561.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     121   4e-28   
ref|WP_025932059.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025906631.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025924610.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025923359.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_042850567.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025964345.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025944115.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025972244.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025965623.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_032514205.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025970276.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025961281.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025956785.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025954710.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_025958425.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_025968127.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     121   4e-28   
ref|WP_029976482.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025962478.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025894690.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_032524589.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     121   4e-28   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     121   4e-28   
ref|WP_025955884.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025935959.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025928515.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_025926674.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    121   4e-28   
ref|WP_025893396.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_025914744.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_032522603.1|  Clp protease ClpX                                  121   4e-28   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     121   5e-28   
ref|WP_032516684.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_025959792.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_025941830.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_032519126.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_032515069.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_025930513.1|  Clp protease ClpX                                  121   5e-28   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     121   5e-28   
ref|XP_001766010.1|  predicted protein                                  121   5e-28   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     121   5e-28   
ref|YP_007947862.1|  Clp protease ATP binding subunit                   121   5e-28   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    121   5e-28   
gb|AJA71272.1|  HSP100                                                  121   5e-28   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     121   5e-28   
ref|WP_036896901.1|  Clp protease ClpX                                  120   6e-28   
gb|ADJ57429.1|  clp protease ATP binding subunit                        120   6e-28   
ref|YP_537014.1|  Clp protease ATP binding subunit                      120   6e-28   
gb|AIA21360.1|  Clp protease ATP binding subunit                        120   6e-28   
ref|YP_009027615.1|  Clp protease ATP binding subunit                   120   6e-28   
gb|AIA21566.1|  Clp protease ATP binding subunit                        120   6e-28   
gb|AFC40000.1|  Clp protease ATP binding subunit                        120   6e-28   
ref|XP_001766888.1|  predicted protein                                  120   6e-28   
ref|NP_053942.1|  Clp protease ATP binding subunit                      120   7e-28   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit      120   7e-28   
emb|CEG02027.1|  Clp, N-terminal                                        120   9e-28   
ref|WP_025781797.1|  Clp protease ClpX                                  120   1e-27   
ref|YP_277337.1|  Clp protease ATP binding subunit                      120   1e-27   
gb|AJH65889.1|  ATP-dependent Clp protease                              120   1e-27   
ref|YP_007627346.1|  Clp protease ATP binding subunit                   120   1e-27   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...    120   1e-27   
ref|YP_009019572.1|  Clp protease ATP binding subunit                   120   1e-27   
ref|YP_063564.1|  Clp protease ATP binding subunit                      120   1e-27   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                  120   1e-27   
ref|YP_007878188.1|  Clp protease ATP binding subunit                   119   1e-27   
gb|AJO68399.1|  Clp protease ATP binding subunit                        119   1e-27   
ref|NP_045112.1|  Clp protease ATP binding subunit                      119   2e-27   
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     119   2e-27   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...    115   3e-27   
ref|XP_003063658.1|  predicted protein                                  119   3e-27   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type                119   3e-27   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...    118   5e-27   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...    118   5e-27   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...    118   5e-27   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...    118   5e-27   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...    118   5e-27   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...    118   6e-27   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...    117   7e-27   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935             114   9e-27   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit          117   1e-26   
ref|YP_005088687.1|  Clp protease ATP binding subunit                   117   1e-26   
ref|YP_008145463.1|  Clp protease ATP binding subunit                   117   2e-26   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)          116   2e-26   
ref|WP_032525473.1|  hypothetical protein                               107   3e-26   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C              116   4e-26   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain                112   5e-26   
ref|YP_009051035.1|  Clp protease ATP binding subunit                   115   6e-26   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...    115   7e-26   
ref|NP_849021.1|  Clp protease ATP binding subunit                      115   7e-26   
ref|WP_017285691.1|  hypothetical protein                               110   9e-26   
ref|WP_026735736.1|  hypothetical protein                               107   1e-25   
ref|YP_007476253.1|  Clp protease ATP binding subunit                   113   2e-25   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...    111   1e-24   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...    109   5e-24   
gb|AJH65844.1|  ATP-dependent Clp protease                              109   5e-24   
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166              108   1e-23   
gb|ABG51946.1|  TPR repeat containing protein                           108   1e-23   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein     108   1e-23   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit     108   2e-23   
gb|AFY44720.1|  Clp domain protein                                      105   5e-23   
gb|AFR24744.1|  ATP-dependent clp protease ATP-binding subunit          106   6e-23   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit     106   7e-23   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein     106   7e-23   
ref|WP_039961643.1|  Clp protease ClpX, partial [                       106   7e-23   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein     105   1e-22   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein     105   1e-22   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein     105   1e-22   
ref|YP_003359282.1|  Clp protease ATP binding subunit                   105   2e-22   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein     104   3e-22   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein     104   3e-22   
ref|WP_015197969.1|  Clp domain-containing protein                      103   3e-22   
ref|WP_015126728.1|  ATPase                                             104   3e-22   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                             104   3e-22   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein     104   4e-22   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                        103   4e-22   
ref|WP_032555672.1|  hypothetical protein                             95.5    4e-22   
ref|WP_044292615.1|  Clp protease ClpX                                  103   4e-22   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   
ref|WP_015137763.1|  chaperone ATPase                                   103   5e-22   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit     103   5e-22   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein     103   6e-22   
ref|WP_015147677.1|  chaperone ATPase                                   103   6e-22   
ref|WP_013321074.1|  Clp domain-containing protein                      104   6e-22   
ref|WP_027845315.1|  Clp protease ClpX                                  103   6e-22   
gb|KIJ85031.1|  Clp protease ClpX                                       103   9e-22   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein     103   9e-22   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...    103   9e-22   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein     103   9e-22   
gb|KIE09004.1|  Clp protease ClpX                                       103   1e-21   
ref|WP_041038849.1|  Clp protease ClpX                                  103   1e-21   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein     102   1e-21   
ref|WP_029638259.1|  Clp protease ClpX [                                102   1e-21   
ref|WP_042466185.1|  Clp protease ClpX                                  102   1e-21   
ref|WP_015181544.1|  chaperone ATPase                                   102   1e-21   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein     102   1e-21   
ref|WP_009630510.1|  ATPase with chaperone activity, ATP-binding ...    102   1e-21   
gb|EMT20629.1|  ATP-dependent Clp protease ATP-binding subunit cl...    102   2e-21   
ref|WP_015199655.1|  ATPase                                             102   2e-21   
ref|XP_003576089.1|  PREDICTED: chaperone protein ClpC2, chloropl...    102   2e-21   
ref|WP_039752731.1|  Clp protease ClpX                                  102   2e-21   
ref|WP_015113826.1|  ATPase                                             102   2e-21   
ref|WP_035148903.1|  Clp protease ClpX                                  102   2e-21   
ref|WP_026735213.1|  Clp protease ClpX                                  101   3e-21   
ref|WP_006196989.1|  ATP-dependent Clp protease ATP-binding protein     101   3e-21   
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein     101   4e-21   
ref|WP_026082520.1|  Clp protease ClpX                                  100   5e-21   
ref|WP_028082386.1|  Clp protease ClpX                                  100   6e-21   
ref|WP_015083493.1|  ATP-dependent Clp protease                         100   6e-21   
ref|WP_028090410.1|  Clp protease ClpX                                  100   7e-21   
dbj|BAK06755.1|  predicted protein                                      100   9e-21   
ref|WP_027402031.1|  Clp protease ClpX                                99.8    2e-20   
ref|WP_039204073.1|  Clp protease ClpX                                99.4    2e-20   



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 154/180 (86%), Gaps = 4/180 (2%)
 Frame = +2

Query  20   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  199
             L  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+G
Sbjct  8    DLWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSG  63

Query  200  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  379
            LRG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEAR
Sbjct  64   LRGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEAR  123

Query  380  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  124  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  183



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 154/179 (86%), Gaps = 4/179 (2%)
 Frame = +2

Query  23   LGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGL  202
            +  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GL
Sbjct  1    MWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGL  56

Query  203  RGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARR  382
            RG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARR
Sbjct  57   RGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARR  116

Query  383  LGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  175



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ +SGQTLHSKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RS QTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSEQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ RSG+TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGETLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 146/175 (83%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLV STNIP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  N
Sbjct  1    MARVLVHSTNIPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD MAR GQ L+SKV  A S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMARPGQDLYSKVGVAISSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 149/190 (78%), Gaps = 19/190 (10%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FV---------------gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  529
            FV                  +ILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  117  FVGTEQILLGLIGEGTGIAAKILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  176

Query  530  GFVAVEIPFT  559
            GFVAVEIPFT
Sbjct  177  GFVAVEIPFT  186



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTN+P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  N
Sbjct  1    MARVLVQSTNVPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALDTM R GQ  +SKVA   S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTMMRPGQDFYSKVAITRSSRRQKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD MA+ GQ  +SK+  A + RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 4/180 (2%)
 Frame = +2

Query  20   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  199
            S+  +MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+G
Sbjct  44   SVSAVMARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSG  99

Query  200  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  379
            LRG NALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEAR
Sbjct  100  LRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEAR  159

Query  380  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  160  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  219



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 147/175 (84%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR +VQSTN+ SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  N
Sbjct  1    MARAIVQSTNVSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD M ++GQ+LHSKVA ATS RRGRGSR   +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDMMVKTGQSLHSKVAIATSSRRGRGSRMAPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQSTNIP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD MA+ GQ  +SK+  A + RR        KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRKASRCVP-KAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = +2

Query  32   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  211
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  212  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  388
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  389  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+AVEIPFT
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFT  173



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = +2

Query  32   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  211
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  212  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  388
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  389  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+AVEIPFT
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFT  173



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 146/176 (83%), Gaps = 5/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST+I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG N
Sbjct  1    MARALVQSTDILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCN  56

Query  215  ALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            ALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   ALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+AVEIPFT
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFT  172



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 145/175 (83%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+GLRG N
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSGLRGAN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV STNIP+L  G   G    S + +   +    M+CS++ P+L LR F+GLR  N
Sbjct  1    MARLLVHSTNIPALSHGVKHG---LSQESETSRRTATKMMCSTRPPALTLRGFSGLRNSN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT+ RSGQ  HS+VA + S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRSGQDFHSRVAISMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA++L QS  +P+L++  + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILAQSAIVPTLLSSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD + R GQ  HSKV  + S +RGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRYGQDFHSKVGISISSQRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 142/176 (81%), Gaps = 5/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQ TNIP LV    +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            +LD M R GQ  HSK+A A S RR  R SR V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKMAIAISSRRVGRASRCVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG GFVAVEIPFT
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVAVEIPFT  172



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQ TNIP LV    + +   S +G G  KRVV M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VARKSPSSRGSGNAKRVVKMMSSVHSPGMRMRSFSGLRGLN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            +LD M R GQ  HSKVA A S RRG      V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKVAIAISSRRGGRPSRGVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG GFVAVEIPFT
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVAVEIPFT  172



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA+VL QST +P+LV   + G  K S K KG       M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKVLAQSTIVPALVTSRSHGPSKESSKSKG----SAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M R GQ   SKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNMVRFGQDFRSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQ-SPSLKLRSFTGLRGG  211
            MA VLVQST++PS V+   +    G  +   K +R V MLCSS+ +P+  +RSF+G RG 
Sbjct  1    MAGVLVQSTSLPSSVS---LANNGGKLEASTKNRRAVTMLCSSRLAPARTMRSFSGFRGV  57

Query  212  NALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRL  385
            N LD +  +S QTLHSKVA A    R  R +R   +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   NVLDRLVQKSSQTLHSKVAEAAGPSRRGRRTRMAPRAMFERFTEKAIKVIMLAQEEARRL  117

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  175



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV S N+P+L      GQ + SG  +    +   M+CSS+ P+L LR +TGLR  N
Sbjct  1    MARLLVHSINVPALAPHIKHGQSQESGTSRRTATK---MMCSSRLPALTLRGYTGLRSSN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM RSG   HS+VA   S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTMLRSGLDFHSRVAITMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 143/175 (82%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L+QSTNIPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGN
Sbjct  1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDTLGTTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = +2

Query  35   MARVLVQSTNIPS--LVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  208
            MAR LVQST+I S   VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG
Sbjct  1    MARALVQSTDILSSVAVAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRG  56

Query  209  GNALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  385
             NALDT+  +SG+TLHSKVAAAT  RR +G R V KAMFERFTEKAIK IMLAQ+EARRL
Sbjct  57   CNALDTLLVKSGETLHSKVAAATFVRRSQGCRFVPKAMFERFTEKAIKGIMLAQDEARRL  116

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GH+FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS F+ VEIPFT
Sbjct  117  GHDFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSVFITVEIPFT  174



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 140/175 (80%), Gaps = 6/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA+VL QST +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  
Sbjct  1    MAKVLAQSTIVPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGST  54

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD M R  Q  HSKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   SLDNMVRVDQDFHSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  169



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L+QST IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGN
Sbjct  1    MAGALIQSTTIPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTLGSTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 139/175 (79%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS N+P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTIN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM R G   H+KV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLDTMLRPGLDFHAKVSMAISSRRARAKRIIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 138/176 (78%), Gaps = 8/176 (5%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTN+PS V+      F+GS K K        MLC+S + S ++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVSWANNCPFEGSNKTKAGP----TMLCNSLATSARMRSFSGLRGAN  56

Query  215  ALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            ++D M +   QTL SKV+ +  G++ R      +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SIDMMLQKNIQTLQSKVSVSRRGKKIRTGA---RAMFERFTEKAIKVIMLAQEEARRLGH  113

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  114  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  169



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL Q  N+P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQPINVPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  391
             LDTM R G   HSKV+ A S  R   +   + KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   HLDTMLRPGLDFHSKVSIAISSSRRARATRCIPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 138/175 (79%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS N+P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSVNVPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM R G   HSKV+ ATS R+ R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRQARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS  +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N
Sbjct  1    MARVLAQSIGMPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD ++RS ++L SK+  +TS RR R  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRSLPSKMLTSTSSRRERAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 138/175 (79%), Gaps = 7/175 (4%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTN+ + V G+  GQF+GS +      R   M  +  +PSL LR F+GLR  N
Sbjct  1    MARALVQSTNLSAAV-GQHHGQFRGSNR------RSSIMAYNIPAPSLMLRGFSGLRASN  53

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD+M RS    HSKVAAA S  R + SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   ALDSMLRSHCNFHSKVAAAISIPRAKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  168



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV S NIP++       QF+ S K +    R   M+ SS S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCLRHCQFEESKKRRDSSAR---MMSSSPSQGLVMSGYSGLRSAN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT+ R GQ+ HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGQSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 138/175 (79%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS ++P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             L+TM R G   HSKV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLNTMMRPGLDFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQST IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSLVTGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSCYTGLRSVN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD   +  + L S V  A + R  R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRCERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHCQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 134/175 (77%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQS  +PS V     GQ KG+GK +    +   M+ + +S  L+L+ F GLRG N
Sbjct  1    MAGALVQSAILPSQVVSRNRGQLKGAGKTR----KAPKMMGNLRSHPLRLQDFAGLRGAN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISSPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 6/178 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M+R L QS N+P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N
Sbjct  1    MSRALAQSINVPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  385
            +LD+M R GQ  HSKV       R +G   SR V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPGQDFHSKVLTQIGTNRAKGGRGSRCVTKAMFERFTEKAIKVIMLAQEEARRL  117

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  175



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHRQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSKV    S  +G+G R V KA
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSKVRLHISSCKGKGCRFVPKA  89

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  150  VEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QS  +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N
Sbjct  1    MARVLAQSVTVPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDTM R G    SKV+ ATS RRGR +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFRSKVSIATSARRGRATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 135/174 (78%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N 
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRTRRPVKMMCSQLQVSGLRMQGFLGLRGNNV  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+ RS Q  HS+V  A +  +G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGRSRQDFHSRVRQAMNVPKGKASRCVTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = +2

Query  32   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  211
            IMA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  
Sbjct  29   IMAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRAS  82

Query  212  NALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            NALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  83   NALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGH  142

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  143  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  198



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 136/174 (78%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQST IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSVAMGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSGYTGLRSVN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD   +  + L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 136/174 (78%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFLGLRGNNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+ ++ Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKNRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 135/175 (77%), Gaps = 6/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  N
Sbjct  1    MAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRASN  54

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   ALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  169



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+LV S NIP++       QF+ S K +      V M+ S  S  L +  ++GLR  N
Sbjct  1    MARLLVYSANIPAVAPRLRHCQFEESKKRRDSS---VKMMSSLPSRGLVMSGYSGLRSAN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  172



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 139/175 (79%), Gaps = 8/175 (5%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVLVQST +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLVQSTGMPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             +D+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PMDSLSRPRHTF----PLNTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  167



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 132/178 (74%), Gaps = 5/178 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M+RVL QS N+P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N
Sbjct  1    MSRVLAQSINVPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLN  58

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  385
            +LD+M R  Q  HSKV       R RG   SR V +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  59   SLDSMFRPRQDFHSKVLTQIGTNRARGGRGSRCVTRAMFERFTEKAIKVIMLAQEEARRL  118

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GHNFVGTEQILLGLIGEGTGI AKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct  119  GHNFVGTEQILLGLIGEGTGIGAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT  176



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFLGLRGSNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+ ++ Q  HSKV  A +  +G+ SR   KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKTRQDFHSKVRQAMTVPKGKASRCTTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 134/173 (77%), Gaps = 5/173 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNAL  220
            RVL QST  PSL    A  Q     +G G+ +R V M+C   +  L ++ F GLRG NAL
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRGNNAL  60

Query  221  DTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFV  400
            DT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNFV
Sbjct  61   DTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNFV  120

Query  401  gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  GTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  173



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L  ST + SL A     ++    +G GK +R V M+ + ++P L+++SF+GLR  N
Sbjct  1    MARLLAHST-VSSLFAS----RWNVQSQGSGKPRRYVKMMYNLEAPGLRIQSFSGLRSSN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +LD +ARSG   HSKV   TS R+G+  R V KAMFERFTEKAIKVIMLAQEEA+RLGHN
Sbjct  56   SLDFIARSGHDFHSKVRLQTSSRKGKACRFVPKAMFERFTEKAIKVIMLAQEEAQRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKS+GINLK ARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGINLKYARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 133/181 (73%), Gaps = 11/181 (6%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTN+PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGAN  56

Query  215  ALDTMA-RSGQTLHSKvaaats-----grrgrgsravvKAMFERFTEKAIKVIMLAQEEA  376
            ALD M  RSGQTL SKVAA  S       R            E F  KAIKVIMLAQEEA
Sbjct  57   ALDVMVQRSGQTLQSKVAATNSGKRGRKLRMAXXXXXXXXXXEGFX-KAIKVIMLAQEEA  115

Query  377  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPF  556
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPF
Sbjct  116  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPF  175

Query  557  T  559
            T
Sbjct  176  T  176



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 135/175 (77%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQS  +P  V      Q KGSGK +    +   M+C+ +S +L+L++F GLRG N
Sbjct  1    MAGALVQSAILPVQVVSRTCEQLKGSGKTR----KAAKMMCNLRSHALRLQAFAGLRGAN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  167



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKSSRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+  + Q  HSKV  + +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQSMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  167



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 134/174 (77%), Gaps = 6/174 (3%)
 Frame = +2

Query  41   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  217
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGRNA  60

Query  218  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  397
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  398  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            M    Q+P L+++ F GLRG N LD + RS Q  HSKV    S RRG+ SR + KAMFER
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSKVRLTMSSRRGKPSRCMPKAMFER  97

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  98   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  157

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  158  KIIGRGSGFVAVEIPFT  174



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  167  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  346
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  104

Query  347  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  526
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  105  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  164

Query  527  SGFVAVEIPFT  559
            SGFVAVEIPFT
Sbjct  165  SGFVAVEIPFT  175



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  167  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  346
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  111

Query  347  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  526
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  112  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  171

Query  527  SGFVAVEIPFT  559
            SGFVAVEIPFT
Sbjct  172  SGFVAVEIPFT  182



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M   L++ TN+PS V     GQ  GS K +    +   MLCS+Q  +++L+SF+GLR  N
Sbjct  1    MTHTLIRPTNLPSSVVLGNNGQLNGSNKAR----KAPTMLCSTQPTAIRLQSFSGLRRAN  56

Query  215  ALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLG  388
            +LD M  +   TL SKVAAA +  R  R SR   +AMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   SLDIMVWQPRHTLQSKVAAAIAPVRQGRKSRMAPRAMFERFTEKAIKVIMLAQEEARRLG  116

Query  389  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            HNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKDAR+EVEKIIGRGSGFVAVEIPFT
Sbjct  117  HNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKDARIEVEKIIGRGSGFVAVEIPFT  173



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  201  VEKIIGRGSGFVAVEIPFT  219



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SKV    S R  +  R V KAMF
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSKVNRNISSRNEKARRCVPKAMF  90

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  91   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  150

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  151  VEKIIGRGSGFVAVEIPFT  169



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 133/178 (75%), Gaps = 6/178 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M+R+LV S N+P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N
Sbjct  1    MSRLLVHSLNVPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVN  57

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  385
            +LD+M R     HSKV       R R    +R V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPRLDFHSKVLTQIGTNRARSGRGNRVVPKAMFERFTEKAIKVIMLAQEEARRL  117

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  175



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+CS Q+P LK++SF+GLR  +ALD MAR       K   A S RR + SR V KAMF
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMARPSPGFLVKFKRAISSRREKASRCVPKAMF  115

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  176  VEKIIGRGSGFVAVEIPFT  194



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  201  VEKIIGRGSGFVAVEIPFT  219



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDEYRKPRRCVKMMYTSQTPVLSIQSFSGLRSAN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrr-grgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            A+D +AR      SKV    S R+         KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaats-grrgrgsravvKAMF  322
            MLCS+    L L  FTGLR  NALD M R +GQTL SK+AA  +  +RG+ +R V +AMF
Sbjct  35   MLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSKIAAKNTFAKRGKHARMVPRAMF  94

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  95   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  154

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  155  VEKIIGRGSGFVAVEIPFT  173



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 131/175 (75%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L QS  +P+ V     GQ KGSGK +        M+C+ +   L+L+ F GLRG N
Sbjct  1    MAGALFQSAILPAQVLSRNRGQLKGSGKAR----EAAKMMCNMRLHPLRLQGFAGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD ++RS +  HS V+A  S  + +  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQAKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  319
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSKVNLNISYRMEKARRCVPKAM  90

Query  320  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  499
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  500  EVEKIIGRGSGFVAVEIPFT  559
            EVEKIIGRGSGFVAVEIPFT
Sbjct  151  EVEKIIGRGSGFVAVEIPFT  170



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +2

Query  143  VAMLCSSQ--SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   KV  A +  +G+GSR VVKA
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGKVRHAMNVPKGKGSRGVVKA  94

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  155  VEVEKIIGRGSGFVAVEIPFT  175



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  137  RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  313
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   KV  A +  +G+GSR VVK
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVK  92

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  152

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            RVEVEKIIGRGSGFVAVEIPFT
Sbjct  153  RVEVEKIIGRGSGFVAVEIPFT  174



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  319
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSKVNLNISSRIEKARRCVPKAM  90

Query  320  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  499
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  500  EVEKIIGRGSGFVAVEIPFT  559
            EVEKIIGRGSGFVAVEIPFT
Sbjct  151  EVEKIIGRGSGFVAVEIPFT  170



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LV+S   P++ +   I       +G  +  R+  M+C+ +   L+L  FTGLR  N
Sbjct  1    MAGTLVKSATFPAVTSRAHI-----QIQGSRRPSRLTLMMCNVRVSPLRLHGFTGLRQLN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALD   +SG+  HS ++A     RGR  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDFPYKSGKDFHSLISALNPASRGRAKRVVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR+EVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGISLKDARIEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L  ST+   L +G          +   K +R V M+ +SQ+  L ++SF+GLR  N
Sbjct  1    MARLLANSTSRSLLGSGRDF-----QSEDYRKPRRCVKMMYTSQTSVLSIQSFSGLRASN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  391
            ALD +AR       KV    S  R   +   V KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   ALDRVARPSHDFFGKVNLQMSSSRREKASRGVTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  392  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ALDT      +  +   ++  G+ GR    VVKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  176  VEKIIGRGSGFVAVEIPFT  194



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 134/175 (77%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQS  +P++    A+ + +   +G GK KR   M+C  +  SL+L+ F GLR  +
Sbjct  1    MAGSLVQSAILPTV----AVNRIQSHLRGSGKVKRGSKMMCQPRKHSLRLQGFAGLRRSD  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             ++  +R+ +  HS V+   S  RG+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NVEFSSRNQRDFHSVVSGYISYSRGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQ T +PS +A     Q +GSGK K    R   M+C  Q   L+L  F GLR  +
Sbjct  1    MAGSLVQLTILPSALANRRQSQLRGSGKAK----RGAKMMCQLQMHPLRLPGFAGLRRAD  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             L+  +R+    HS V+   S   G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLEFFSRNRHDFHSLVSVYVSYAWGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 131/175 (75%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LV S  +PS V   +  Q +GSGK K    R   M+ S +   L+L+SF GLR  +
Sbjct  1    MADSLVHSAILPSAVMTRSQSQLRGSGKAK----RGAKMVRSMRMHPLRLQSFAGLRAAD  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD  +R  Q  HS V+   S  RG+ +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDFSSRCQQDFHSVVSRYISNPRGKATRGVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQS  +P+ V      Q KGSG+ +G       M+ + +  S++L+ F GLRG N
Sbjct  1    MAGALVQSAVLPAQVLSRNHRQLKGSGRTRG----AAKMMYNMRLHSIRLQGFAGLRGSN  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LD ++RS +  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  171



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  176  VEKIIGRGSGFVAVEIPFT  194



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  84

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  85   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  144

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  145  VEKIIGRGSGFVAVEIPFT  163



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  176  VEKIIGRGSGFVAVEIPFT  194



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  322
            V M+ S  +P L +R+++GLR  +ALD MA       +KV  + S R+G+ SR V KAMF
Sbjct  32   VKMMSSLHAPVLSIRNYSGLRVNSALDLMASRSPDFFAKVNISISSRKGKASRCVPKAMF  91

Query  323  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  502
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  92   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  151

Query  503  VEKIIGRGSGFVAVEIPFT  559
            VEKIIGRGSGFVAVEIPFT
Sbjct  152  VEKIIGRGSGFVAVEIPFT  170



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR L +S+ +P  V+G ++  F+GSGK +    +   M+CS +S  L+   FTGL+G N
Sbjct  1    MARPLFKSSVLPDAVSG-SVPLFQGSGKAR----KPANMMCSRRSSQLRFLGFTGLKGSN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             L  ++   +     V+A+ S  +G+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   DLHLVSGPSKDFRLAVSASVSAPKGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR+EVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARIEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R+  M+C+ +   L+++ FTGLR  NALD   +SG+  H  ++A +   RGR  R V KA
Sbjct  30   RLALMMCNVRVSPLRMQGFTGLRQLNALDFPYKSGRDFHFLISALSPTARGRAKRVVPKA  89

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   VFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
             EVEKIIGRGSGFVAVEIPFT
Sbjct  150  AEVEKIIGRGSGFVAVEIPFT  170



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 127/175 (73%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGTLVQSAVVPTVYRSSS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 132/175 (75%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  LVQS  +P+++   +  Q +GSGK K    R   M+C  Q   L+L+ F GLR  +
Sbjct  1    MAGSLVQSAVLPAVIMNRSHSQLQGSGKAK----RGARMICQLQMHPLRLQGFAGLRVAD  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             L + +R  Q  HS V+   +  RGR SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLFS-SRHRQDFHSVVSGYITNPRGRPSRLVTKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVEKIIGRGSGFVAVEIPFT  170



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 112/142 (79%), Gaps = 2/142 (1%)
 Frame = +2

Query  140  VVAMLCSSQSPSLKLRSFTGLRGG-NALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  313
            V  M+ +SQ+  L ++SF+GLR   NALD +AR       KV    S  R   +   V K
Sbjct  32   VKMMMYTSQTSVLSIQSFSGLRASSNALDRVARPSHDFFGKVNLQISSSRKGKASRGVTK  91

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+
Sbjct  92   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDS  151

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            RVEVEKIIGRGSGFVAVEIPFT
Sbjct  152  RVEVEKIIGRGSGFVAVEIPFT  173



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  146  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  325
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA+  +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVASQLARPRGKGSRMVVRAMFE  92

Query  326  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  505
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  506  EKIIGRGSGFVAVEIPFT  559
            EKIIGRGSGFVAVEIPFT
Sbjct  153  EKIIGRGSGFVAVEIPFT  170



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 120/175 (69%), Gaps = 30/175 (17%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C++     + +    +RGG 
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNAMISIPEWQLLFLVRGGK  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            A   +AR                          AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ASRCVAR--------------------------AMFERFTEKAIKVIMLAQEEARRLGHN  90

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  91   FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  145



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  206  GGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  385
            G N LDT+ RS Q+   KV  A +  +G+GSR VVKAMFERFTEKAIKVIMLAQEEARRL
Sbjct  4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL  63

Query  386  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  121



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  146  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  325
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA   +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVAHQLARPRGKGSRMVVRAMFE  92

Query  326  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  505
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  506  EKIIGRGSGFVAVEIPFT  559
            EKIIGRGSGFVAVEIPFT
Sbjct  153  EKIIGRGSGFVAVEIPFT  170



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  158  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  337
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  338  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  517
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  518  GRGSGFVAVEIPFT  559
            GRGSGFVAVEIPFT
Sbjct  152  GRGSGFVAVEIPFT  165



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  158  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  337
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  338  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  517
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  518  GRGSGFVAVEIPFT  559
            GRGSGFVAVEIPFT
Sbjct  152  GRGSGFVAVEIPFT  165



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R  +ML  S +  +++ +F GLR  ++   +  S     S VA+    RRGR +  V +A
Sbjct  80   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAVRSS--NFRSTVASYRFSRRGRRASFVTRA  137

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  197

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRG+GFVAVEIPFT
Sbjct  198  VEVEKIIGRGNGFVAVEIPFT  218



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 127/175 (73%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPTIYRSNS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVVKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            ML S+ + +L L  F GLR  N LDT +   +     VA+  S  RG  SR VV+AMFER
Sbjct  31   MLRSTPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGYIVASQISRPRGSASRGVVRAMFER  90

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  151  KIIGRGSGFVAVEIPFT  167



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  146  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  325
             ML S+ + +L L  F GLR  N LDT +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  29   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQISRPRGSGSRMVVRAMFE  88

Query  326  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  505
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEV
Sbjct  89   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEV  148

Query  506  EKIIGRGSGFVAVEIPFT  559
            EKIIGRGSGFVAVEIPFT
Sbjct  149  EKIIGRGSGFVAVEIPFT  166



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            M   LVQS  +P++    + G+F+   + +        M+ ++ + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPAVYRSSS-GRFRVRARARTN----ATMVRNTPTRTLTLGGFQGLRQTN  55

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKV+KSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVMKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  170



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  227  MARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  406
            M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGT
Sbjct  1    MLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGT  60

Query  407  eqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT
Sbjct  61   EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  111



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +2

Query  173  SLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKV  352
            +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKV
Sbjct  42   TLTLGGFQGLRQTNFLDTRSVIKRDFVSIVASQIARPRGSASRGVVRAMFERFTEKAIKV  101

Query  353  IMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSG  532
            IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSG
Sbjct  102  IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSG  161

Query  533  FVAVEIPFT  559
            FVAVEIPFT
Sbjct  162  FVAVEIPFT  170



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  151  KIIGRGSGFVAVEIPFT  167



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  151  KIIGRGSGFVAVEIPFT  167



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L+    + S  AG A GQ           +R  +ML  S +  +++ +F GLR  +
Sbjct  1    MAGTLLLPVALGSTFAGRASGQ----RWKSHGTRRPASMLAMSLNRPVRMAAFVGLRSAH  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +    A       S VA+  S RRGR +R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SF--TATPASNYRSTVASYRSSRRGRRTRFVTRAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGL+GEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVAVEIPFT
Sbjct  115  FVGTEQILLGLVGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFT  169



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  60

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  121  KIIGRGSGFVAVEIPFT  137



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  146  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  325
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  145  TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  204

Query  326  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  505
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  205  RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  264

Query  506  EKIIGRGSGFVAVEIPFT  559
            EKIIGRGSGFVAVEIPFT
Sbjct  265  EKIIGRGSGFVAVEIPFT  282



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 122/175 (70%), Gaps = 7/175 (4%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR  +
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLRSVH  56

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            +   M  S         A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SFSVMPVSN---FRSTVASYRSRRGRRTRFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVAVEIPFT
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFT  168



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  328
            M+ +  + +L L  F GLR  N LD+ +   +   + VA+  S  RG  SR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVVKRDFGAIVASQISRHRGSASRGVVRAMFER  60

Query  329  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  508
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  509  KIIGRGSGFVAVEIPFT  559
            KIIGRGSGFVAVEIPFT
Sbjct  121  KIIGRGSGFVAVEIPFT  137



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R  +ML  S +  +++ +F GLR  ++   M  S     S VA+    RRGR +  V +A
Sbjct  31   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAMRSS--NFRSTVASYRFSRRGRRASFVTRA  88

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  148

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRG+GFVAVEIPFT
Sbjct  149  VEVEKIIGRGNGFVAVEIPFT  169



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score =   120 bits (301),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S RR R SR V +A
Sbjct  31   RPASMLAMSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRRTRRSRFVTRA  89

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRG+GFVAVEIPFT
Sbjct  150  VEVEKIIGRGNGFVAVEIPFT  170



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +2

Query  137  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  316
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S R+ R SR V +A
Sbjct  31   RPASMLAVSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRQTRRSRFVTQA  89

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRG+GFVAVEIPFT
Sbjct  150  VEVEKIIGRGNGFVAVEIPFT  170



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 128/179 (72%), Gaps = 9/179 (5%)
 Frame = +2

Query  47   LVQSTNIPSLVAGEAIGQFkgsgkgkgk-gkRVVAM----LCSSQSPSL-KLRSFTGLRG  208
            +  S  IPS V    +GQF GS K K +   R  +M    +  S S S+ + +SF+G+R 
Sbjct  1    MAHSLTIPS-VGASPVGQFNGSRKSKKQGAARAASMGRRNVDKSASMSVARFQSFSGMRK  59

Query  209  GNALDTMA-RSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARR  382
            G+ +D +  + G+   S VA +T+          V  AMFERFTEKAIKVIMLAQEEARR
Sbjct  60   GSVVDALVVKQGKDFKSVVANSTAVTGHSRPSRGVTTAMFERFTEKAIKVIMLAQEEARR  119

Query  383  LGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFVAVEIPFT
Sbjct  120  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVAVEIPFT  178



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 124/182 (68%), Gaps = 15/182 (8%)
 Frame = +2

Query  47   LVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLK---------LRSFTG  199
            +  S  +PS V    +GQ   S K K    R +A   S+   +LK          +SF+G
Sbjct  4    MAHSLTLPS-VGSSLVGQLNDSAKSKR---RTIAQAASTGRKNLKKSASLSVSGFQSFSG  59

Query  200  LRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvK-AMFERFTEKAIKVIMLAQEE  373
            +R  +A+D +  + G+ L S VA + +          V  AMFERFTEKAIKVIMLAQEE
Sbjct  60   MRKASAVDALTVKQGKDLKSVVAKSMAVAGHSRPSRGVTFAMFERFTEKAIKVIMLAQEE  119

Query  374  ARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIP  553
            ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFVAVEIP
Sbjct  120  ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVAVEIP  179

Query  554  FT  559
            FT
Sbjct  180  FT  181



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 124/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query  35   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  214
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR   
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLR---  53

Query  215  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  394
            ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  395  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  559
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVAVEIPFT
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFT  168



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 126/181 (70%), Gaps = 7/181 (4%)
 Frame = +2

Query  17   GSLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFT  196
            G L   MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F 
Sbjct  488  GKLLLTMAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFV  543

Query  197  GLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEA  376
            GLR   ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEA
Sbjct  544  GLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEA  600

Query  377  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPF  556
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVAVEIPF
Sbjct  601  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPF  660

Query  557  T  559
            T
Sbjct  661  T  661



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +2

Query  182  LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  358
            L+++ G+R  + LD++A R+ +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  21   LQTYVGMRKPSPLDSLATRTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  80

Query  359  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFV  538
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFV
Sbjct  81   LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  140

Query  539  AVEIPFT  559
            AVEIPFT
Sbjct  141  AVEIPFT  147



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  490
            K+MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  73   KSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  132

Query  491  ARVEVEKIIGRGSGFVAVEIPFT  559
            ARVEVEKIIGRGSGFVAVEIPFT
Sbjct  133  ARVEVEKIIGRGSGFVAVEIPFT  155



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNF+GTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFMGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  490
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  491  ARVEVEKIIGRGSGFVAVEIPFT  559
            AR+EVEKIIGRGSGFVAVEIPFT
Sbjct  74   ARIEVEKIIGRGSGFVAVEIPFT  96



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  182  LRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  358
            L+++ G+R  + LD++A S  +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  57   LQTYVGMRKPSPLDSLATSTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  116

Query  359  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFV  538
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFV
Sbjct  117  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  176

Query  539  AVEIPFT  559
            AVEIPFT
Sbjct  177  AVEIPFT  183



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +2

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  33   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  92

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            R+EVEKIIGRGSGFVAVEIPFT
Sbjct  93   RIEVEKIIGRGSGFVAVEIPFT  114



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +2

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            R+EVEKIIGRGSGFVAVEIPFT
Sbjct  76   RIEVEKIIGRGSGFVAVEIPFT  97



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +2

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            R+EVEKIIGRGSGFVAVEIPFT
Sbjct  76   RIEVEKIIGRGSGFVAVEIPFT  97



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDA
Sbjct  78   AMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDA  137

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            RVEVEKIIGRGSGFVAVEIPFT
Sbjct  138  RVEVEKIIGRGSGFVAVEIPFT  159



>gb|EHC12174.1| ATPase AAA-2 domain protein [Fischerella sp. JSC-11]
Length=851

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +2

Query  314  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  493
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  29   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  88

Query  494  RVEVEKIIGRGSGFVAVEIPFT  559
            R+EVEKIIGRGSGFVAVEIPFT
Sbjct  89   RIEVEKIIGRGSGFVAVEIPFT  110



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_044105586.1| Clp protease ClpX [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP16974.1| ATP-dependent Clp protease regulatory subunit [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=823

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>gb|EMT29575.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4B 
protein, chloroplastic [Aegilops tauschii]
Length=1027

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  490
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  224  RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  283

Query  491  ARVEVEKIIGRGSGFVAVEIPFT  559
            ARVEVEKIIGRGSGFVAVEIPFT
Sbjct  284  ARVEVEKIIGRGSGFVAVEIPFT  306



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006041704.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 7805]
 gb|EAR18013.1| ATPase [Synechococcus sp. WH 7805]
Length=857

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011618961.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9311]
 gb|ABI47413.1| putative Clp protease, ATP-binding subunit ClpC [Synechococcus 
sp. CC9311]
Length=860

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>gb|AHF63374.1| ATPase [Synechococcus sp. WH 8109]
Length=846

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|NP_050661.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
 sp|O78410.1|CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Guillardia theta]
 gb|AAC35595.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
Length=819

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011142062.1| ATP-dependent Clp protease ATP-binding protein [Gloeobacter violaceus]
 ref|NP_925010.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
 dbj|BAC90005.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
Length=819

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|YP_001293474.1| Clp protease ATP binding subunit [Rhodomonas salina]
 gb|ABO70723.1| Clp protease ATP binding subunit [Rhodomonas salina]
Length=819

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/81 (99%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_009626822.1| ATPase AAA-2 domain protein [Pseudanabaena biceps]
 gb|ELS33048.1| ATPase AAA-2 domain protein [Pseudanabaena biceps PCC 7429]
Length=829

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_039726508.1| MULTISPECIES: Clp protease ClpX [Oscillatoriophycideae]
 gb|KIF14711.1| Clp protease ClpX [Aphanocapsa montana BDHKU210001]
 gb|KIF39633.1| Clp protease ClpX [Lyngbya confervoides BDU141951]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_011935205.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RCC307]
 emb|CAK27691.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Synechococcus 
sp. RCC307]
Length=852

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/81 (98%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            VEVEKIIGRGSGFVAVEIPFT
Sbjct  61   VEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_037222416.1| Clp protease ClpX [Richelia intracellularis]
 emb|CDN15062.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006277610.1| ATP-dependent Clp protease ATP-binding protein [Cylindrospermopsis 
raciborskii]
 gb|EFA69311.1| UvrB/UvrC protein [Cylindrospermopsis raciborskii CS-505]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_017741509.1| ATP-dependent Clp protease ATP-binding protein [Scytonema hofmanni]
Length=823

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_009784332.1| ATP-dependent Clp protease ATP-binding protein [Lyngbya sp. PCC 
8106]
 gb|EAW37092.1| ATP-dependent Clp protease regulatory subunit [Lyngbya sp. PCC 
8106]
Length=825

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_035989117.1| Clp protease ClpX [Leptolyngbya sp. KIOST-1]
Length=821

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>dbj|BAD79443.1| ATP-dependent Clp protease regulatory subunit ClpC [Synechococcus 
elongatus PCC 6301]
Length=839

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  490
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  491  ARVEVEKIIGRGSGFVAVEIPFT  559
            AR+EVEKIIGRGSGFVA EIPFT
Sbjct  74   ARIEVEKIIGRGSGFVAAEIPFT  96



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_009342297.1| ATP-dependent Clp protease ATP-binding protein [Raphidiopsis 
brookii]
 gb|EFA73676.1| UvrB/UvrC protein [Raphidiopsis brookii D9]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_017293405.1| ATP-dependent Clp protease ATP-binding protein [Geminocystis 
herdmanii]
Length=824

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_026097796.1| Clp protease ClpX [Geitlerinema sp. PCC 7105]
Length=822

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_008179937.1| ATP-dependent Clp protease ATP-binding protein [Moorea producens]
 gb|EGJ34643.1| ATPase with chaperone activity, ATP-binding subunit [Moorea producens 
3L]
Length=822

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015227883.1| chaperone ATPase [Dactylococcopsis salina]
 gb|AFZ48870.1| ATPase with chaperone activity, ATP-binding subunit [Dactylococcopsis 
salina PCC 8305]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_035153450.1| Clp protease ClpX [Calothrix sp. 336/3]
 gb|KFB83654.1| Clp protease ClpX [Calothrix sp. 336/3]
Length=822

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_006102932.1| ATP-dependent Clp protease ATP-binding protein [Coleofasciculus 
chthonoplastes]
 gb|EDX73701.1| ATPase, AAA family [Coleofasciculus chthonoplastes PCC 7420]
Length=824

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_015225278.1| ATPase [Halothece sp. PCC 7418]
 gb|AFZ43401.1| ATPase AAA-2 domain protein [Halothece sp. PCC 7418]
Length=823

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  496
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  497  VEVEKIIGRGSGFVAVEIPFT  559
            +EVEKIIGRGSGFVAVEIPFT
Sbjct  61   IEVEKIIGRGSGFVAVEIPFT  81



>ref|XP_007509860.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18975.1| predicted protein [Bathycoccus prasinos]
Length=944

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 12/136 (9%)
 Frame = +2

Query  188  SFTGLRGGNALD---TMARSGQ---------TLHSKvaaatsgrrgrgsravvKAMFERF  331
            +F+GLR  NA+D   T++R+G          +  S  ++++SG++        +AMFERF
Sbjct  51   NFSGLRSTNAIDMTSTLSRNGNFKGVTSRQLSTKSGSSSSSSGKKLGAVIKGPRAMFERF  110

Query  332  TEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEK  511
            TEKAIKV+MLAQEEARRLGHNFVGTEQI+LGLIGEGTGIAAKVLKSMGI+LK+ARVEVEK
Sbjct  111  TEKAIKVVMLAQEEARRLGHNFVGTEQIMLGLIGEGTGIAAKVLKSMGISLKEARVEVEK  170

Query  512  IIGRGSGFVAVEIPFT  559
            IIGRGSGFVAVEIPFT
Sbjct  171  IIGRGSGFVAVEIPFT  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840