BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS167D03

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP17325.1|  unnamed protein product                                190   2e-52   Coffea canephora [robusta coffee]
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               186   3e-51   Solanum tuberosum [potatoes]
gb|KDO78075.1|  hypothetical protein CISIN_1g0026401mg                  175   1e-50   Citrus sinensis [apfelsine]
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    184   2e-50   Nicotiana sylvestris
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    184   2e-50   Nicotiana tomentosiformis
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    184   2e-50   Nicotiana tomentosiformis
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    184   2e-50   Nicotiana sylvestris
ref|XP_009614044.1|  PREDICTED: uncharacterized protein LOC104107...    184   2e-50   Nicotiana tomentosiformis
ref|XP_009614043.1|  PREDICTED: uncharacterized protein LOC104107...    184   2e-50   Nicotiana tomentosiformis
ref|XP_009785963.1|  PREDICTED: uncharacterized protein LOC104234...    183   2e-50   Nicotiana sylvestris
gb|KDO78070.1|  hypothetical protein CISIN_1g0026401mg                  176   3e-50   Citrus sinensis [apfelsine]
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 183   5e-50   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    178   3e-48   Citrus sinensis [apfelsine]
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             178   3e-48   
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    178   3e-48   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             178   4e-48   Citrus clementina [clementine]
emb|CBI30819.3|  unnamed protein product                                176   1e-47   Vitis vinifera
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   176   2e-47   Vitis vinifera
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             173   2e-46   
ref|XP_002317304.2|  kinase-related family protein                      173   3e-46   
gb|KHF99174.1|  hypothetical protein F383_17166                         172   3e-46   Gossypium arboreum [tree cotton]
gb|KJB69763.1|  hypothetical protein B456_011G041100                    172   4e-46   Gossypium raimondii
gb|KJB69765.1|  hypothetical protein B456_011G041100                    172   4e-46   Gossypium raimondii
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    172   5e-46   Solanum lycopersicum
gb|KHN48057.1|  hypothetical protein glysoja_015527                     172   5e-46   Glycine soja [wild soybean]
gb|KDP21205.1|  hypothetical protein JCGZ_21676                         171   1e-45   Jatropha curcas
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    169   4e-45   Solanum lycopersicum
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    169   4e-45   Solanum lycopersicum
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             169   6e-45   Solanum tuberosum [potatoes]
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    169   8e-45   Populus euphratica
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...    169   9e-45   Prunus mume [ume]
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...    169   9e-45   Prunus mume [ume]
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    169   9e-45   Populus euphratica
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    169   1e-44   Populus euphratica
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    168   1e-44   Populus euphratica
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    167   3e-44   Populus euphratica
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    167   3e-44   Populus euphratica
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    167   3e-44   Populus euphratica
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    166   6e-44   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    166   6e-44   Sesamum indicum [beniseed]
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg             165   2e-43   Prunus persica
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             165   2e-43   
gb|KHF99173.1|  hypothetical protein F383_17166                         164   4e-43   Gossypium arboreum [tree cotton]
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    160   1e-41   Fragaria vesca subsp. vesca
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             159   3e-41   Phaseolus vulgaris [French bean]
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    159   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    159   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    158   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    158   7e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    157   1e-40   Nicotiana sylvestris
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    155   4e-40   Glycine max [soybeans]
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   2e-39   
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    154   2e-39   Cucumis melo [Oriental melon]
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    154   2e-39   Cucumis melo [Oriental melon]
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388    154   2e-39   Cucumis sativus [cucumbers]
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       154   2e-39   Cucumis sativus [cucumbers]
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    149   8e-38   Nicotiana tomentosiformis
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    149   8e-38   Nicotiana tomentosiformis
ref|XP_002519742.1|  conserved hypothetical protein                     148   1e-37   Ricinus communis
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                147   4e-37   Erythranthe guttata [common monkey flower]
gb|KJB57294.1|  hypothetical protein B456_009G157400                    146   4e-37   Gossypium raimondii
gb|KJB57297.1|  hypothetical protein B456_009G157400                    146   5e-37   Gossypium raimondii
gb|KJB57295.1|  hypothetical protein B456_009G157400                    147   5e-37   Gossypium raimondii
gb|KHG18569.1|  Protein translocase subunit SecA                        146   7e-37   Gossypium arboreum [tree cotton]
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  143   1e-35   Medicago truncatula
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    143   1e-35   Elaeis guineensis
ref|XP_008349816.1|  PREDICTED: serine/threonine-protein kinase C...    134   2e-35   
ref|XP_008797517.1|  PREDICTED: uncharacterized protein LOC103712...    142   2e-35   
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    142   2e-35   Phoenix dactylifera
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    141   5e-35   
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...    140   8e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...    140   8e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               140   9e-35   Elaeis guineensis
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    137   2e-33   
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    137   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    137   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    137   2e-33   
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    137   2e-33   
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    137   2e-33   
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    136   2e-33   
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    136   3e-33   
ref|XP_008358625.1|  PREDICTED: cell wall protein RBR3-like             131   3e-33   
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    135   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   2e-32   
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    134   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   133   4e-32   
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    130   4e-31   Cicer arietinum [garbanzo]
emb|CBI20348.3|  unnamed protein product                                121   2e-30   Vitis vinifera
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    128   2e-30   Cicer arietinum [garbanzo]
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...    126   8e-30   Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...    126   9e-30   Eucalyptus grandis [rose gum]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...    126   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    122   2e-28   Tarenaya hassleriana [spider flower]
emb|CAN79286.1|  hypothetical protein VITISV_039797                     116   1e-27   Vitis vinifera
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    120   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    120   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    119   2e-27   
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX94662.1|  BnaC07g09960D                                          119   2e-27   
gb|EYU43283.1|  hypothetical protein MIMGU_mgv1a002920mg                118   4e-27   Erythranthe guttata [common monkey flower]
emb|CAE00871.1|  TA9 protein                                            110   6e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646178.1|  PREDICTED: putative GPI-anchored protein PB1...    117   1e-26   
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...    117   1e-26   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...    117   2e-26   
gb|KHN14369.1|  hypothetical protein glysoja_012407                     116   2e-26   Glycine soja [wild soybean]
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...    115   7e-26   Tarenaya hassleriana [spider flower]
dbj|BAD72339.1|  TA9 protein-like                                       110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395691.1|  PREDICTED: mucin-17-like                           113   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg             112   5e-25   Eutrema salsugineum [saltwater cress]
emb|CDJ26391.1|  unnamed protein product                                112   5e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg             112   5e-25   Eutrema salsugineum [saltwater cress]
ref|NP_001043788.1|  Os01g0663800                                       112   1e-24   
gb|EMT31975.1|  Retrovirus-related Pol polyprotein LINE-1               112   1e-24   
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146             110   2e-24   
ref|XP_008648655.1|  PREDICTED: uncharacterized protein LOC103629266    107   2e-24   
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg             110   3e-24   Capsella rubella
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg             110   3e-24   Capsella rubella
ref|NP_001130067.1|  uncharacterized protein LOC100191159               105   5e-24   
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...    108   2e-23   
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   
gb|EEC71225.1|  hypothetical protein OsI_03160                          107   4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...    107   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...    107   6e-23   
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g             106   7e-23   Phaseolus vulgaris [French bean]
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...    106   8e-23   
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...    106   8e-23   
ref|NP_174230.2|  Kinase-related protein                                106   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507                 106   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...    106   1e-22   Glycine max [soybeans]
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...    106   1e-22   Glycine max [soybeans]
emb|CDX99817.1|  BnaC05g22390D                                          104   2e-22   
ref|NP_174229.2|  uncharacterized protein                               104   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                  104   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...    104   4e-22   Brassica rapa
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...    104   4e-22   Brassica rapa
emb|CDY48333.1|  BnaA09g26880D                                          104   4e-22   Brassica napus [oilseed rape]
emb|CDY15632.1|  BnaA07g08030D                                          104   4e-22   Brassica napus [oilseed rape]
ref|XP_009102863.1|  PREDICTED: uncharacterized protein LOC103828...    103   5e-22   Brassica rapa
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756    103   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820          103   1e-21   Amborella trichopoda
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139    103   1e-21   
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...    102   2e-21   Setaria italica
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...    102   2e-21   Setaria italica
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...    102   3e-21   Brachypodium distachyon [annual false brome]
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...    102   3e-21   Brachypodium distachyon [annual false brome]
ref|XP_008645740.1|  PREDICTED: uncharacterized protein LOC103627229  97.1    1e-20   
gb|AFW71654.1|  hypothetical protein ZEAMMB73_647126                  97.8    2e-20   
gb|EMS47817.1|  hypothetical protein TRIUR3_20557                     99.8    2e-20   Triticum urartu
emb|CDY61562.1|  BnaCnng37970D                                        98.6    3e-20   Brassica napus [oilseed rape]
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...  99.0    4e-20   
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...  98.6    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...  98.6    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266  97.8    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...  97.4    1e-19   Setaria italica
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...  97.4    1e-19   Setaria italica
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...  94.7    8e-19   Brassica rapa
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730        94.0    2e-18   
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                          93.2    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63247.1|  hypothetical protein TRIUR3_29233                     90.5    3e-17   Triticum urartu
dbj|BAJ92311.1|  predicted protein                                    89.4    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007048866.1|  Uncharacterized protein TCM_001879               89.4    6e-17   
emb|CDY43685.1|  BnaA04g20060D                                        89.0    8e-17   Brassica napus [oilseed rape]
dbj|BAJ85689.1|  predicted protein                                    88.2    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                  88.2    2e-16   Arabis alpina [alpine rockcress]
emb|CDY43334.1|  BnaC03g59060D                                        87.8    2e-16   Brassica napus [oilseed rape]
emb|CDX90188.1|  BnaA08g17960D                                        87.8    2e-16   
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...  87.4    2e-16   Brassica rapa
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...  87.4    2e-16   Brassica rapa
emb|CDY11787.1|  BnaC03g57910D                                        86.3    7e-16   Brassica napus [oilseed rape]
gb|ACF86865.1|  unknown                                               85.5    8e-16   Zea mays [maize]
ref|XP_002440322.1|  hypothetical protein SORBIDRAFT_09g029670        85.5    9e-16   
ref|NP_001141689.1|  uncharacterized protein LOC100273818             85.9    9e-16   Zea mays [maize]
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  85.9    9e-16   Zea mays [maize]
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916  83.2    7e-15   Brachypodium distachyon [annual false brome]
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...  81.3    3e-14   Zea mays [maize]
gb|AFW81250.1|  putative DUF1296 domain containing family protein     81.3    3e-14   
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...  81.3    3e-14   Zea mays [maize]
gb|AFW81248.1|  putative DUF1296 domain containing family protein     81.3    3e-14   
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  81.3    3e-14   Zea mays [maize]
ref|NP_001146586.1|  uncharacterized protein LOC100280182             81.3    3e-14   Zea mays [maize]
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  80.9    4e-14   Zea mays [maize]
gb|AFW81251.1|  putative DUF1296 domain containing family protein     80.9    4e-14   
ref|XP_006654843.1|  PREDICTED: dentin sialophosphoprotein-like       80.5    5e-14   Oryza brachyantha
ref|XP_010102151.1|  hypothetical protein L484_021385                 79.3    1e-13   Morus notabilis
ref|XP_006654800.1|  PREDICTED: uncharacterized protein LOC102700994  79.3    1e-13   Oryza brachyantha
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...  78.6    2e-13   Setaria italica
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...  78.6    2e-13   Setaria italica
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like           78.6    3e-13   Prunus mume [ume]
ref|NP_001266740.1|  uncharacterized protein LOC101027201             76.3    4e-13   
ref|XP_008655403.1|  PREDICTED: uncharacterized protein LOC101027...  77.4    6e-13   
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...  77.0    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...  77.0    8e-13   
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...  76.6    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg           76.6    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg           76.6    1e-12   
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like           75.9    2e-12   
gb|EEC79711.1|  hypothetical protein OsI_21014                        75.5    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001056347.1|  Os05g0566900                                     75.5    2e-12   
ref|XP_010230981.1|  PREDICTED: uncharacterized protein LOC100825...  75.5    2e-12   
ref|XP_003567822.1|  PREDICTED: uncharacterized protein LOC100825...  75.5    2e-12   
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526  75.1    3e-12   Brassica rapa
emb|CDX84653.1|  BnaA03g15770D                                        75.1    3e-12   
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           73.9    9e-12   
gb|EEC79757.1|  hypothetical protein OsI_21141                        69.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...  65.1    6e-09   Fragaria vesca subsp. vesca
gb|AAT44198.1|  unknown protein                                       65.1    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64826.1|  hypothetical protein OsJ_19683                        65.1    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056433.1|  Os05g0581800                                     65.1    6e-09   
ref|XP_011467574.1|  PREDICTED: uncharacterized protein LOC101307...  64.7    8e-09   Fragaria vesca subsp. vesca
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...  63.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...  62.8    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...  62.8    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_008380341.1|  PREDICTED: probable GPI-anchored adhesin-lik...  62.8    3e-08   
emb|CDY61669.1|  BnaC01g40800D                                        62.4    4e-08   Brassica napus [oilseed rape]
gb|KJB57296.1|  hypothetical protein B456_009G157400                  62.0    5e-08   Gossypium raimondii
gb|KDP46910.1|  hypothetical protein JCGZ_10401                       60.8    1e-07   Jatropha curcas
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...  59.7    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...  59.7    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008342489.1|  PREDICTED: uncharacterized protein LOC103405294  58.9    5e-07   
ref|XP_008362365.1|  PREDICTED: uncharacterized protein LOC103426056  58.9    5e-07   
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...  58.2    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...  58.2    9e-07   Camelina sativa [gold-of-pleasure]
dbj|BAJ94362.1|  predicted protein                                    57.8    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03133.1|  predicted protein                                    57.4    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144           56.6    3e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_002870069.1|  predicted protein                                55.8    5e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...  55.5    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...  55.5    7e-06   Camelina sativa [gold-of-pleasure]
gb|KHN22963.1|  hypothetical protein glysoja_030633                   55.1    9e-06   Glycine soja [wild soybean]
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           53.1    4e-05   
ref|XP_009377414.1|  PREDICTED: uncharacterized protein LOC103966021  53.1    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            52.4    8e-05   Brassica rapa
ref|XP_008779718.1|  PREDICTED: uncharacterized protein LOC103699456  50.1    8e-05   
gb|KJB75412.1|  hypothetical protein B456_012G040900                  51.6    1e-04   Gossypium raimondii
emb|CDX78828.1|  BnaA01g08950D                                        51.2    2e-04   
gb|EMS61509.1|  hypothetical protein TRIUR3_20581                     51.2    2e-04   Triticum urartu
gb|KHG01632.1|  Segment polarity dishevelled DVL-3                    50.1    5e-04   Gossypium arboreum [tree cotton]



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 9/149 (6%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFG++ T+PG+F +N  AAPS T+LG DD LS+QYKD++HL+SLQQ ++SGMWLHG GS
Sbjct  737  GAFGSSTTVPGNFTMNQPAAPSGTNLGYDDVLSAQYKDSNHLISLQQSDSSGMWLHGPGS  796

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+TYY+ Q QNQQP GFRQ QQPSQNY SLGY PNFYHSQTG+SLD  HQQQN
Sbjct  797  RTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQNYGSLGY-PNFYHSQTGMSLD--HQQQN  853

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG L    G +Q QPK  SQQ+WQNSY
Sbjct  854  PRDGSL----GGSQGQPK-QSQQIWQNSY  877



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 117/147 (80%), Gaps = 8/147 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NPSAAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  694  GGFGNTASIPGNFPMNPSAAPSGTNLSYDDMLSSQYKDTNHLMSLQQSENSAMWLHGPGS  753

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  754  RTMSAVPANTYYAFQGQNQQSSGFRQAQQPLQNHGSLGY-PNFYHSQAGISLE--HQQQN  810

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQN  439
            PRD   G  GG +Q QPKP SQQLWQ+
Sbjct  811  PRD---GSLGGGSQGQPKP-SQQLWQS  833



>gb|KDO78075.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=250

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN P+A   T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  110  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  169

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  170  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  226

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  227  RDATL----GGSQAQPSKQTQQLWQNSY  250



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  700  GGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGS  759

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  760  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  816

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG LG   G  +     S QQLWQNSY
Sbjct  817  PRDGSLGASQGQPKQ----SQQQLWQNSY  841



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  698  GGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGS  757

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  758  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  814

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG L    G +Q QPK S QQLWQNSY
Sbjct  815  PRDGSL----GGSQGQPKQSQQQLWQNSY  839



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  700  GGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGS  759

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  760  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  816

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG L    G +Q QPK S QQLWQNSY
Sbjct  817  PRDGSL----GGSQGQPKQSQQQLWQNSY  841



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  702  GGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGS  761

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  762  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  818

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG LG   G  +     S QQLWQNSY
Sbjct  819  PRDGSLGASQGQPKQ----SQQQLWQNSY  843



>ref|XP_009614044.1| PREDICTED: uncharacterized protein LOC104107048 isoform X4 [Nicotiana 
tomentosiformis]
Length=783

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  642  GGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGS  701

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  702  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  758

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG L    G +Q QPK S QQLWQNSY
Sbjct  759  PRDGSL----GGSQGQPKQSQQQLWQNSY  783



>ref|XP_009614043.1| PREDICTED: uncharacterized protein LOC104107048 isoform X3 [Nicotiana 
tomentosiformis]
Length=789

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  648  GGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGS  707

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  708  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  764

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG L    G +Q QPK S QQLWQNSY
Sbjct  765  PRDGSL----GGSQGQPKQSQQQLWQNSY  789



>ref|XP_009785963.1| PREDICTED: uncharacterized protein LOC104234138 isoform X3 [Nicotiana 
sylvestris]
Length=780

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GS
Sbjct  639  GGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGS  698

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  699  RTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQN  755

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG LG   G  +     S QQLWQNSY
Sbjct  756  PRDGSLGASQGQPKQ----SQQQLWQNSY  780



>gb|KDO78070.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78071.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78072.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78073.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=304

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN   AP+ T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  164  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  223

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  224  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  280

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  281  RDATL----GGSQAQPSKQTQQLWQNSY  304



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 114/147 (78%), Gaps = 8/147 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++ +IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRT
Sbjct  733  FGSSTSIPGGLPLNPPTAPTGTTIGYDDVLSSQYKDSNHLMSLQQNENSAMWIHGPGSRT  792

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            MSA PA+TYY+ Q QNQQ  GFRQ QQPSQ++ +LGY PNFYHSQTG+S+D  HQQQNPR
Sbjct  793  MSAVPASTYYSFQGQNQQAGGFRQGQQPSQHFGALGY-PNFYHSQTGVSMD--HQQQNPR  849

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            DG L       Q QP   +QQLWQNSY
Sbjct  850  DGSL----SGTQGQPSKQTQQLWQNSY  872



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN   AP+ T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  729  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  788

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  789  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  845

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  846  RDATL----GGSQAQPSKQTQQLWQNSY  869



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN   AP+ T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  723  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  782

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  783  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  839

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  840  RDATL----GGSQAQPSKQTQQLWQNSY  863



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN   AP+ T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  714  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  773

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  774  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  830

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  831  RDATL----GGSQAQPSKQTQQLWQNSY  854



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FGN+ +IPG +FPLN   AP+ T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSR
Sbjct  738  FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSR  797

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQTG+SL+  HQQQNP
Sbjct  798  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNP  854

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  855  RDATL----GGSQAQPSKQTQQLWQNSY  878



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 9/150 (6%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHG  175
            GAFG++ +IPG+F LNP +AA  T++G DD ++SQYKD +HL+SLQQ  ENS MW+HG G
Sbjct  657  GAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKDGNHLISLQQQNENSAMWVHGPG  716

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQ GISL+  HQQQ
Sbjct  717  SRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQAGISLE--HQQQ  773

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRDG L G  G A  Q    SQQ+WQN+Y
Sbjct  774  NPRDGSLSGSQGQASKQ----SQQIWQNNY  799



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 9/150 (6%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHG  175
            GAFG++ +IPG+F LNP +AA  T++G DD ++SQYKD +HL+SLQQ  ENS MW+HG G
Sbjct  744  GAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKDGNHLISLQQQNENSAMWVHGPG  803

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +LGY PNFYHSQ GISL+  HQQQ
Sbjct  804  SRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNFYHSQAGISLE--HQQQ  860

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRDG L G  G A  Q    SQQ+WQN+Y
Sbjct  861  NPRDGSLSGSQGQASKQ----SQQIWQNNY  886



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 114/148 (77%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IP G+FPLN   AP+ T++G DD L SQYKD  HLMSLQQ ENS MWLHG GSR
Sbjct  753  FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKDASHLMSLQQNENSAMWLHGPGSR  812

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PN+YHSQTG+SL+ H QQQN 
Sbjct  813  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNS  870

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  871  RDGSL----GGSQGQPSKQAQQLWQNSY  894



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 114/148 (77%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IP G+FPLN   AP+ T++G DD L SQYKD  HLMSLQQ ENS MWLHG GSR
Sbjct  768  FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKDASHLMSLQQNENSAMWLHGPGSR  827

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PN+YHSQTG+SL+ H QQQN 
Sbjct  828  TMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNS  885

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  886  RDGSL----GGSQGQPSKQAQQLWQNSY  909



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN+HLMSLQQ ENSGMW+HG GSRT
Sbjct  728  FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRT  787

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            MSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLGY PNFYHSQTG+SLD   QQQNP
Sbjct  788  MSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLGY-PNFYHSQTGVSLD--PQQQNP  844

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L G  G     P   +QQLWQN+Y
Sbjct  845  RDGSLSGSQGQP---PSKQTQQLWQNNY  869



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 112/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN+HLMSLQQ ENSGMW+HG GSRT
Sbjct  728  FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRT  787

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            MSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLGY PNFYHSQ G+SLD   QQQNP
Sbjct  788  MSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLGY-PNFYHSQMGVSLD--PQQQNP  844

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L G  G     P   +QQLWQN+Y
Sbjct  845  RDGSLSGSQGQP---PSKQTQQLWQNNY  869



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 112/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN+HLMSLQQ ENSGMW+HG GSRT
Sbjct  726  FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRT  785

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            MSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLGY PNFYHSQ G+SLD   QQQNP
Sbjct  786  MSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLGY-PNFYHSQMGVSLD--PQQQNP  842

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L G  G     P   +QQLWQN+Y
Sbjct  843  RDGSLSGSQGQP---PSKQTQQLWQNNY  867



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 113/147 (77%), Gaps = 9/147 (6%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGNT +IPG+FP+NP AAPS T+L  DD LSSQYKD +HLMSLQQ ENS MW HG GS
Sbjct  692  GGFGNTASIPGNFPMNPPAAPSGTNLSYDDVLSSQYKDTNHLMSLQQSENSAMW-HGPGS  750

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQN
Sbjct  751  RTMSAVPANTYYGFQGQNQQSSGFRQAQQPLQNHGSLGY-PNFYHSQAGISLE--HQQQN  807

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQN  439
            PRD   G  GG +Q QPK   QQLWQ+
Sbjct  808  PRD---GSLGGGSQGQPK-QFQQLWQS  830



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG ++PLNP AAP ST++G DD ++SQYKDN+H++SLQQ ENS MW+HG  SR
Sbjct  676  FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKDNNHMISLQQNENSPMWVHGPSSR  735

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ-NYASLGYNPNFYHSQTGISLDHHHQQQN  358
            TMSA PANTYY+ Q QNQQP GFRQ QQPSQ ++ SLGY PNFYHSQTGISL+  HQQQN
Sbjct  736  TMSAIPANTYYSFQGQNQQPGGFRQNQQPSQQHFGSLGY-PNFYHSQTGISLE--HQQQN  792

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PR+  L      +Q QP   S Q+WQNSY
Sbjct  793  PREASL----AGSQTQPPKQSPQIWQNSY  817



>gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IP G+FPLNP AAP  T+LG DD LSSQYKD +HL+SLQQ +NS MW+HG GSR
Sbjct  726  FGSSTSIPAGNFPLNPPAAPGGTTLGYDDVLSSQYKDGNHLISLQQNDNSAMWVHGPGSR  785

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYY+ Q QNQQP GFRQ QQ SQ++ +LGY PN+YHSQTGISL+  HQQQN 
Sbjct  786  TMSAVPASTYYSFQGQNQQPGGFRQGQQLSQHFGALGY-PNYYHSQTGISLE--HQQQNS  842

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q QP   +QQLWQNSY
Sbjct  843  RDASL----GGSQGQPSKQTQQLWQNSY  866



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHGHGS
Sbjct  700  GAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGHGS  759

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  P+FY+SQ GISLD   QQ+N
Sbjct  760  RTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQEN  818

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RDG L G  G  +     S QQLWQN Y
Sbjct  819  LRDGSLSGSQGQPKQ----SQQQLWQNGY  843



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHGHGS
Sbjct  679  GAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGHGS  738

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  P+FY+SQ GISLD   QQ+N
Sbjct  739  RTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQEN  797

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RDG L G  G  +     S QQLWQN Y
Sbjct  798  LRDGSLSGSQGQPKQ----SQQQLWQNGY  822



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT  IPG+FP+NP AAPS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHG GS
Sbjct  702  GAFGNTTNIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGPGS  761

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  P+FY+SQ GISLD   QQQN
Sbjct  762  RTMSAVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQQN  820

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RDG L G  G  +     S QQLWQN Y
Sbjct  821  LRDGSLSGSQGQPKQ----SQQQLWQNGY  845



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSR
Sbjct  729  YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSR  788

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + GY PN+YHSQ+G+SL+  HQQQN 
Sbjct  789  TMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNT  845

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  846  RDGSL----GGSQGQPSKQAQQLWQNSY  869



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 116/149 (78%), Gaps = 9/149 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++  IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR
Sbjct  719  FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSR  778

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQQQN  358
             MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +LGY PNFYHSQTG+SL+  HQQQ+
Sbjct  779  AMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGALGYPPNFYHSQTGMSLE--HQQQS  836

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RD  L    G +Q QP   SQQLWQN+Y
Sbjct  837  SRDTSL----GGSQGQPSKQSQQLWQNTY  861



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 116/149 (78%), Gaps = 9/149 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++  IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR
Sbjct  718  FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSR  777

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQQQN  358
             MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +LGY PNFYHSQTG+SL+  HQQQ+
Sbjct  778  AMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGALGYPPNFYHSQTGMSLE--HQQQS  835

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RD  L    G +Q QP   SQQLWQN+Y
Sbjct  836  SRDTSL----GGSQGQPSKQSQQLWQNTY  860



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSR
Sbjct  728  YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSR  787

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + GY PN+YHSQ+G+SL+  HQQQN 
Sbjct  788  TMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNT  844

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  845  RDGSL----GGSQGQPSKQAQQLWQNSY  868



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSR
Sbjct  735  YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSR  794

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + GY PN+YHSQ+G+SL+  HQQQN 
Sbjct  795  TMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNT  851

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  852  RDGSL----GGSQGQPSKQAQQLWQNSY  875



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSR
Sbjct  734  YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSR  793

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + GY PN+YHSQ+G+SL+  HQQQN 
Sbjct  794  TMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNT  850

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  851  RDGSL----GGSQGQPSKQAQQLWQNSY  874



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ ++P G+FPLN   AP+ T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSR
Sbjct  731  FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSR  790

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PN+YHSQTG+SL+ H QQQN 
Sbjct  791  TMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNS  848

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  849  RDGSL----GGSQGQPSKQAQQLWQNSY  872



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ ++P G+FPLN   AP+ T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSR
Sbjct  730  FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSR  789

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PN+YHSQTG+SL+ H QQQN 
Sbjct  790  TMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNS  847

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  848  RDGSL----GGSQGQPSKQAQQLWQNSY  871



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ ++P G+FPLN   AP+ T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSR
Sbjct  700  FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSR  759

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LGY PN+YHSQTG+SL+ H QQQN 
Sbjct  760  TMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNS  817

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQNSY
Sbjct  818  RDGSL----GGSQGQPSKQAQQLWQNSY  841



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 110/150 (73%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ HL+SLQQ EN  +WLHG  S
Sbjct  703  GAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSSHLVSLQQNENPALWLHGANS  762

Query  179  RTMSAAPANTYYNI-QAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            RTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY PNFYHSQTGI+LD   QQQ
Sbjct  763  RTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY-PNFYHSQTGIALD---QQQ  818

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  819  NPRDAPL----GGSQGQPKQS--QIWQNSY  842



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 110/150 (73%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ HL+SLQQ EN  +WLHG  S
Sbjct  704  GAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSSHLVSLQQNENPALWLHGANS  763

Query  179  RTMSAAPANTYYNI-QAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            RTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY PNFYHSQTGI+LD   QQQ
Sbjct  764  RTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY-PNFYHSQTGIALD---QQQ  819

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  820  NPRDAPL----GGSQGQPKQS--QIWQNSY  843



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 116/149 (78%), Gaps = 10/149 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++  IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR
Sbjct  718  FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSR  777

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQQQN  358
             MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +LGY PNFYHSQTG+SL+  HQQQ+
Sbjct  778  AMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGALGY-PNFYHSQTGMSLE--HQQQS  834

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             RD  L    G +Q QP   SQQLWQN+Y
Sbjct  835  SRDTSL----GGSQGQPSKQSQQLWQNTY  859



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 113/148 (76%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            +G++ +IP G+FPLN  AAP+ T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSR
Sbjct  727  YGSSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSR  786

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + GY PN+YHSQ+G+SL+  HQQQN 
Sbjct  787  TMSAVPASTYYNFQGQNQQPGVFRQGQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNT  843

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RDG L    G +Q QP   +QQLWQN Y
Sbjct  844  RDGSL----GGSQGQPSKQAQQLWQNGY  867



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 5/125 (4%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN+HLMSLQQ ENSGMW+HG GSRT
Sbjct  728  FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRT  787

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            MSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLGY PNFYHSQTG+SLD   QQQNP
Sbjct  788  MSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLGY-PNFYHSQTGVSLD--PQQQNP  844

Query  362  RDGPL  376
            RDG L
Sbjct  845  RDGSL  849



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 10/150 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGS  178
            FG++ +IPG +FPLNP +AP+ T++G DD +SSQYKD++HLMSLQQ  +NSGMW+HG GS
Sbjct  698  FGSSTSIPGGNFPLNPPSAPTGTTIGYDDVISSQYKDSNHLMSLQQQNDNSGMWVHGPGS  757

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN-PNFYHSQTGISLDHHHQQQ  355
            R M A PA+ YY+ Q QNQQ +GFRQ QQPSQ +A    N PNFYHSQTG+SLD  HQQQ
Sbjct  758  RAMPAVPASNYYSFQGQNQQHAGFRQTQQPSQQFAGAALNYPNFYHSQTGMSLD--HQQQ  815

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            + RD  L    G +Q QP   SQQLWQNSY
Sbjct  816  SSRDASL----GGSQGQPSKQSQQLWQNSY  841



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 114/149 (77%), Gaps = 10/149 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG ++PLNP AAP ST++G DD ++SQYKDN+H++SLQQ ENS MW+HG  SR
Sbjct  706  FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKDNNHMISLQQNENSPMWVHGPSSR  765

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQV-QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            TMSA P +TYY+ Q QNQQ  GFRQ  QQPSQ++ SLGY PNFYHSQ+G+SL+  H QQN
Sbjct  766  TMSAVPPSTYYSFQGQNQQAGGFRQSPQQPSQHFGSLGY-PNFYHSQSGVSLE--HPQQN  822

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PR+  L    G +Q QP   + Q+WQNSY
Sbjct  823  PREATL----GGSQSQPPKQTPQIWQNSY  847



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGN+  IPGSFPLNPS+ P ST++G DD +SSQYKD +H + LQQ +NS MW+HG GS
Sbjct  714  GGFGNSTNIPGSFPLNPSSTPASTTIGYDDVISSQYKDGNHFIPLQQNDNSAMWVHGPGS  773

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ+Y +LGY PNFY SQ  +S    H QQN
Sbjct  774  RTMSALPASTYYSFQGQSQQHGGFRQAQQPSQHYGALGY-PNFYQSQPRVS--QEHPQQN  830

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      +Q  P   S Q+WQ++Y
Sbjct  831  PNDGTL----AGSQGVPTKQSHQIWQHNY  855



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGN+  IPGSFPLNPS+ P ST++G DD +SSQYKD +H + LQQ +NS MW+HG GS
Sbjct  734  GGFGNSTNIPGSFPLNPSSTPASTTIGYDDVISSQYKDGNHFIPLQQNDNSAMWVHGPGS  793

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ+Y +LGY PNFY SQ  +S    H QQN
Sbjct  794  RTMSALPASTYYSFQGQSQQHGGFRQAQQPSQHYGALGY-PNFYQSQPRVS--QEHPQQN  850

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      +Q  P   S Q+WQ++Y
Sbjct  851  PNDGTL----AGSQGVPTKQSHQIWQHNY  875



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 109/149 (73%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGN+  IPG+FPLNPS+ P ST++G DD +SSQYKD +  + LQQ ENSGMW+HG GS
Sbjct  748  GGFGNSTNIPGNFPLNPSSTPASTTIGYDDVISSQYKDGNQFIPLQQNENSGMWVHGLGS  807

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA P +TYY+ Q Q+QQ  GFRQ QQPSQ+Y +LGY PNFY SQTG+S    H QQN
Sbjct  808  RTMSALPGSTYYSFQGQSQQHGGFRQGQQPSQHYGALGY-PNFYQSQTGVS--QEHPQQN  864

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG LGG  G +  Q    S Q+WQ++Y
Sbjct  865  PNDGTLGGSQGASAKQ----SHQIWQHNY  889



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 109/149 (73%), Gaps = 8/149 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FGN+  IPG+FPLNPS+ P ST++G DD +SSQYKD +  + LQQ ENSGMW+HG GS
Sbjct  766  GGFGNSTNIPGNFPLNPSSTPASTTIGYDDVISSQYKDGNQFIPLQQNENSGMWVHGLGS  825

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA P +TYY+ Q Q+QQ  GFRQ QQPSQ+Y +LGY PNFY SQTG+S    H QQN
Sbjct  826  RTMSALPGSTYYSFQGQSQQHGGFRQGQQPSQHYGALGY-PNFYQSQTGVS--QEHPQQN  882

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG LGG  G +  Q    S Q+WQ++Y
Sbjct  883  PNDGTLGGSQGASAKQ----SHQIWQHNY  907



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT  IPG+F +NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GS
Sbjct  707  GAFGNTTAIPGNFTINPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGS  766

Query  179  RTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            RTMSA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SL   P+FY+SQ GISLD   QQQ
Sbjct  767  RTMSAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLAGYPHFYNSQAGISLD-QQQQQ  825

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            N RD         +Q QPK S QQ+WQN Y
Sbjct  826  NLRDA---ASLAGSQGQPKQSQQQIWQNGY  852



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 10/149 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG ++PLNP AAP ST++G DD ++SQ+K+N+H++SLQQ ENS MW+HG  SR
Sbjct  704  FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQFKENNHIISLQQNENSPMWVHGPSSR  763

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ-NYASLGYNPNFYHSQTGISLDHHHQQQN  358
            TMSA P +TYY+ Q QNQQP GFRQ QQPSQ ++ SLGY PNFYHSQTGISL+  HQQQN
Sbjct  764  TMSAVPPSTYYSFQGQNQQPGGFRQSQQPSQQHFGSLGY-PNFYHSQTGISLE--HQQQN  820

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PR+  L G            SQQ+WQNSY
Sbjct  821  PREASLAGSQSQPPK----QSQQIWQNSY  845



>ref|XP_004162612.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224560 
[Cucumis sativus]
Length=844

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +FPLNP  AP+ +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSR
Sbjct  704  FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSR  763

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LGY PNFYHSQ GISLD   QQQ  
Sbjct  764  TMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTL  820

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q Q    SQQ+WQNSY
Sbjct  821  RDASL----GGSQGQQPKQSQQIWQNSY  844



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +FPLNP  AP+ +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSR
Sbjct  707  FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSR  766

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LGY PNFYHSQ GISLD   QQQ  
Sbjct  767  TMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTL  823

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  LGG  G         SQQ+WQNSY
Sbjct  824  RDASLGGSQGQQPK----QSQQIWQNSY  847



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +FPLNP  AP+ +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSR
Sbjct  706  FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSR  765

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LGY PNFYHSQ GISLD   QQQ  
Sbjct  766  TMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTL  822

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  LGG  G         SQQ+WQNSY
Sbjct  823  RDASLGGSQGQQPK----QSQQIWQNSY  846



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 [Cucumis sativus]
Length=845

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +FPLNP  AP+ +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSR
Sbjct  705  FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSR  764

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LGY PNFYHSQ GISLD   QQQ  
Sbjct  765  TMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTL  821

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q Q    SQQ+WQNSY
Sbjct  822  RDASL----GGSQGQQPKQSQQIWQNSY  845



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +FPLNP  AP+ +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSR
Sbjct  765  FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSR  824

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LGY PNFYHSQ GISLD   QQQ  
Sbjct  825  TMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTL  881

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L    G +Q Q    SQQ+WQNSY
Sbjct  882  RDASL----GGSQGQQPKQSQQIWQNSY  905



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GS
Sbjct  700  GAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGS  759

Query  179  RTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
            RT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG  P+FY+SQ GIS
Sbjct  760  RTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLGGYPHFYNSQAGIS  811



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GS
Sbjct  707  GAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGS  766

Query  179  RTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
            RT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG  P+FY+SQ GIS
Sbjct  767  RTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLGGYPHFYNSQAGIS  818



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 17/147 (12%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTM  187
            FG++ ++P         A  T++G DDGLSSQYKD +HL+SLQQ +NS MW+HG GSRTM
Sbjct  719  FGSSTSVP---------AGGTTIGYDDGLSSQYKDGNHLISLQQNDNSAMWVHGPGSRTM  769

Query  188  SAAPANTYYNIQAQNQQPSGFRQVQQPSQ-NYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            SA PA+TYY+ Q QNQQP+G+RQ QQ SQ ++ +LGY PN+YHSQTGISL+   QQQN R
Sbjct  770  SAVPASTYYSFQGQNQQPAGYRQGQQLSQQHFGALGY-PNYYHSQTGISLE--LQQQNSR  826

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            +G L    G +Q QP   +QQLWQNSY
Sbjct  827  EGSL----GGSQGQPSKQTQQLWQNSY  849



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 114/158 (72%), Gaps = 17/158 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGNT T+PG+F +NP AAP+  +L  DD LSSQYKDN HL+SLQQ ENS MWLHG  S
Sbjct  683  GAFGNTTTVPGNFQMNPPAAPTGATLSYDDVLSSQYKDNSHLVSLQQNENSAMWLHGPNS  742

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLD-------  337
            RTMSA PA+TYYN Q Q+QQ  GFRQ QQPSQNY +LGY PNFYHSQTG+SLD       
Sbjct  743  RTMSAVPASTYYNYQGQSQQGGGFRQGQQPSQNYGALGY-PNFYHSQTGMSLDQQQQQQQ  801

Query  338  --HHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
                 QQQN RDG L    G AQ QPK S  Q+WQN+Y
Sbjct  802  QQQQQQQQNARDGSL----GGAQGQPKQS--QIWQNNY  833



>gb|KJB57294.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=722

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 8/147 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRT
Sbjct  583  FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRT  642

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            MSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY PNFYHSQTG+  D  HQQQNP 
Sbjct  643  MSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPM  699

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            DG L      +Q QP   +QQLWQN+Y
Sbjct  700  DGSL----SGSQGQPSKQTQQLWQNNY  722



>gb|KJB57297.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57298.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=761

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 8/147 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRT
Sbjct  622  FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRT  681

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            MSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY PNFYHSQTG+  D  HQQQNP 
Sbjct  682  MSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPM  738

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            DG L      +Q QP   +QQLWQN+Y
Sbjct  739  DGSL----SGSQGQPSKQTQQLWQNNY  761



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 8/147 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRT
Sbjct  730  FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRT  789

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            MSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY PNFYHSQTG+  D  HQQQNP 
Sbjct  790  MSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPM  846

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            DG L      +Q QP   +QQLWQN+Y
Sbjct  847  DGSL----SGSQGQPSKQTQQLWQNNY  869



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 108/147 (73%), Gaps = 8/147 (5%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRT
Sbjct  712  FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRT  771

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
            MSA P + YY+ Q QNQQ  GFRQ QQPSQ + +LGY PNFYHSQTG+  D  HQQQNP 
Sbjct  772  MSAVPGSNYYSFQGQNQQGGGFRQGQQPSQQFGALGY-PNFYHSQTGVLGD--HQQQNPM  828

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            DG L      +Q QP   +QQLWQN+Y
Sbjct  829  DGSL----SGSQGQPSKQTQQLWQNNY  851



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 111/150 (74%), Gaps = 10/150 (7%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG ++PLNPSAAP ST++G DD ++SQYKDN+H++SLQQ EN+ MW+ G GSR
Sbjct  722  FGSSTSIPGGNYPLNPSAAPTSTTIGYDDVINSQYKDNNHMISLQQNENNPMWVQGPGSR  781

Query  182  TMSAAPANTYYNIQAQN-QQPSGFRQVQQPS-QNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            TMS  P+ TYY+ Q QN QQP  FRQ QQPS Q++A  GY  NFYHSQ+GISL+  HQQQ
Sbjct  782  TMSVPPS-TYYSFQGQNQQQPGAFRQSQQPSQQHFAPHGYPNNFYHSQSGISLE--HQQQ  838

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRD  L G       Q   S QQLWQNSY
Sbjct  839  NPRDASLAGSQSQPPKQ---SQQQLWQNSY  865



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  IPGSF  NP SA+ ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GS
Sbjct  748  GGFGSSTNIPGSFTRNPTSASASTTIGFDESLSSQYKEANHYMPLQQNDNPAMWVHGAGS  807

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+Y+ Q Q+Q  SGFRQ QQPSQ + +LGY PNFYHSQ GIS +H   QQN
Sbjct  808  RTMSALPASTFYSFQGQSQH-SGFRQSQQPSQ-FGALGY-PNFYHSQAGISQEH---QQN  861

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L      +Q  P   S Q+WQ+SY
Sbjct  862  PGEGNL----NGSQATPSQPSHQIWQHSY  886



>ref|XP_008349816.1| PREDICTED: serine/threonine-protein kinase CBK1-like [Malus domestica]
Length=208

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 13/155 (8%)
 Frame = +2

Query  5    AFGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGH  172
             F ++ +IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG 
Sbjct  59   GFSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGP  118

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHH  343
            GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H
Sbjct  119  GSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-H  176

Query  344  HQQQNPRDGPLgggggNAQVQP-KPSSQQLWQNSY  445
             QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  177  QQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  208



>ref|XP_008797517.1| PREDICTED: uncharacterized protein LOC103712704 isoform X2 [Phoenix 
dactylifera]
Length=733

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  IPGSF  NP SA+ ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GS
Sbjct  595  GGFGSSTNIPGSFTRNPTSASASTTIGFDESLSSQYKEANHYMPLQQTDNPAMWVHGAGS  654

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN Q Q+Q  SGFRQ QQPSQ + + GY PNFYHSQ G+S +H   QQN
Sbjct  655  RTMSALPASTFYNFQGQSQH-SGFRQGQQPSQ-FGAPGY-PNFYHSQAGVSQEH---QQN  708

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L      +Q  P   S Q+WQ+SY
Sbjct  709  PGEGNL----NGSQATPSQPSHQIWQHSY  733



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  IPGSF  NP SA+ ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GS
Sbjct  755  GGFGSSTNIPGSFTRNPTSASASTTIGFDESLSSQYKEANHYMPLQQTDNPAMWVHGAGS  814

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN Q Q+Q  SGFRQ QQPSQ + + GY PNFYHSQ G+S +H   QQN
Sbjct  815  RTMSALPASTFYNFQGQSQH-SGFRQGQQPSQ-FGAPGY-PNFYHSQAGVSQEH---QQN  868

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L      +Q  P   S Q+WQ+SY
Sbjct  869  PGEGNL----NGSQATPSQPSHQIWQHSY  893



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 110/149 (74%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFG+T TI G++P+NP AAPS T+L  DD LSSQYKD+  L+SLQQ ENS MWLHG  S
Sbjct  710  GAFGSTATIAGNYPMNPPAAPSGTTLSYDDVLSSQYKDSSQLLSLQQNENSAMWLHGPNS  769

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM A PA+TYYN Q QNQQP GFRQ QQ SQ+Y S GY PNFYHSQTGI LD   QQQN
Sbjct  770  RTMPAVPASTYYNYQGQNQQPGGFRQGQQQSQSYGSPGY-PNFYHSQTGILLD---QQQN  825

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG +      +Q QPK S  Q+W NSY
Sbjct  826  PRDGSI----AGSQGQPKQS--QIWPNSY  848



>ref|XP_010666705.1| PREDICTED: uncharacterized protein LOC104883839 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=847

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 103/150 (69%), Gaps = 16/150 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQYKD  HL+SLQQ         G GS
Sbjct  712  GAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQYKDASHLLSLQQ---------GAGS  762

Query  179  RTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            RT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y  L   PNFYHSQ+G+SLD H QQQ
Sbjct  763  RTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHYGQLSGYPNFYHSQSGLSLD-HQQQQ  821

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              RDG L      +Q Q    +QQLWQNSY
Sbjct  822  MSRDGSL----SGSQGQQPKQTQQLWQNSY  847



>ref|XP_010666704.1| PREDICTED: uncharacterized protein LOC104883839 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=858

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 103/150 (69%), Gaps = 16/150 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            GAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQYKD  HL+SLQQ         G GS
Sbjct  723  GAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQYKDASHLLSLQQ---------GAGS  773

Query  179  RTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            RT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y  L   PNFYHSQ+G+SLD H QQQ
Sbjct  774  RTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHYGQLSGYPNFYHSQSGLSLD-HQQQQ  832

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              RDG L      +Q Q    +QQLWQNSY
Sbjct  833  MSRDGSL----SGSQGQQPKQTQQLWQNSY  858



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  +PGSF LNP+ A+ ST++G+++ LSSQYK+ +H M LQQ +N  MW+HG GS
Sbjct  749  GGFGSSANLPGSFTLNPTTASASTTIGLEEALSSQYKEANHYMPLQQADNPAMWVHGAGS  808

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+Y+ Q QNQ  SGFRQ QQPSQ + +LGY PNFY SQ G+S +H   QQN
Sbjct  809  RTMSALPASTFYSFQGQNQH-SGFRQGQQPSQ-FGALGY-PNFYPSQGGVSQEH---QQN  862

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L      +Q  P   S Q+WQ+ Y
Sbjct  863  PSEGNLSV----SQAAPSQPSHQMWQHGY  887



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 114/153 (75%), Gaps = 12/153 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGS  178
            F N+ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ  +NSGMW+HG GS
Sbjct  709  FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQNDNSGMWVHGPGS  768

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQ  349
            R MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQ+G+SL+ H Q
Sbjct  769  RAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQ  826

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  827  QQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F N+ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  707  FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  766

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  767  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQ  824

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  825  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  855



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F N+ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  708  FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  767

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  768  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQ  825

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  826  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F N+ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  709  FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  768

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  769  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQ  826

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  827  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  857



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F N+ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  708  FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  767

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  768  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQ  825

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  826  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 12/153 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGS  178
            F ++ +IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ  +NSGMW+HG GS
Sbjct  709  FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQNDNSGMWVHGPGS  768

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQ  349
            R MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H Q
Sbjct  769  RAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQ  826

Query  350  QQNPRDGPLgggggNAQVQP-KPSSQQLWQNSY  445
            QQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  827  QQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  856



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 12/153 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGS  178
            F ++ +IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ  +NSGMW+HG GS
Sbjct  710  FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQNDNSGMWVHGPGS  769

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHHQ  349
            R MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H Q
Sbjct  770  RAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQ  827

Query  350  QQNPRDGPLgggggNAQVQP-KPSSQQLWQNSY  445
            QQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  828  QQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F ++ +IPG +FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG G
Sbjct  709  FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGPG  768

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H 
Sbjct  769  SRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQ  826

Query  347  QQQNPRDGPLgggggNAQVQP-KPSSQQLWQNSY  445
            QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  827  QQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_008358625.1| PREDICTED: cell wall protein RBR3-like [Malus domestica]
Length=312

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F ++ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  164  FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  223

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  224  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQYAGALGY-PNFYHSQSGMSLE-HQ  281

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  282  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  312



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 103/152 (68%), Gaps = 21/152 (14%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQ--VENSGMWLH-GH  172
            FGN+  +  G++PLN SA P+ TSLG ++ LSSQYK+++H++SLQQ   ENS MWLH GH
Sbjct  679  FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQYKESNHMLSLQQHQQENSPMWLHNGH  738

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
            GSRTMS  P N YYN+Q Q Q P  FR  Q Q SQ+Y SLGY PNFYH QTGIS++ HH 
Sbjct  739  GSRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQHYGSLGY-PNFYHPQTGISIE-HHP  795

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QNPRDG              PS QQ+WQN Y
Sbjct  796  PQNPRDG------------GPPSKQQIWQNPY  815



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  IPGSF L+P+  + ST++G+++ LSSQYK+ +H M LQQ +N+ MW+HG GS
Sbjct  747  GGFGSSANIPGSFTLDPTTVSASTTIGLEEALSSQYKEANHYMPLQQADNTAMWVHGAGS  806

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+Y+ Q QNQ  SGFRQ QQPSQ +   GY PNFY SQ G+       QQN
Sbjct  807  RTMSALPASTFYSFQGQNQH-SGFRQGQQPSQ-FGPPGY-PNFYPSQAGVP---QELQQN  860

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L      +Q  P  +S Q+WQ+SY
Sbjct  861  PSEGNLNV----SQAAPSQASHQMWQHSY  885



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 103/151 (68%), Gaps = 20/151 (13%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLH-GHG  175
            FGN+  +  G++PLN SA P+ TSLG ++ LSSQYK+++H++SLQQ  +NS MWLH GHG
Sbjct  679  FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQYKESNHMLSLQQHQQNSPMWLHNGHG  738

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            SRTMS  P N YYN+Q Q Q P  FR  Q Q SQ+Y SLGY PNFYH QTGIS++ HH  
Sbjct  739  SRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQHYGSLGY-PNFYHPQTGISIE-HHPP  795

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            QNPRDG              PS QQ+WQN Y
Sbjct  796  QNPRDG------------GPPSKQQIWQNPY  814



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 13/154 (8%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  175
            F ++ +IPG +FPLNPS+AP+ T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG G
Sbjct  708  FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPG  767

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  346
            SR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ YA +LGY PNFYHSQ+G+SL+ H 
Sbjct  768  SRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQYAGALGY-PNFYHSQSGMSLE-HQ  825

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQ-LWQNSY  445
            QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  826  QQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  856



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG ++PLNPSA P ST++G DD +SSQYK+N+H++SLQQ ENS MW+ G GSR
Sbjct  721  FGSSTSIPGGNYPLNPSAPPTSTAIGYDDVISSQYKENNHMISLQQNENSPMWVQGPGSR  780

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNP  361
            TMS  P+  Y       QQ  GFRQ QQPSQ++   GY PN+YHSQ+GISL+  HQQQNP
Sbjct  781  TMSVPPSTYYSFQGQNQQQAGGFRQNQQPSQHFGPHGY-PNYYHSQSGISLE--HQQQNP  837

Query  362  RDGPLgggggNAQVQPKPSSQQLWQNSY  445
            RD  L G            SQQLWQNSY
Sbjct  838  RDASLAGSQQQNPK----QSQQLWQNSY  861



>emb|CBI20348.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  280
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q QNQQP GFRQ  QPSQ++
Sbjct  74   YKNGNHLISFQQQNENSTMWNHGPGSQTMSAVPANTYYSFQGQNQQPGGFRQGHQPSQHF  133

Query  281  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLW  433
              LGY PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  134  GVLGY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  177



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (78%), Gaps = 4/117 (3%)
 Frame = +2

Query  8    FGNTGTIPG--SFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            F ++ +IPG  SF LNP +AA  T++G ++ ++SQ KDN H++SLQQ ENS +WL G GS
Sbjct  690  FNSSTSIPGGGSFSLNPPAAATGTTIGYENVINSQLKDNSHMISLQQNENSPIWLQGPGS  749

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
            RTM A P + YY++Q QNQQPSGF+Q QQP+Q++ SLG+ PNFY SQ+GISL+H HQ
Sbjct  750  RTMPAVPPSAYYSLQGQNQQPSGFQQRQQPTQHFGSLGH-PNFYQSQSGISLEHQHQ  805



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G+TG   G+F LNP +AP +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G 
Sbjct  691  GFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGG  750

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ SL Y PNFY S  GISL+  HQQ
Sbjct  751  RTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQ  806

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q  RD  LGG            S Q+WQN+Y
Sbjct  807  QIARDSSLGGSQSQQAK----QSAQIWQNTY  833



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G+TG   G+F LNP +AP +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G 
Sbjct  717  GFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGG  776

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ SL Y PNFY S  GISL+  HQQ
Sbjct  777  RTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQ  832

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q  RD  LGG            S Q+WQN+Y
Sbjct  833  QIARDSSLGGSQSQQAK----QSAQIWQNTY  859



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G+TG   G+F LNP +AP +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G 
Sbjct  715  GFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGG  774

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ SL Y PNFY S  GISL+  HQQ
Sbjct  775  RTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQ  830

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q  RD  LGG            S Q+WQN+Y
Sbjct  831  QIARDSSLGGSQSQQAK----QSAQIWQNTY  857



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 107/160 (67%), Gaps = 27/160 (17%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLN-PSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV---ENSGMWLHG  169
            FGN+  I  G++PLN P+A P+ T+LG  D LSSQYK+ +HL+SLQQ    ENS MW+HG
Sbjct  680  FGNSSNIGTGNYPLNQPTAPPTGTTLGYGDVLSSQYKEINHLLSLQQQQQNENSAMWVHG  739

Query  170  HGSRTMSAAPANTYYNIQA--QNQQP-----SGF-RQVQQPSQNYASLGYNPNFYHSQTG  325
            HG++TM A P NTYYN+QA   NQQ      SG+ R   QP  +Y SLGY PNFY SQTG
Sbjct  740  HGAQTMPAIPTNTYYNLQAAHHNQQASSSSSSGYHRHAHQP--DYGSLGY-PNFYQSQTG  796

Query  326  ISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            +SL+   QQQNPRDG           Q +P S+Q+WQNSY
Sbjct  797  MSLE-QQQQQNPRDG---------GSQGQPPSKQIWQNSY  826



>emb|CAN79286.1| hypothetical protein VITISV_039797 [Vitis vinifera]
Length=298

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  280
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q+QNQQP  FRQ  QPSQ++
Sbjct  191  YKNGNHLISFQQQNENSAMWNHGPGSQTMSAVPANTYYSFQSQNQQPGRFRQGHQPSQHF  250

Query  281  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLW  433
             +L Y PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  251  GALEY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  294



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G++  IPG+F LN  +A+ ST++G D+ LS QYK+  H + LQQ EN  MW+HG GS
Sbjct  693  GGLGSSANIPGAFILNHTTASASTTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGS  752

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN   QNQ  SG R  QQ SQ   +LGY PN YHSQ G S +H   QQN
Sbjct  753  RTMSALPASTFYNYPGQNQH-SGIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQN  806

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L     N    P   + Q+WQ+ Y
Sbjct  807  PGEGNL-----NGSQTPSQPANQIWQHGY  830



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G++  IPG+F LN  +A+ ST++G D+ LS QYK+  H + LQQ EN  MW+HG GS
Sbjct  735  GGLGSSANIPGAFILNHTTASASTTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGS  794

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN   QNQ  SG R  QQ SQ   +LGY PN YHSQ G S +H   QQN
Sbjct  795  RTMSALPASTFYNYPGQNQH-SGIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQN  848

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L     N    P   + Q+WQ+ Y
Sbjct  849  PGEGNL-----NGSQTPSQPANQIWQHGY  872



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G++  IPG+F LN  +A+ ST++G D+ LS QYK+  H + LQQ EN  MW+HG GS
Sbjct  741  GGLGSSANIPGAFILNHTTASASTTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGS  800

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN   QNQ  SG R  QQ SQ   +LGY PN YHSQ G S +H   QQN
Sbjct  801  RTMSALPASTFYNYPGQNQH-SGIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQN  854

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L     N    P   + Q+WQ+ Y
Sbjct  855  PGEGNL-----NGSQTPSQPANQIWQHGY  878



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  G++  IPG+F LN  +A+ ST++G D+ LS QYK+  H + LQQ EN  MW+HG GS
Sbjct  746  GGLGSSANIPGAFILNHTTASASTTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGS  805

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PA+T+YN   QNQ  SG R  QQ SQ   +LGY PN YHSQ G S +H   QQN
Sbjct  806  RTMSALPASTFYNYPGQNQH-SGIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQN  859

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P +G L     N    P   + Q+WQ+ Y
Sbjct  860  PGEGNL-----NGSQTPSQPANQIWQHGY  883



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 99/149 (66%), Gaps = 19/149 (13%)
 Frame = +2

Query  32   GSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----ENSGMWLHGHGSRTMSAA  196
            G+FPLN  S  P T++G +D LSSQYK++ HL++LQQ     ENS MW HGHGSRTMS  
Sbjct  665  GNFPLNQHSTPPGTTMGYEDVLSSQYKESSHLLALQQQQQQNENSAMWHHGHGSRTMSGV  724

Query  197  PANTYYNIQAQNQQPS------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            PANTYYN+QAQ Q         G+RQ QQ  Q+Y S GY PN+Y SQT +S+D   QQQN
Sbjct  725  PANTYYNLQAQQQLQQAQQAAGGYRQAQQ-QQHYGSQGY-PNYYQSQTEMSVD--RQQQN  780

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            PRDG     G  A  QP   +QQLWQNSY
Sbjct  781  PRDG----AGAQAGSQPSNQTQQLWQNSY  805



>gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Erythranthe guttata]
Length=625

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 101/158 (64%), Gaps = 21/158 (13%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNP-SAAP--STSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLHG  169
            G FGN  +IPG++ +NP SAAP   ++L  DD L++QYK+  HL+SLQQ  ENS +WL G
Sbjct  479  GGFGNNTSIPGNYQMNPQSAAPLSESALSYDDVLNAQYKERSHLLSLQQQSENSPVWLQG  538

Query  170  HGSRTMSAAPANTYYNIQAQ--NQQPSGFRQVQQPSQNYASLGY----NPNFYHSQTGIS  331
            H SRTMS  PA+T YN+QAQ  NQQ  GFRQ Q P Q           NPN+YHSQTG+S
Sbjct  539  HNSRTMSGVPASTLYNLQAQQTNQQLGGFRQGQAPHQQQQQQQSQNYGNPNYYHSQTGMS  598

Query  332  LDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            LD   Q QNPRD         +Q QPK S  Q+W N+Y
Sbjct  599  LD---QLQNPRD------VSGSQGQPKQS--QMWPNNY  625



>emb|CAE00871.1| TA9 protein [Oryza sativa Japonica Group]
Length=140

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  169
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG 
Sbjct  1    GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGA  58

Query  170  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  59   AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPHEH---  112

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  113  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  140



>ref|XP_006646178.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like, partial 
[Oryza brachyantha]
Length=780

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 97/152 (64%), Gaps = 16/152 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  169
            G FG++ +IPG+F LN   PSAA  TS+G D+ LS+Q+KDN H ++LQQ +NS MWL G 
Sbjct  641  GGFGSSTSIPGNFGLNQNVPSAA--TSMGFDEALSAQFKDNSHYIALQQSDNSAMWLQGA  698

Query  170  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  699  AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---  752

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QN  +G L     ++Q  P   S QLWQ+ Y
Sbjct  753  PQNLPEGTL----NSSQTAPSQPSHQLWQHIY  780



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 14/153 (9%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSR
Sbjct  655  FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSR  714

Query  182  TMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHH  346
            TMSA P + YYN+Q QNQQ         +Q QQPSQ++  LGY PNFY SQTGISL+  H
Sbjct  715  TMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--H  771

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q QNPR+  LGG            SQQ+WQNSY
Sbjct  772  QPQNPREASLGGPQSQPSK----QSQQIWQNSY  800



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 14/153 (9%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSR
Sbjct  687  FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSR  746

Query  182  TMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHH  346
            TMSA P + YYN+Q QNQQ         +Q QQPSQ++  LGY PNFY SQTGISL+  H
Sbjct  747  TMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--H  803

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q QNPR+  LGG            SQQ+WQNSY
Sbjct  804  QPQNPREASLGGPQSQPSK----QSQQIWQNSY  832



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 14/153 (9%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSR
Sbjct  686  FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSR  745

Query  182  TMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHH  346
            TMSA P + YYN+Q QNQQ         +Q QQPSQ++  LGY PNFY SQTGISL+  H
Sbjct  746  TMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--H  802

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q QNPR+  LGG            SQQ+WQNSY
Sbjct  803  QPQNPREASLGGPQSQPSK----QSQQIWQNSY  831



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 95/150 (63%), Gaps = 15/150 (10%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPSTSLGID--DGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            FG +  +PG +FPLN S+  +T++G D  D LSSQ+KD++H  S+QQ E+S  WL G  S
Sbjct  652  FGASSNVPGGNFPLNQSSTGNTTMGYDNNDVLSSQFKDSNHFASIQQNESSQAWLQGQNS  711

Query  179  RTMSAAPANTYYNIQAQNQQ-PSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            R +S  P +TYY+   QNQQ P GFR  QQPSQ +   GY   +Y SQ G+S++H+H  Q
Sbjct  712  RVVSVVPGSTYYSFPGQNQQPPGGFR--QQPSQQH--FGYMSPYY-SQAGMSMEHNHHHQ  766

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NPRD  +      AQ      +QQLWQNSY
Sbjct  767  NPRDTSV------AQTHASKQAQQLWQNSY  790



>dbj|BAD72339.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72382.1| TA9 protein-like [Oryza sativa Japonica Group]
Length=371

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  169
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG 
Sbjct  232  GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGA  289

Query  170  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  290  AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---  343

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  344  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  371



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 93/149 (62%), Gaps = 11/149 (7%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG+  +IPG F LN  +A+ +T+ G+ + LS QYK+  H M LQQ EN  MW+ G GS
Sbjct  772  GGFGSAASIPGGFTLNHTTASANTTTGLGEALSLQYKEGSHYMPLQQNENPAMWVQGAGS  831

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTMSA PANT+YN Q  NQQ SGFRQ  Q S    +LGY PN Y SQ G S +H   QQ+
Sbjct  832  RTMSALPANTFYNYQGHNQQ-SGFRQNLQASP-LGALGY-PNLYLSQGGPSREH---QQS  885

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L G     Q QP   + Q+WQ+ Y
Sbjct  886  PSDGNLNGSQAT-QSQP---ANQIWQHGY  910



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 106/171 (62%), Gaps = 38/171 (22%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-------------  142
            FGN+  +   G+FPLN  +AP+   G +D LSSQYK+++HL++LQQ              
Sbjct  679  FGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKESNHLLALQQQQQQQQQQQLLLQQ  735

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPSQNYASLGY  295
               ENS MW HGHGSRTMS  PANTYYN+QAQ QQ        G+RQ QQ  Q+Y S GY
Sbjct  736  QQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQPQQAAGGYRQAQQ-QQHYGSHGY  794

Query  296  NPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQV-QPKPSSQQLWQNSY  445
             PNFY SQT +SLD   QQQNPRDG        AQV QP   +QQLWQNSY
Sbjct  795  -PNFYQSQTEMSLD--RQQQNPRDG------AGAQVGQPSNQTQQLWQNSY  836



>emb|CDJ26391.1| unnamed protein product [Triticum aestivum]
Length=845

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (66%), Gaps = 11/137 (8%)
 Frame = +2

Query  38   FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYY  214
            F  N SA+P+T++GID+ LSSQ K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y
Sbjct  719  FGQNQSASPATTMGIDEALSSQLKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFY  778

Query  215  NIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggN  394
              Q Q+ Q  GFR+VQQPSQ Y  LGY P+FY SQ G+  +H    QNP +G L     +
Sbjct  779  GFQGQSAQ-GGFREVQQPSQ-YGGLGY-PSFYQSQNGMQQEH---PQNPAEGSL----NS  828

Query  395  AQVQPKPSSQQLWQNSY  445
            +Q  P   S Q+WQ+SY
Sbjct  829  SQTAPSQPSHQMWQHSY  845



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 106/171 (62%), Gaps = 38/171 (22%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-------------  142
            FGN+  +   G+FPLN  +AP+   G +D LSSQYK+++HL++LQQ              
Sbjct  681  FGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKESNHLLALQQQQQQQQQQQLLLQQ  737

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPSQNYASLGY  295
               ENS MW HGHGSRTMS  PANTYYN+QAQ QQ        G+RQ QQ  Q+Y S GY
Sbjct  738  QQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQPQQAAGGYRQAQQ-QQHYGSHGY  796

Query  296  NPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQV-QPKPSSQQLWQNSY  445
             PNFY SQT +SLD   QQQNPRDG        AQV QP   +QQLWQNSY
Sbjct  797  -PNFYQSQTEMSLD--RQQQNPRDG------AGAQVGQPSNQTQQLWQNSY  838



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  169
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG 
Sbjct  712  GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGA  769

Query  170  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  770  AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---  823

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  824  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  851



>gb|EMT31975.1| Retrovirus-related Pol polyprotein LINE-1 [Aegilops tauschii]
Length=1186

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 11/137 (8%)
 Frame = +2

Query  38    FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYY  214
             F  N SA+P+T++GID+ LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y
Sbjct  1060  FGQNQSASPATTMGIDEALSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFY  1119

Query  215   NIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggN  394
               Q Q+ Q  GFR+VQQPSQ Y  LG+ P+FY SQ G+  +H    QNP +G L     +
Sbjct  1120  GFQGQSAQ-GGFREVQQPSQ-YGGLGH-PSFYQSQNGMQQEH---PQNPAEGSL----NS  1169

Query  395   AQVQPKPSSQQLWQNSY  445
             +Q  P   S Q+WQ+SY
Sbjct  1170  SQTAPSQPSHQMWQHSY  1186



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 104/174 (60%), Gaps = 36/174 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV------------  142
            FGN+  +   G+FPLN  +AP+ T+LG +D LSSQYK+NH L++LQQ             
Sbjct  676  FGNSTNVGSTGNFPLNQQSAPTGTTLGYEDVLSSQYKENH-LLALQQQQQQQQQQQQQQN  734

Query  143  ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-------------GFRQVQQPSQNYA  283
            ENS MW HGHGSRTMS  P NTYYN+QAQ Q                G+RQ QQ  Q+Y 
Sbjct  735  ENSAMWHHGHGSRTMSGVPTNTYYNLQAQQQLQLQQQQQQQAQQAAGGYRQAQQ-QQHYG  793

Query  284  SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            S GY PN+Y SQT +SLD   QQQNPRDG  G   G    Q   + QQLWQNSY
Sbjct  794  SHGY-PNYYQSQTEMSLD--RQQQNPRDGGTGSQAGQPSNQ---TQQQLWQNSY  841



>ref|XP_008648655.1| PREDICTED: uncharacterized protein LOC103629266 [Zea mays]
Length=281

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 91/150 (61%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IPG+F  N  AA + T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  142  GGFGSANNIPGNFSQNQGAAAAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAG  201

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y+ Q Q+Q   GFRQ  QPSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  202  SRTISAVPPGNFYDFQGQSQH-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  255

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+ Y
Sbjct  256  NPTEGSL----NNPQGVPSQPSHQLWQHIY  281



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 104/174 (60%), Gaps = 36/174 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL  163
            FGN+      G+FP N  +AP+ T+LG +D LSSQYK+++HL++LQQ      ENS MW 
Sbjct  675  FGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQYKESNHLLALQQQQQQQNENSAMWH  734

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS--------------------GFRQVQQPSQNYA  283
            HGHGSRTMS  PANTYYN+QAQ Q                       G+RQ QQ   +Y 
Sbjct  735  HGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQQQQQQTQQAAGGYRQAQQQQHHYG  794

Query  284  SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            S GY PNFY SQT +SL+   QQQNPRDG     GG+   Q    +QQLWQNSY
Sbjct  795  SHGY-PNFYQSQTEMSLE--RQQQNPRDG-----GGSQAGQQSNQTQQLWQNSY  840



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 104/174 (60%), Gaps = 36/174 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL  163
            FGN+      G+FP N  +AP+ T+LG +D LSSQYK+++HL++LQQ      ENS MW 
Sbjct  667  FGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQYKESNHLLALQQQQQQQNENSAMWH  726

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS--------------------GFRQVQQPSQNYA  283
            HGHGSRTMS  PANTYYN+QAQ Q                       G+RQ QQ   +Y 
Sbjct  727  HGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQQQQQQTQQAAGGYRQAQQQQHHYG  786

Query  284  SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            S GY PNFY SQT +SL+   QQQNPRDG     GG+   Q    +QQLWQNSY
Sbjct  787  SHGY-PNFYQSQTEMSLE--RQQQNPRDG-----GGSQAGQQSNQTQQLWQNSY  832



>ref|NP_001130067.1| uncharacterized protein LOC100191159 [Zea mays]
 gb|ACF78188.1| unknown [Zea mays]
Length=255

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IPG+F  N  A A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  116  GGFGSANNIPGNFSQNQGAPAAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAG  175

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y  Q Q+Q   GFRQ  QPSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  176  SRTISAVPPGNFYGFQGQSQH-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  229

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+ Y
Sbjct  230  NPTEGSL----NNPQGVPSQPSHQLWQHIY  255



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 105/178 (59%), Gaps = 40/178 (22%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV------------  142
            FGN+  +    SFPLN  +AP+ T+LG +D LSSQYK+++HL++LQQ             
Sbjct  673  FGNSTNVGSAASFPLNQQSAPTGTTLGYEDVLSSQYKESNHLLALQQQQQQQQHQQQQQN  732

Query  143  ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----------------GFRQVQQPS  271
            ENS MW HGHGSRTMS  PANTYYN+QAQ Q                    G+RQ QQ  
Sbjct  733  ENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQLQQQQQQQTQQAAGGYRQAQQ-Q  791

Query  272  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q+Y S GY PNFY SQT +SL+   QQQ+PRDG     G  A  Q   + QQLWQNSY
Sbjct  792  QHYGSHGY-PNFYQSQTEMSLE--RQQQSPRDG----AGSQAGQQSNQTQQQLWQNSY  842



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 106/180 (59%), Gaps = 41/180 (23%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV------------  142
            FGN+  +   GSFP+N  +AP+ T+LG +D LSSQYK+++HL++LQQ             
Sbjct  673  FGNSTNVGSAGSFPVNQQSAPTGTALGYEDVLSSQYKESNHLLALQQQQQQQQQQQQQQN  732

Query  143  ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-------------------GFRQVQQ  265
            ENS MW HGHGSRTMS  PANTYYN+QAQ Q                      G+RQ QQ
Sbjct  733  ENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQLQQQQQQQQQNQQAAGGYRQAQQ  792

Query  266  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              Q+Y S GY PNFY SQT +SL+   QQQNPRDG     GG    Q   + QQLWQNSY
Sbjct  793  -QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGAGSQAGGQQSNQ---TQQQLWQNSY  845



>gb|EEC71225.1| hypothetical protein OsI_03160 [Oryza sativa Indica Group]
Length=732

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  169
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ ++S MWLHG 
Sbjct  593  GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDSSAMWLHGA  650

Query  170  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  349
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY+ +FY SQ G+  +H   
Sbjct  651  AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGYS-SFYQSQAGLPQEH---  704

Query  350  QQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  705  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  732



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 104/179 (58%), Gaps = 41/179 (23%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV------------  142
            FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK+++HL++LQQ             
Sbjct  673  FGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYKESNHLLALQQQQQQQQQQQHQQQ  732

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------------GFRQVQQP  268
               ENS MW HGHGSRTMS  PANTYYN+QAQ Q                  G+RQ QQ 
Sbjct  733  QQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQQQQQQQTQQAAGGYRQAQQ-  791

Query  269  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             Q+Y S GY PNFY SQT +SL+   QQQNPRDG     G  A  Q   + QQLWQNSY
Sbjct  792  QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG----AGSQAGQQSNQTQQQLWQNSY  843



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 104/179 (58%), Gaps = 41/179 (23%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV------------  142
            FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK+++HL++LQQ             
Sbjct  672  FGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYKESNHLLALQQQQQQQQQQQHQQQ  731

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------------GFRQVQQP  268
               ENS MW HGHGSRTMS  PANTYYN+QAQ Q                  G+RQ QQ 
Sbjct  732  QQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQQQQQQQTQQAAGGYRQAQQ-  790

Query  269  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             Q+Y S GY PNFY SQT +SL+   QQQNPRDG     G  A  Q   + QQLWQNSY
Sbjct  791  QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG----AGSQAGQQSNQTQQQLWQNSY  842



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 107/156 (69%), Gaps = 16/156 (10%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F L+P AAP+ T++G +D ++SQ+KD++H++SLQQ +NS MW+ G G R
Sbjct  694  FGSSTSIPGGNFSLSPPAAPTGTTIGYEDLINSQFKDSNHMISLQQNDNSPMWVQGPGPR  753

Query  182  TMSAAPANTYYNIQAQ--------NQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLD  337
            TMSA P + YY++Q Q         Q+    +Q QQPSQ++ SLGY PNFY SQ+GISL+
Sbjct  754  TMSAVPPSNYYSMQGQSQQQAGGFRQRQQQQQQQQQPSQHFGSLGY-PNFYQSQSGISLE  812

Query  338  HHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              HQ QNPR+  LGG       Q   S QQLWQNSY
Sbjct  813  --HQPQNPREASLGGPQSQPSKQ---SQQQLWQNSY  843



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IPG+F  N  A A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  682  GGFGSANNIPGNFSQNQGAPAAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAG  741

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y  Q Q+Q   GFRQ  QPSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  742  SRTISAVPPGNFYGFQGQSQH-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  795

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+ Y
Sbjct  796  NPTEGSL----NNPQGVPSQPSHQLWQHIY  821



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IPG+F  N  A A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  703  GGFGSANNIPGNFSQNQGAPAAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAG  762

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y  Q Q+Q   GFRQ  QPSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  763  SRTISAVPPGNFYGFQGQSQH-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  816

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+ Y
Sbjct  817  NPTEGSL----NNPQGVPSQPSHQLWQHIY  842



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 100/173 (58%), Gaps = 36/173 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------EN  148
            FGN+  +   G+FPLN  SA   T+LG DD LSSQYK+NH L++LQQ           EN
Sbjct  668  FGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYKENH-LLALQQQQQQQQHQQQNEN  726

Query  149  SGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------------GFRQVQQPSQNYAS  286
            S MW  GHGSRTMS  P NTYYN+QAQ Q                 G+RQ QQ  Q+Y S
Sbjct  727  SAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGS  785

Query  287  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             GY PN+Y SQT +SL+   QQQNPRDG     G  A      S QQLWQNSY
Sbjct  786  HGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQAGQPSNQSQQQLWQNSY  831



>gb|AAG51735.1|AC068667_14 unknown protein; 25451-20507 [Arabidopsis thaliana]
Length=858

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 100/173 (58%), Gaps = 36/173 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------EN  148
            FGN+  +   G+FPLN  SA   T+LG DD LSSQYK+NH L++LQQ           EN
Sbjct  695  FGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYKENH-LLALQQQQQQQQHQQQNEN  753

Query  149  SGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------------GFRQVQQPSQNYAS  286
            S MW  GHGSRTMS  P NTYYN+QAQ Q                 G+RQ QQ  Q+Y S
Sbjct  754  SAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGS  812

Query  287  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             GY PN+Y SQT +SL+   QQQNPRDG     G  A      S QQLWQNSY
Sbjct  813  HGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQAGQPSNQSQQQLWQNSY  858



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 19/158 (12%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSR
Sbjct  688  FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNNHMMSLQQNENSPMWVQGPGSR  747

Query  182  TMSAAPANTYYNIQ----------AQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
            TMSA P + YYN+Q           Q  Q    +Q Q P Q++  LGY PNFY SQTGIS
Sbjct  748  TMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPPLQHFGPLGY-PNFYQSQTGIS  806

Query  332  LDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            L+   Q QNPR+  LGG            SQQ+WQNSY
Sbjct  807  LE--QQPQNPREASLGGPQSQPSK----QSQQIWQNSY  838



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 19/158 (12%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            FG++ +IPG +F LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSR
Sbjct  687  FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNNHMMSLQQNENSPMWVQGPGSR  746

Query  182  TMSAAPANTYYNIQ----------AQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
            TMSA P + YYN+Q           Q  Q    +Q Q P Q++  LGY PNFY SQTGIS
Sbjct  747  TMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPPLQHFGPLGY-PNFYQSQTGIS  805

Query  332  LDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            L+   Q QNPR+  LGG            SQQ+WQNSY
Sbjct  806  LE--QQPQNPREASLGGPQSQPSK----QSQQIWQNSY  837



>emb|CDX99817.1| BnaC05g22390D [Brassica napus]
Length=620

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 94/158 (59%), Gaps = 32/158 (20%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV---------ENSG  154
            FGN+ ++   G+FPLN  +AP+   G +D LSSQYK+N HL++LQQ          +NS 
Sbjct  483  FGNSTSVGSAGNFPLNQQSAPT---GYEDVLSSQYKENSHLLALQQQQQQQQQQQNDNSA  539

Query  155  MWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISL  334
            MW HGHGSRTMS  PAN YYN+Q Q       +  Q   Q Y S GY PNFY SQT +S 
Sbjct  540  MWHHGHGSRTMSGVPANAYYNLQQQQ------QLQQAQQQQYGSHGY-PNFYQSQTEMS-  591

Query  335  DHHHQQQNPRDGPLgggggNAQVQPK-PSSQQLWQNSY  445
             H  QQQNPRDG        A  QP   + QQLWQNSY
Sbjct  592  -HERQQQNPRDG--------AGAQPSNQTQQQLWQNSY  620



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 100/173 (58%), Gaps = 36/173 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------EN  148
            FGN+  +   G+FPLN  SA   T+LG +D LSSQYK+NH L++LQQ           EN
Sbjct  668  FGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNEN  726

Query  149  SGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------------GFRQVQQPSQNYAS  286
            S MW  GHGSRTMS  P NTYYN+QAQ Q                 G+RQ QQ  Q+Y S
Sbjct  727  SAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGS  785

Query  287  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             GY PN+Y SQT +SL+   QQQNPRDG     G  A      S QQLWQNSY
Sbjct  786  HGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQAGQPSNQSQQQLWQNSY  831



>gb|AAG51729.1|AC068667_8 unknown protein; 16040-11188 [Arabidopsis thaliana]
Length=858

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 100/173 (58%), Gaps = 36/173 (21%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------EN  148
            FGN+  +   G+FPLN  SA   T+LG +D LSSQYK+NH L++LQQ           EN
Sbjct  695  FGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNEN  753

Query  149  SGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------------GFRQVQQPSQNYAS  286
            S MW  GHGSRTMS  P NTYYN+QAQ Q                 G+RQ QQ  Q+Y S
Sbjct  754  SAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGS  812

Query  287  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
             GY PN+Y SQT +SL+   QQQNPRDG     G  A      S QQLWQNSY
Sbjct  813  HGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQAGQPSNQSQQQLWQNSY  858



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +2

Query  32   GSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPAN  205
            G+FPLN  SA P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PAN
Sbjct  658  GNFPLNQQSAPPGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPAN  714

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
            TYYN+QAQ QQ     +  Q  Q+Y S GY PN+Y SQT +S  H  QQQNPRDG     
Sbjct  715  TYYNLQAQQQQ---QLRQAQQQQHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG-----  763

Query  386  ggNAQV-QPKPSSQQLWQNSY  445
               AQ  QP   +QQLWQNSY
Sbjct  764  -AGAQAGQPSNQTQQLWQNSY  783



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +2

Query  32   GSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPAN  205
            G+FPLN  SA P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PAN
Sbjct  657  GNFPLNQQSAPPGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPAN  713

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
            TYYN+QAQ QQ     +  Q  Q+Y S GY PN+Y SQT +S  H  QQQNPRDG     
Sbjct  714  TYYNLQAQQQQ---QLRQAQQQQHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG-----  762

Query  386  ggNAQV-QPKPSSQQLWQNSY  445
               AQ  QP   +QQLWQNSY
Sbjct  763  -AGAQAGQPSNQTQQLWQNSY  782



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 97/161 (60%), Gaps = 30/161 (19%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV------ENSGMWL  163
            FGN+  +   G+FPLN  +AP+   G +D LSSQYK+N HL++LQQ       +NS MW 
Sbjct  678  FGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQYKENSHLLALQQQQQQQQNDNSAMWH  734

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPSQNYASLGYNPNFYHSQTG  325
            HGHGSRTMS  PAN YYN+Q Q Q         G+RQ QQ  Q Y S GY PNFY SQT 
Sbjct  735  HGHGSRTMSGVPANAYYNLQQQQQLQQAQQAAGGYRQAQQ-QQQYGSHGY-PNFYQSQTE  792

Query  326  ISLDHHHQQQNPRDGPLgggggNAQVQPK-PSSQQLWQNSY  445
            +S  H  QQQNPRD         A  QP   + QQLWQNSY
Sbjct  793  MS--HERQQQNPRDA--------AGAQPSNQTQQQLWQNSY  823



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +2

Query  32   GSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPAN  205
            G+FPLN  SA P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PAN
Sbjct  661  GNFPLNQQSAPPGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPAN  717

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
            TYYN+QAQ QQ     +  Q  Q+Y S GY PN+Y SQT +S  H  QQQNPRDG     
Sbjct  718  TYYNLQAQQQQ---QLRQAQQQQHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG-----  766

Query  386  ggNAQV-QPKPSSQQLWQNSY  445
               AQ  QP   +QQLWQNSY
Sbjct  767  -AGAQAGQPSNQTQQLWQNSY  786



>ref|XP_009102863.1| PREDICTED: uncharacterized protein LOC103828968 isoform X3 [Brassica 
rapa]
Length=639

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 92/141 (65%), Gaps = 18/141 (13%)
 Frame = +2

Query  32   GSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPAN  205
            G+FPLN  SA P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PAN
Sbjct  514  GNFPLNQQSAPPGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPAN  570

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
            TYYN+QAQ        +  Q  Q+Y S GY PN+Y SQT +S  H  QQQNPRDG     
Sbjct  571  TYYNLQAQQ---QQQLRQAQQQQHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG-----  619

Query  386  ggNAQV-QPKPSSQQLWQNSY  445
               AQ  QP   +QQLWQNSY
Sbjct  620  -AGAQAGQPSNQTQQLWQNSY  639



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 97/150 (65%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG++  +PG + LN  SA+ +T +G+D+ L+ Q+++  H + LQQ EN  MW+HG GS
Sbjct  745  GGFGSSANVPGGYTLNHTSASTNTMIGLDEALNLQHREASHHVPLQQSENPAMWIHGGGS  804

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYH-SQTGISLDHHHQQQ  355
            RTMSA P +T+YN   QNQ  SGFRQ QQ S +  +LGY PN +H +Q G S +H   QQ
Sbjct  805  RTMSALPTSTFYNYPGQNQH-SGFRQTQQ-SSHLGALGY-PNLHHDAQAGPSQEH---QQ  858

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            N  DG + G      VQ +P++ Q+WQ+ Y
Sbjct  859  NLSDGNMSGSQT---VQSQPAN-QIWQHGY  884



>ref|XP_006827353.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 24/156 (15%)
 Frame = +2

Query  2    GAFGNTGTIP-GSFPLNPSAAPSTS--LGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGH  172
             A+G+ GT P GSF LN S   S S  +G DD +SSQYKD  H + +QQ E+S +W+HG 
Sbjct  765  AAYGSFGTNPLGSFALNSSTTSSGSTTMGYDDIVSSQYKDGSHYVPIQQNESSAVWVHGP  824

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGI-----SLD  337
            GSR +SA PANTYY++Q  NQ    FRQ QQ S +Y +LGY PNFYH+Q G+     +L+
Sbjct  825  GSRNVSAIPANTYYSLQGHNQL-GEFRQPQQAS-HYNTLGY-PNFYHAQMGVAPPAAALE  881

Query  338  HHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            H   QQ+P DG              PSS Q+W + Y
Sbjct  882  H---QQSPSDGGSR----------APSSHQIWAHGY  904



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 94/151 (62%), Gaps = 12/151 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GH  172
            G FGN   IPG+F LN   APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLH G 
Sbjct  699  GGFGNANNIPGNFSLN-QGAPSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGGA  757

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            GSRT+SA P   +Y +Q Q+QQ  GFRQ  QPSQ Y  LGY P+FY SQ+  SL   H  
Sbjct  758  GSRTVSAVPPGNFYGLQGQSQQ-GGFRQAHQPSQ-YGGLGY-PSFYQSQSQASLPQEH-P  813

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            QN  +G L     N+Q  P   S  LWQ+SY
Sbjct  814  QNLTEGSL----NNSQGVPSQPSHHLWQHSY  840



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 83/150 (55%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHG  175
            G FGN   IPG+F LN   APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLHG  
Sbjct  700  GGFGNANNIPGNFSLN-QGAPSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGAA  758

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
                +  P N Y       Q      QVQQPSQ Y  LGY P+FY SQ G+  +H    Q
Sbjct  759  GSRAAVPPGNFYGFQGQSQQGGFRQAQVQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQ  813

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+SY
Sbjct  814  NPTEGSL----NNPQAAPSQPSHQLWQHSY  839



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 83/150 (55%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHG  175
            G FGN   IPG+F LN   APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLHG  
Sbjct  698  GGFGNANNIPGNFSLN-QGAPSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGAA  756

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
                +  P N Y       Q      QVQQPSQ Y  LGY P+FY SQ G+  +H    Q
Sbjct  757  GSRAAVPPGNFYGFQGQSQQGGFRQAQVQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQ  811

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            NP +G L     N Q  P   S QLWQ+SY
Sbjct  812  NPTEGSL----NNPQAAPSQPSHQLWQHSY  837



>ref|XP_003569505.1| PREDICTED: uncharacterized protein LOC100846506 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 14/147 (10%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            +G  G  P +F  N SA+ P T++G+D+ LS+Q+K+ +H M+LQQ +NS MWLHG  +  
Sbjct  701  YGGFGNFP-NFGQNQSASSPGTTMGLDEALSTQFKEANHYMALQQSDNSAMWLHGAAAS-  758

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
              A P + +Y  Q QN Q  GFRQ QQPSQ Y  LGY P+FY SQTG+      + QNP 
Sbjct  759  -RAVPPSNFYGFQGQNTQ-GGFRQAQQPSQ-YGGLGY-PSFYQSQTGMP---QERLQNPT  811

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            +G L     ++Q  P   S Q+WQ+SY
Sbjct  812  EGSL----NSSQTTPSQPSHQIWQHSY  834



>ref|XP_010232108.1| PREDICTED: uncharacterized protein LOC100846506 isoform X2 [Brachypodium 
distachyon]
Length=824

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 14/147 (10%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            +G  G  P +F  N SA+ P T++G+D+ LS+Q+K+ +H M+LQQ +NS MWLHG  +  
Sbjct  691  YGGFGNFP-NFGQNQSASSPGTTMGLDEALSTQFKEANHYMALQQSDNSAMWLHGAAAS-  748

Query  185  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  364
              A P + +Y  Q QN Q  GFRQ QQPSQ Y  LGY P+FY SQTG+      + QNP 
Sbjct  749  -RAVPPSNFYGFQGQNTQ-GGFRQAQQPSQ-YGGLGY-PSFYQSQTGMP---QERLQNPT  801

Query  365  DGPLgggggNAQVQPKPSSQQLWQNSY  445
            +G L     ++Q  P   S Q+WQ+SY
Sbjct  802  EGSL----NSSQTTPSQPSHQIWQHSY  824



>ref|XP_008645740.1| PREDICTED: uncharacterized protein LOC103627229 [Zea mays]
Length=281

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IP +F  N  AA + T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  142  GGFGSANNIPRNFSQNQGAAAAPTTLGFDEALGTQFKHPNHYAALQQSDNSAMWLHGGAG  201

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y  Q Q++   GFRQ   PSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  202  SRTISAVPPGNFYGFQGQSKH-GGFRQAHHPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  255

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            +P +G L     N    P   S QLWQ+ Y
Sbjct  256  SPTEGSL----NNPYGVPSQPSHQLWQHIY  281



>gb|AFW71654.1| hypothetical protein ZEAMMB73_647126 [Zea mays]
Length=432

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 87/150 (58%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHG  175
            G FG+   IP +F  N  AA + T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G G
Sbjct  293  GGFGSANNIPRNFSQNQGAAAAPTTLGFDEALGTQFKHPNHYAALQQSDNSAMWLHGGAG  352

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SRT+SA P   +Y  Q Q++   GFRQ   PSQ Y  LGY P+FY SQT +  +H    Q
Sbjct  353  SRTISAVPPGNFYGFQGQSKH-GGFRQAHHPSQ-YGGLGY-PSFYQSQTSLPQEH---PQ  406

Query  356  NPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            +P +G L     N    P   S QLWQ+ Y
Sbjct  407  SPTEGSL----NNPYGVPSQPSHQLWQHIY  432



>gb|EMS47817.1| hypothetical protein TRIUR3_20557 [Triticum urartu]
Length=1165

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +2

Query  38   FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYY  214
            F  N SA+P+T++GID+ LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y
Sbjct  812  FGQNQSASPATTMGIDEALSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFY  871

Query  215  NIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQ  319
              Q Q++Q  GFR+VQQPSQ Y  LGY P+FY SQ
Sbjct  872  GFQGQSEQ-GGFREVQQPSQ-YGGLGY-PSFYQSQ  903



>emb|CDY61562.1| BnaCnng37970D [Brassica napus]
Length=762

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 24/160 (15%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPS-----AAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENS  151
            FGN+  + PG+FPLN       AAP+  +L  +D +S QYK N+HL+SLQQ      +NS
Sbjct  613  FGNSNNVGPGNFPLNQQQQQQQAAPTGATLSYEDIMSLQYKQNNHLLSLQQQQQQQNDNS  672

Query  152  GMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
             +W+HG GS+TMS   +N YY++QAQ Q     +  Q+  Q Y SLGY PN+Y SQTG+S
Sbjct  673  PLWVHGPGSQTMSGVQSNAYYSLQAQQQAQQLRQAQQEAQQQYGSLGY-PNYYQSQTGMS  731

Query  332  LDHHHQQQNPRDGPLgggggNAQVQPKPSSQQ--LWQNSY  445
            ++  HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  732  ME--HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  762



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 96/161 (60%), Gaps = 30/161 (19%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV------ENSGMWL  163
            FGN+  +   G+FPLN  +AP+   G +D LSSQYK+N +L++LQQ       +NS MW 
Sbjct  714  FGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQYKENSNLLALQQQQQQQQNDNSAMWH  770

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPSQNYASLGYNPNFYHSQTG  325
            HGHGSRTMS  PAN Y+N+Q Q Q         G+RQ QQ  Q Y S GY PNFY SQT 
Sbjct  771  HGHGSRTMSGVPANAYFNLQQQQQLQQAQQAAGGYRQAQQ-QQQYGSHGY-PNFYQSQT-  827

Query  326  ISLDHHHQQQNPRDGPLgggggNAQVQPK-PSSQQLWQNSY  445
              + H  QQQNPRD         A  QP   + QQLWQNSY
Sbjct  828  -EMPHERQQQNPRDA--------AGAQPSNQTQQQLWQNSY  859



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 13/151 (9%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN--PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GH  172
            G  GN+  IPG F LN   S + ST+ G D+ LS Q K+  H M  QQ EN  +WLH   
Sbjct  745  GGLGNSANIPGGFALNHHTSGSASTTTGFDESLSLQNKEESHYMPPQQSENPNLWLHSAA  804

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            GSR M A PA+T+YN Q Q+QQ SGFRQ  Q S +  +LGY PN YHS  G+S +H   Q
Sbjct  805  GSRAMPALPASTFYNYQGQSQQ-SGFRQSPQAS-HLGALGY-PNLYHSPAGLSREH---Q  858

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            QN  +G L  G    Q  P   + Q+WQ+ Y
Sbjct  859  QNTGEGNL-NGPPTTQAHP---ANQIWQHGY  885



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 13/151 (9%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN--PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GH  172
            G  GN+  IPG F LN   S + ST+ G D+ LS Q K+  H M  QQ EN  +WLH   
Sbjct  746  GGLGNSANIPGGFALNHHTSGSASTTTGFDESLSLQNKEESHYMPPQQSENPNLWLHSAA  805

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            GSR M A PA+T+YN Q Q+QQ SGFRQ  Q S +  +LGY PN YHS  G+S +H   Q
Sbjct  806  GSRAMPALPASTFYNYQGQSQQ-SGFRQSPQAS-HLGALGY-PNLYHSPAGLSREH---Q  859

Query  353  QNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            QN  +G L  G    Q  P   + Q+WQ+ Y
Sbjct  860  QNTGEGNL-NGPPTTQAHP---ANQIWQHGY  886



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 99/160 (62%), Gaps = 26/160 (16%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL-  163
            FGN+  +  G++PLN  AAPS T+LG +D LSSQYK+++HL+SLQQ      ENSGMW+ 
Sbjct  685  FGNSSNVGIGNYPLNQPAAPSGTTLGYEDVLSSQYKESNHLLSLQQQQQQQNENSGMWIH  744

Query  164  HGHGSRTMSAAPANTYYN---IQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGI  328
            HG  SRTM A P+NTYYN    Q   Q  SG+R    QQ   +Y SLGY PNFY SQTG+
Sbjct  745  HGSASRTMPAVPSNTYYNHLQAQQNQQASSGYRQAASQQQQHHYGSLGY-PNFYQSQTGM  803

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQP-KPSSQQLWQNSY  445
                  +QQN   GP        Q QP K + QQ+W NSY
Sbjct  804  MA---MEQQNRDGGP--------QGQPSKQNQQQMWPNSY  832



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FGN+  +PG+F LN S   +++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR
Sbjct  705  GGFGNSSNLPGNFALNQSTGSASTLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSR  764

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASLGYNPNFYHSQTGIS  331
              SA P   +Y  Q Q+Q   GFRQ QQP    +   GY P FY SQ G++
Sbjct  765  ATSALPQGHFYGFQGQSQL-GGFRQAQQPQPSQFGGHGY-PTFYQSQGGLT  813



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FGN+  +PG+F LN S   +++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR
Sbjct  706  GGFGNSSNLPGNFALNQSTGSASTLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSR  765

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASLGYNPNFYHSQTGIS  331
              SA P   +Y  Q Q+Q   GFRQ QQP    +   GY P FY SQ G++
Sbjct  766  ATSALPQGHFYGFQGQSQL-GGFRQAQQPQPSQFGGHGY-PTFYQSQGGLT  814



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 97/160 (61%), Gaps = 24/160 (15%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPS-AAPS-TSLGIDDGLSSQYKDNHHLMSLQQV---------ENS  151
            FGN+  +  G+F LN   AAP+ T+L  +D +S QYK N HL+SLQQ          ENS
Sbjct  670  FGNSSNVGAGNFSLNQQQAAPTGTTLSYEDVMSLQYKQNSHLLSLQQQQQQQQQQQNENS  729

Query  152  GMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGIS  331
             +WLHG GS+TMS   +N YYN+QAQ Q     +  QQ    Y SLGY PN+Y SQTG+S
Sbjct  730  PVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQHQYGSLGY-PNYYQSQTGMS  788

Query  332  LDHHHQQQNPRDGPLgggggNAQVQPKPSS--QQLWQNSY  445
            ++  HQQ+NPR+G        +Q QP   +  Q LWQNSY
Sbjct  789  ME--HQQRNPREG-------GSQGQPSKQTPQQHLWQNSY  819



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 77/138 (56%), Gaps = 10/138 (7%)
 Frame = +2

Query  26   IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  205
            I G+F LN S   +++LG D+ LS QYKD    M+LQQ +NSGMWLHG GSR  S  P N
Sbjct  723  IQGNFTLNQSTGSASTLGFDEALSRQYKDTSQYMALQQGDNSGMWLHGSGSRATSTLPPN  782

Query  206  TYYNIQAQNQQPSGFRQVQQPS-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  382
             +Y  Q Q+Q   GFRQ QQP    +   GY P FY SQ G++ +H    QN  +G L  
Sbjct  783  HFYGYQGQSQL-GGFRQAQQPQPSQFGGHGY-PTFYQSQGGLTQEH---PQNLAEGSL--  835

Query  383  gggNAQVQPKPSSQQLWQ  436
                 QV P   S   WQ
Sbjct  836  --NGFQVAPSQPSHPNWQ  851



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 87/146 (60%), Gaps = 32/146 (22%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------EN  148
            FGN+  +   G+FPLN  SA   T+LG +D LSSQYK+NH L++LQQ           EN
Sbjct  668  FGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNEN  726

Query  149  SGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------------GFRQVQQPSQNYAS  286
            S MW  GHGSRTMS  P NTYYN+QAQ Q                 G+RQ QQ  Q+Y S
Sbjct  727  SAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGS  785

Query  287  LGYNPNFYHSQTGISLDHHHQQQNPR  364
             GY PN+Y SQT +SL+   QQQNPR
Sbjct  786  HGY-PNYYQSQTEMSLE--RQQQNPR  808



>gb|EMS63247.1| hypothetical protein TRIUR3_29233 [Triticum urartu]
Length=823

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSR  181
            FG++  +PG+F LN +AAP S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSR
Sbjct  698  FGSSSNLPGNFALNQNAAPPSANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSR  757

Query  182  TMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            T SA P   +Y  Q Q+QQ   FR  Q  Q    Y   GY P FYHSQ G++ +HH   Q
Sbjct  758  TASALPPTQFYGYQGQSQQQGAFRQAQQPQQPSQYGGHGY-PAFYHSQGGMAQEHH--PQ  814

Query  356  NPRDGPL  376
            NP DG L
Sbjct  815  NPADGAL  821



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSR  181
            FG++  +PG+F LN +AAP S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSR
Sbjct  720  FGSSSNLPGNFALNQNAAPASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSR  779

Query  182  TMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            T SA P   +Y  Q Q+QQ   FR  Q  Q    Y   GY P FYH+Q G++ +HH   Q
Sbjct  780  TASALPPTQFYGYQGQSQQQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQEHH--PQ  836

Query  356  NPRDGPL  376
            NP DG L
Sbjct  837  NPADGTL  843



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 88/154 (57%), Gaps = 19/154 (12%)
 Frame = +2

Query  5    AFGNTGTIPGSFPLNPSAAPSTS-LGIDDGLSSQYKD---NHHLMSLQQVENSGMWLHGH  172
            + GN+  IPGSF  N SA P+ S +G DD L SQY+D   N +L  LQQ + S +W + H
Sbjct  732  SLGNSTDIPGSFLHNLSAGPAGSKVGYDDFLRSQYRDGGANFNL--LQQNDGSAVWDYVH  789

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            GSRT S  P + YY++Q QN Q +G+ Q Q+ SQ +  LGY P  Y+SQ GI+     QQ
Sbjct  790  GSRTTSTIPHSAYYSLQGQNHQLAGYHQGQRHSQLHGFLGY-PGVYNSQAGIT--REQQQ  846

Query  353  QNPRDGPLgggggNAQVQPKPSSQQL---WQNSY  445
            QN  D  L G          PSS+QL   WQ  Y
Sbjct  847  QNLGDVILNGSQS-------PSSKQLPQNWQRRY  873



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 97/162 (60%), Gaps = 26/162 (16%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLNPS----AAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--------E  145
            FGN+  +  G+F LN      AAP+  +L  +D +S QYK N HL+SLQQ         E
Sbjct  679  FGNSSNVGTGNFSLNQQQQQQAAPTGATLSYEDVMSLQYKQNSHLLSLQQQQQQQQQQNE  738

Query  146  NSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTG  325
            NS +WLHG GS+TMS   +N YYN+QAQ Q     +  QQ  Q Y SLGY PN+Y SQTG
Sbjct  739  NSPVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQQQYGSLGY-PNYYQSQTG  797

Query  326  ISLDHHHQQQNPRDGPLgggggNAQVQPKPSS--QQLWQNSY  445
            +S++  +QQ+NPR+G        +Q QP   +  Q LWQNSY
Sbjct  798  MSME--YQQRNPREG-------GSQGQPSKQTPQQHLWQNSY  830



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 80/127 (63%), Gaps = 7/127 (6%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSR  181
            FG++  +PG+F LN +AAP S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSR
Sbjct  720  FGSSSNLPGNFALNQNAAPASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSR  779

Query  182  TMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            T SA P   +Y  Q Q+QQ   FR  Q  Q    Y   GY P FYH+Q G++  HH   Q
Sbjct  780  TASALPPTQFYGYQGQSQQQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQGHH--PQ  836

Query  356  NPRDGPL  376
            NP DG L
Sbjct  837  NPADGTL  843



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +2

Query  8    FGNTG-TIPGSFPLNPS--AAPST-SLGIDDGLSSQYKDNHHLMSLQQVE-----NSGMW  160
            FGN+   + G+FPLN    AAP+  +L  +D L+ QYK N+HL+SLQQ +     N  +W
Sbjct  685  FGNSSNVVAGNFPLNQQQQAAPTGGTLSYEDVLNLQYKQNNHLLSLQQQQQHQQQNEPVW  744

Query  161  LHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDH  340
            LHG GS+TMS   +NTYYN+QAQ Q     +  QQ  Q Y SLGY PN+Y  QTG+S++ 
Sbjct  745  LHGPGSQTMSGVTSNTYYNLQAQQQAQQLRQAQQQAQQQYGSLGY-PNYYQPQTGMSME-  802

Query  341  HHQQQNPRDG  370
             HQQQNPRDG
Sbjct  803  -HQQQNPRDG  811



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 99/164 (60%), Gaps = 29/164 (18%)
 Frame = +2

Query  8    FGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----ENSGMWLHG  169
            FGN+  +   G+FP+N   +  T  G +D LSSQYK+++HL++LQ      ENS MW HG
Sbjct  670  FGNSTNVGSAGNFPINQQQSAPT--GYEDVLSSQYKESNHLLALQHQQQQNENSAMWHHG  727

Query  170  HGSRTMSAAPANTYYNIQAQNQQPS--------GFR-QVQQPSQNYASLGYNPNFYHSQT  322
            HGSRTMS  PANTYYN+QAQ QQ          G+R   QQ  Q Y S GY PNFY SQT
Sbjct  728  HGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQSQT  786

Query  323  GISLDHHHQQQNPRDGPLgggggNAQV---QPKPSSQQLWQNSY  445
             +SL+   QQQNPRDG        AQV       + QQLWQNSY
Sbjct  787  EMSLE--RQQQNPRDG------AGAQVGQQTSDQTQQQLWQNSY  822



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 98/166 (59%), Gaps = 31/166 (19%)
 Frame = +2

Query  8    FGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL  163
            FGN  T  GS   FPLN   +  T  G +D LSSQYK+++HL++LQ       ENS MW 
Sbjct  668  FGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQYKESNHLLALQHQQQQQNENSAMWH  725

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS--------GFR-QVQQPSQNYASLGYNPNFYHS  316
            HGHGSRTMS  PANTYYN+QAQ QQ          G+R   QQ  Q Y S GY PNFY S
Sbjct  726  HGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQS  784

Query  317  QTGISLDHHHQQQNPRDGPLgggggNAQV---QPKPSSQQLWQNSY  445
            QT +SL+   QQQNPRDG        AQV       + QQLWQNSY
Sbjct  785  QTEMSLE--RQQQNPRDG------AGAQVGQQPSDQTQQQLWQNSY  822



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 98/166 (59%), Gaps = 31/166 (19%)
 Frame = +2

Query  8    FGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL  163
            FGN  T  GS   FPLN   +  T  G +D LSSQYK+++HL++LQ       ENS MW 
Sbjct  669  FGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQYKESNHLLALQHQQQQQNENSAMWH  726

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS--------GFR-QVQQPSQNYASLGYNPNFYHS  316
            HGHGSRTMS  PANTYYN+QAQ QQ          G+R   QQ  Q Y S GY PNFY S
Sbjct  727  HGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQS  785

Query  317  QTGISLDHHHQQQNPRDGPLgggggNAQV---QPKPSSQQLWQNSY  445
            QT +SL+   QQQNPRDG        AQV       + QQLWQNSY
Sbjct  786  QTEMSLE--RQQQNPRDG------AGAQVGQQPSDQTQQQLWQNSY  823



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 98/166 (59%), Gaps = 31/166 (19%)
 Frame = +2

Query  8    FGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL  163
            FGN  T  GS   FPLN   +  T  G +D LSSQYK+++HL++LQ       ENS MW 
Sbjct  668  FGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQYKESNHLLALQHQQQQQNENSAMWH  725

Query  164  HGHGSRTMSAAPANTYYNIQAQNQQPS--------GFR-QVQQPSQNYASLGYNPNFYHS  316
            HGHGSRTMS  PANTYYN+QAQ QQ          G+R   QQ  Q Y S GY PNFY S
Sbjct  726  HGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQS  784

Query  317  QTGISLDHHHQQQNPRDGPLgggggNAQV---QPKPSSQQLWQNSY  445
            QT +SL+   QQQNPRDG        AQV       + QQLWQNSY
Sbjct  785  QTEMSLE--RQQQNPRDG------AGAQVGQQPSDQTQQQLWQNSY  822



>emb|CDY11787.1| BnaC03g57910D [Brassica napus]
Length=737

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 83/134 (62%), Gaps = 25/134 (19%)
 Frame = +2

Query  92   LSSQYKDNHHLMSLQ----QVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  244
            LSS++  ++H+++LQ    Q ENS MW HGHGSRTMS  PANT+YN+QAQ QQ       
Sbjct  613  LSSKHTRSNHVLALQHQQQQNENSAMWHHGHGSRTMSGVPANTHYNLQAQQQQQLQQTQQ  672

Query  245  ----GFR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggggNAQV--  403
                G+R   QQ  Q Y S GY+ NFY  QT +SL+   QQQNPRDG        AQV  
Sbjct  673  AAAVGYRQAQQQQQQRYGSYGYS-NFYQFQTEMSLE--RQQQNPRDG------AGAQVGQ  723

Query  404  QPKPSSQQLWQNSY  445
            QP   +QQLWQNSY
Sbjct  724  QPSDQTQQLWQNSY  737



>gb|ACF86865.1| unknown [Zea mays]
Length=564

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S AA +T+LG D  + S +KD +  +SLQQ EN  MW+HG  S
Sbjct  436  GGFGTASNMPGNFPLNQSTAAATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASS  495

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  496  RGMPPLAASTMYGYQGQSHQ-AGLRQGQLPSQFGSALG------QSQPGLGPEH----RN  544

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W N+Y
Sbjct  545  PSDSNLSGAAQ---------ANQMWPNTY  564



>ref|XP_002440322.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
 gb|EES18752.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
Length=649

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S  + +T+LG D  + S +KD +  +SLQQ EN  MW+HG GS
Sbjct  521  GGFGTANNMPGNFPLNQSTTSATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGAGS  580

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  581  RGMPPLAASTMYGYQGQSHQ-AGLRQGQLPSQFGSALG------QSQPGLGPEH----RN  629

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  630  PSDSNLSGAAQ---------ANQMWPNSY  649



>ref|NP_001141689.1| uncharacterized protein LOC100273818 [Zea mays]
 gb|ACN27855.1| unknown [Zea mays]
 gb|ACN28046.1| unknown [Zea mays]
 gb|AFW79333.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S AA +T+LG D  + S +KD +  +SLQQ EN  MW+HG  S
Sbjct  699  GGFGTASNMPGNFPLNQSTAAATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASS  758

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  759  RGMPPLAASTMYGYQGQSHQ-AGLRQGQLPSQFGSALG------QSQPGLGPEH----RN  807

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W N+Y
Sbjct  808  PSDSNLSGAAQ---------ANQMWPNTY  827



>ref|XP_008647566.1| PREDICTED: uncharacterized protein LOC100273818 isoform X1 [Zea 
mays]
Length=828

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S AA +T+LG D  + S +KD +  +SLQQ EN  MW+HG  S
Sbjct  700  GGFGTASNMPGNFPLNQSTAAATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASS  759

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  760  RGMPPLAASTMYGYQGQSHQ-AGLRQGQLPSQFGSALG------QSQPGLGPEH----RN  808

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W N+Y
Sbjct  809  PSDSNLSGAAQ---------ANQMWPNTY  828



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 8/130 (6%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKD-NHHLMSLQQV-ENSGMWLHGH  172
            G FG++  +P +F LN +A + ST+ G D+ L +QYKD N ++ +LQQ  +NS MWLHG 
Sbjct  712  GGFGSSSNLPANFNLNQNATSASTNAGFDEALGAQYKDANQYMAALQQQGDNSAMWLHGA  771

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN--PNFYHSQTGISLDHHH  346
            GSRT +A P   +Y  Q Q+QQ    RQ QQ  Q  +  G +  P FYHSQ+G++ +HH 
Sbjct  772  GSRTAAALPPTQFYGYQGQSQQ-GALRQAQQQPQQPSQFGGHGYPAFYHSQSGMTQEHH-  829

Query  347  QQQNPRDGPL  376
              QNP +  L
Sbjct  830  -PQNPSEASL  838



>ref|XP_008654851.1| PREDICTED: uncharacterized protein LOC100280182 isoform X1 [Zea 
mays]
 gb|AFW81249.1| putative DUF1296 domain containing family protein [Zea mays]
Length=826

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  698  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  757

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  758  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  806

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  807  PSDSNLSGAAQ---------ANQMWPNSY  826



>gb|AFW81250.1| putative DUF1296 domain containing family protein [Zea mays]
Length=787

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  659  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  718

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  719  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  767

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  768  PSDSNLSGAAQ---------ANQMWPNSY  787



>ref|XP_008654854.1| PREDICTED: uncharacterized protein LOC100280182 isoform X4 [Zea 
mays]
Length=791

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  663  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  722

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  723  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  771

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  772  PSDSNLSGAAQ---------ANQMWPNSY  791



>gb|AFW81248.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  699  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  758

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  759  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  807

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  808  PSDSNLSGAAQ---------ANQMWPNSY  827



>ref|XP_008654853.1| PREDICTED: uncharacterized protein LOC100280182 isoform X3 [Zea 
mays]
Length=792

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  664  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  723

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  724  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  772

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  773  PSDSNLSGAAQ---------ANQMWPNSY  792



>ref|NP_001146586.1| uncharacterized protein LOC100280182 [Zea mays]
 gb|ACL54332.1| unknown [Zea mays]
Length=827

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  699  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  758

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  759  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  807

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  808  PSDSNLSGAAQ---------ANQMWPNSY  827



>ref|XP_008654852.1| PREDICTED: uncharacterized protein LOC100280182 isoform X2 [Zea 
mays]
Length=823

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  695  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  754

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  755  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  803

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  804  PSDSNLSGAAQ---------ANQMWPNSY  823



>gb|AFW81251.1| putative DUF1296 domain containing family protein [Zea mays]
Length=847

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 77/149 (52%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPST-SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG+FPLN S   +T +LG D  + S  +D +  + LQQ EN  MW+HG GS
Sbjct  719  GGFGTANNMPGNFPLNQSTTSATATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGS  778

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    A+T Y  Q Q+ Q +G RQ Q PSQ  ++LG       SQ G+  +H    +N
Sbjct  779  RGMPPLAASTMYGYQGQSHQ-TGLRQGQLPSQYGSALG------QSQPGLGPEH----RN  827

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L G            + Q+W NSY
Sbjct  828  PSDSNLSGAAQ---------ANQMWPNSY  847



>ref|XP_006654843.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=807

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 78/149 (52%), Gaps = 18/149 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG   ++PG+F LN S A +T+  G D  + +QYK+ +H +SLQQ EN  MW+HG GS
Sbjct  676  GGFGAASSMPGNFALNQSTASATAAPGFDGTVPAQYKEGNHFVSLQQSENPAMWMHGAGS  735

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM    AN  Y  Q Q     G RQ Q PSQ  A+LG       SQ G+     H+ +N
Sbjct  736  RTMPPLAANALYGYQGQQGHQGGLRQGQLPSQFGAALG------QSQPGLG----HEHRN  785

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG       N        + Q+W NSY
Sbjct  786  PSDG-------NLSAAAAAQANQMWPNSY  807



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 68/120 (57%), Gaps = 6/120 (5%)
 Frame = +2

Query  2    GAFGNTGTIPGSF-PLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G +G    +PGS+  ++PS     + G DD    QYKD  H   LQQ  NS  W  G GS
Sbjct  688  GNYGMPSNVPGSYLQISPSPPMIPNSGYDDLFHRQYKDRDHFTPLQQ--NSSSWNQGPGS  745

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R + +A    YYN+  QNQQ SG+RQ  QPSQ Y  L Y+ N Y SQTG++ +  HQQ N
Sbjct  746  RKLPSAEEIAYYNLHGQNQQYSGYRQDHQPSQYYGGLEYS-NPYRSQTGMARE--HQQHN  802



>ref|XP_006654800.1| PREDICTED: uncharacterized protein LOC102700994 [Oryza brachyantha]
Length=815

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 82/137 (60%), Gaps = 9/137 (7%)
 Frame = +2

Query  32   GSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANT  208
            G+F LN +AA  ST+LG D+ LS+ YKD +  M+LQQ +NS MWLHG GSR  SA P + 
Sbjct  681  GNFNLNQNAASASTNLGFDEALSTPYKDPNQYMALQQGDNSAMWLHGAGSRATSAVPPSH  740

Query  209  YYNIQAQNQQPSG-FRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
            +Y  Q Q+QQ      Q  Q    +   GY P FYHSQ+G++ +HH   QNP +G    G
Sbjct  741  FYGFQGQSQQGGFRQAQQPQQHSQFGGHGY-PAFYHSQSGLTQEHH---QNPAEGGGLNG  796

Query  386  ggNAQVQPKPSSQQLWQ  436
              +AQ QP   S Q WQ
Sbjct  797  FQSAQSQP---SHQGWQ  810



>ref|XP_004961107.1| PREDICTED: uncharacterized protein LOC101764022 isoform X2 [Setaria 
italica]
Length=793

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHG  175
            G FG    +PG+FP+N S A+ +T+LG D  +   YK+ +  +SLQQ  EN  MW+HG G
Sbjct  665  GGFGTANNMPGNFPVNQSTASATTTLGFDGSVPPHYKEGNQFISLQQQNENPAMWMHGAG  724

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SR M    A+T Y  Q Q+ Q +G RQ Q PSQ   +LG       SQ G+  +H    +
Sbjct  725  SRGMPPLAASTLYGYQGQSHQ-AGLRQGQLPSQFGTALG------QSQPGLGPEH----R  773

Query  356  NPRDGPL  376
            NP DG L
Sbjct  774  NPSDGNL  780



>ref|XP_004961106.1| PREDICTED: uncharacterized protein LOC101764022 isoform X1 [Setaria 
italica]
Length=794

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPS-AAPSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHG  175
            G FG    +PG+FP+N S A+ +T+LG D  +   YK+ +  +SLQQ  EN  MW+HG G
Sbjct  666  GGFGTANNMPGNFPVNQSTASATTTLGFDGSVPPHYKEGNQFISLQQQNENPAMWMHGAG  725

Query  176  SRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQ  355
            SR M    A+T Y  Q Q+ Q +G RQ Q PSQ   +LG       SQ G+  +H    +
Sbjct  726  SRGMPPLAASTLYGYQGQSHQ-AGLRQGQLPSQFGTALG------QSQPGLGPEH----R  774

Query  356  NPRDGPL  376
            NP DG L
Sbjct  775  NPSDGNL  781



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 69/124 (56%), Gaps = 17/124 (14%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FG +  + GSF  N SAAP +    DD L ++YKD  HL  L Q            SR
Sbjct  706  GNFGASNNVHGSFLQNASAAPISMSDYDDALRARYKDGSHLTPLHQ-----------SSR  754

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--QNYASLGYNPNFYHSQTGISLDHHH  346
            T+S+ P + Y N+  QNQQ +G+RQ    Q PS  Q+Y S GY P+FY SQ GI+ +HH 
Sbjct  755  TLSSVPDSVYDNLLRQNQQNAGYRQGQAGQMPSQLQHYGSPGY-PDFYPSQMGITQEHHR  813

Query  347  QQQN  358
            Q  N
Sbjct  814  QSLN  817



>ref|NP_001266740.1| uncharacterized protein LOC101027201 [Zea mays]
 gb|ACN30616.1| unknown [Zea mays]
Length=390

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 72/137 (53%), Gaps = 8/137 (6%)
 Frame = +2

Query  26   IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  205
            I G+F LN S    ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N
Sbjct  257  IQGNFTLNQSTGTGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPN  315

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
             +Y  Q Q+Q     +  QQ    +   GY P FY SQ G++ +HH   QN  +G L   
Sbjct  316  HFYGYQGQSQLGGFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSL---  369

Query  386  ggNAQVQPKPSSQQLWQ  436
                QV P   S   WQ
Sbjct  370  -NGFQVAPSQPSHPSWQ  385



>ref|XP_008655403.1| PREDICTED: uncharacterized protein LOC101027201 isoform X2 [Zea 
mays]
Length=836

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 73/137 (53%), Gaps = 8/137 (6%)
 Frame = +2

Query  26   IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  205
            I G+F LN S    ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N
Sbjct  703  IQGNFTLNQSTGTGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPN  761

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
             +Y  Q Q+Q     +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G 
Sbjct  762  HFYGYQGQSQLGGFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF  818

Query  386  ggNAQVQPKPSSQQLWQ  436
                QV P   S   WQ
Sbjct  819  ----QVAPSQPSHPSWQ  831



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 82/155 (53%), Gaps = 37/155 (24%)
 Frame = +2

Query  8    FGNTGTIPGS-FPLNPS--AAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----------  142
            FGN+  +    F LN    AAPS  +L  +D LS QYK N++L+SLQQ            
Sbjct  671  FGNSSNVETENFLLNQQQQAAPSGATLSYEDVLSLQYKQNNYLLSLQQQQQQQLQQQQQQ  730

Query  143  -------------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  265
                               EN  MWLHG GS+TMS    NTYYN+QAQ Q     +  QQ
Sbjct  731  QQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTMSGVAGNTYYNLQAQQQSQQVRQAQQQ  790

Query  266  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  370
              Q Y  LGY PN+Y SQTGIS++  HQQQNPR+G
Sbjct  791  EQQQYGLLGY-PNYYQSQTGISIE--HQQQNPREG  822



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 73/137 (53%), Gaps = 8/137 (6%)
 Frame = +2

Query  26   IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  205
            I G+F LN S    ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N
Sbjct  723  IQGNFTLNQSTGTGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPN  781

Query  206  TYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  385
             +Y  Q Q+Q     +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G 
Sbjct  782  HFYGYQGQSQLGGFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF  838

Query  386  ggNAQVQPKPSSQQLWQ  436
                QV P   S   WQ
Sbjct  839  ----QVAPSQPSHPSWQ  851



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 82/155 (53%), Gaps = 37/155 (24%)
 Frame = +2

Query  8    FGNTGTIPGS-FPLNPS--AAPS-TSLGIDDGLSSQYKDNHHLMSLQQV-----------  142
            FGN+  +    F LN    AAPS  +L  +D LS QYK N++L+SLQQ            
Sbjct  692  FGNSSNVETENFLLNQQQQAAPSGATLSYEDVLSLQYKQNNYLLSLQQQQQQQLQQQQQQ  751

Query  143  -------------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  265
                               EN  MWLHG GS+TMS    NTYYN+QAQ Q     +  QQ
Sbjct  752  QQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTMSGVAGNTYYNLQAQQQSQQVRQAQQQ  811

Query  266  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  370
              Q Y  LGY PN+Y SQTGIS++  HQQQNPR+G
Sbjct  812  EQQQYGLLGY-PNYYQSQTGISIE--HQQQNPREG  843



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 78/140 (56%), Gaps = 25/140 (18%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLN----PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------  142
            FGN+     G++PLN     SA    SL  +D LS QYK N+HL+SLQQ           
Sbjct  689  FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDALSLQYKQNNHLLSLQQQQQLQQQQLQQ  748

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNI-QAQNQQPSGFRQVQQPSQNYASLGYNPNFY  310
               ENS MWLHG GS+TMS  P+NTYYN+   Q  Q     Q Q   Q Y SLGY PN+Y
Sbjct  749  QQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQAQQVRQAQQQAQQQQYGSLGY-PNYY  807

Query  311  HSQTGISLDHHHQQQNPRDG  370
             SQT       HQQQNPRDG
Sbjct  808  QSQT-----MEHQQQNPRDG  822



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 78/140 (56%), Gaps = 25/140 (18%)
 Frame = +2

Query  8    FGNTGTI-PGSFPLN----PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQV----------  142
            FGN+     G++PLN     SA    SL  +D LS QYK N+HL+SLQQ           
Sbjct  687  FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDALSLQYKQNNHLLSLQQQQQLQQQQLQQ  746

Query  143  ---ENSGMWLHGHGSRTMSAAPANTYYNI-QAQNQQPSGFRQVQQPSQNYASLGYNPNFY  310
               ENS MWLHG GS+TMS  P+NTYYN+   Q  Q     Q Q   Q Y SLGY PN+Y
Sbjct  747  QQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQAQQVRQAQQQAQQQQYGSLGY-PNYY  805

Query  311  HSQTGISLDHHHQQQNPRDG  370
             SQT       HQQQNPRDG
Sbjct  806  QSQT-----MEHQQQNPRDG  820



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 3/99 (3%)
 Frame = +2

Query  26   IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  205
            I G+F L+ S   +++LG D+ LS QYK+    M+LQQ +NSGMW+HG GSR  S  P N
Sbjct  721  IQGNFTLSQSTGSASALGFDEALSRQYKNTSQYMALQQGDNSGMWVHGSGSRAASTLPPN  780

Query  206  TYYNIQAQNQQPSGFRQVQQPS-QNYASLGYNPNFYHSQ  319
             +Y  Q Q+Q   GF + QQP    +   GY P  Y SQ
Sbjct  781  HFYGYQGQSQL-GGFARAQQPQPSQFGGHGY-PTVYQSQ  817



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 81/139 (58%), Gaps = 13/139 (9%)
 Frame = +2

Query  26   IPGSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPA  202
            +PG+F LN +AA  ST+LG D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P 
Sbjct  720  LPGNFTLNQNAASASTNLGFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPP  779

Query  203  NTYYNIQAQNQQPSG-FRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  379
            + +Y  Q Q+QQ      Q  Q    +   GY P FYHSQ   S +HH   QNP +G L 
Sbjct  780  SHFYGFQGQSQQGGFRQAQQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-  831

Query  380  ggggNAQVQPKPSSQQLWQ  436
             G  NAQ QP   S Q WQ
Sbjct  832  NGFQNAQSQP---SHQGWQ  847



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 81/139 (58%), Gaps = 13/139 (9%)
 Frame = +2

Query  26   IPGSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPA  202
            +PG+F LN +AA  ST+LG D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P 
Sbjct  720  LPGNFTLNQNAASASTNLGFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPP  779

Query  203  NTYYNIQAQNQQPSG-FRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  379
            + +Y  Q Q+QQ      Q  Q    +   GY P FYHSQ   S +HH   QNP +G L 
Sbjct  780  SHFYGFQGQSQQGGFRQAQQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-  831

Query  380  ggggNAQVQPKPSSQQLWQ  436
             G  NAQ QP   S Q WQ
Sbjct  832  NGFQNAQSQP---SHQGWQ  847



>ref|XP_010230981.1| PREDICTED: uncharacterized protein LOC100825596 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 77/149 (52%), Gaps = 20/149 (13%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG++ LN S+ P+ +  G D  + SQYKD +H +SLQQ EN  MW+HG GS
Sbjct  721  GGFGTANGMPGNYALNQSSVPANAAPGFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGS  780

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    ANT Y  Q Q     G RQ Q PSQ  A+LG       SQ G+  +H    +N
Sbjct  781  RGMPPLAANTLYGYQGQQGHQGGLRQGQLPSQFGAALG------QSQQGLGQEH----RN  830

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L   G          + Q+W NSY
Sbjct  831  PSDSNLSAAGQ---------ANQMWPNSY  850



>ref|XP_003567822.1| PREDICTED: uncharacterized protein LOC100825596 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 77/149 (52%), Gaps = 20/149 (13%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG    +PG++ LN S+ P+ +  G D  + SQYKD +H +SLQQ EN  MW+HG GS
Sbjct  720  GGFGTANGMPGNYALNQSSVPANAAPGFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGS  779

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R M    ANT Y  Q Q     G RQ Q PSQ  A+LG       SQ G+  +H    +N
Sbjct  780  RGMPPLAANTLYGYQGQQGHQGGLRQGQLPSQFGAALG------QSQQGLGQEH----RN  829

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P D  L   G          + Q+W NSY
Sbjct  830  PSDSNLSAAGQ---------ANQMWPNSY  849



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 21/157 (13%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--------ENSGMW  160
            FGN+ ++         AAPS  +L  +D +S QYK N HL+SLQQ         +NS +W
Sbjct  662  FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHNSHLLSLQQQQQQQQHQNDNSPLW  721

Query  161  LHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDH  340
            +HG GS+TMS   +N YYN+QAQ Q     +  QQ  Q + SLGY PN+Y SQTG+S++ 
Sbjct  722  VHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQQQHGSLGY-PNYYQSQTGMSME-  779

Query  341  HHQQQNPRDGPLgggggNAQVQPKPSSQQ--LWQNSY  445
             HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  780  -HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  808



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 21/157 (13%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--------ENSGMW  160
            FGN+ ++         AAPS  +L  +D +S QYK N HL+SLQQ         +NS +W
Sbjct  667  FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHNSHLLSLQQQQQQQQHQNDNSPLW  726

Query  161  LHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDH  340
            +HG GS+TMS   +N YYN+QAQ Q     +  QQ  Q + SLGY PN+Y SQTG+S++ 
Sbjct  727  VHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQQQHGSLGY-PNYYQSQTGMSME-  784

Query  341  HHQQQNPRDGPLgggggNAQVQPKPSSQQ--LWQNSY  445
             HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  785  -HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  813



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 80/155 (52%), Gaps = 27/155 (17%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FG +  + GSF  N SAAP +    DD L ++YKD  HL  L Q            SR
Sbjct  749  GNFGASNNVHGSFLQNASAAPISMSDYDDALRARYKDGSHLTPLHQ-----------SSR  797

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--QNYASLGYNPNFYHSQTGISLDHHH  346
            T+S+ P + Y  +  QNQQ +G++Q    Q PS  Q+Y S GY P+FY SQ GI+ +HH 
Sbjct  798  TLSSIPDSVYNTLLRQNQQNAGYQQGQAGQMPSQLQHYGSPGY-PDFYPSQMGITQEHHR  856

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQ--QLWQNSY  445
            Q  N  D  L      A +Q     Q  Q+WQ +Y
Sbjct  857  QSVN--DLSL------AGIQDLSPQQLHQIWQRTY  883



>gb|EEC79757.1| hypothetical protein OsI_21141 [Oryza sativa Indica Group]
Length=798

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 15/149 (10%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG   ++PG+F LN S   +T+  G D  + +QYK+ +  +SLQQ EN+ MW+HG  S
Sbjct  664  GGFGAASSMPGNFALNQSTPSATAAPGFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASS  723

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM    AN  Y  Q Q     G RQ Q PSQ  A L        +Q G+     H+ +N
Sbjct  724  RTMPPLAANALYGYQGQQGHQGGLRQGQLPSQFGAPLA------PTQPGLG----HEHRN  773

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      A       + Q+W NSY
Sbjct  774  PSDGNLSSAAAAAAA----QANQMWPNSY  798



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 24/153 (16%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +  + G++  N S AP      DD   SQYKD +HL  L Q             R
Sbjct  670  GSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYKDGNHLTPLHQ-----------SPR  716

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--QNYASLGYNPNFYHSQTGISLDHHH  346
            T+S+   + Y N+  QNQQ +G+RQ Q    PS  Q+Y S+GY P++Y+SQ GI+     
Sbjct  717  TLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQHYGSMGY-PDYYNSQMGIT--QER  773

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  774  QRQSLNESPFAPGIPDLSPQ---QLQQIWQRTY  803



>gb|AAT44198.1| unknown protein [Oryza sativa Japonica Group]
Length=860

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 18/149 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG   ++PG+F LN S   +T+  G D  + +QYK+ +  +SLQQ EN+ MW+HG  S
Sbjct  729  GGFGAASSMPGNFALNQSTPSATAAPGFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASS  788

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM    AN  Y  Q Q     G RQ Q PSQ  A L        +Q G+     H+ +N
Sbjct  789  RTMPPLAANALY-YQGQQGHQGGLRQGQLPSQFGAPLA------PTQPGLG----HEHRN  837

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      A       + Q+W NSY
Sbjct  838  PSDGNLSSAAAAA------QANQMWPNSY  860



>gb|EEE64826.1| hypothetical protein OsJ_19683 [Oryza sativa Japonica Group]
Length=853

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 18/149 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG   ++PG+F LN S   +T+  G D  + +QYK+ +  +SLQQ EN+ MW+HG  S
Sbjct  722  GGFGAASSMPGNFALNQSTPSATAAPGFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASS  781

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM    AN  Y  Q Q     G RQ Q PSQ  A L        +Q G+     H+ +N
Sbjct  782  RTMPPLAANALY-YQGQQGHQGGLRQGQLPSQFGAPLA------PTQPGLG----HEHRN  830

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      A       + Q+W NSY
Sbjct  831  PSDGNLSSAAAAA------QANQMWPNSY  853



>ref|NP_001056433.1| Os05g0581800 [Oryza sativa Japonica Group]
 gb|AAU10711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18347.1| Os05g0581800 [Oryza sativa Japonica Group]
Length=852

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 18/149 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G FG   ++PG+F LN S   +T+  G D  + +QYK+ +  +SLQQ EN+ MW+HG  S
Sbjct  721  GGFGAASSMPGNFALNQSTPSATAAPGFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASS  780

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            RTM    AN  Y  Q Q     G RQ Q PSQ  A L        +Q G+     H+ +N
Sbjct  781  RTMPPLAANALY-YQGQQGHQGGLRQGQLPSQFGAPLA------PTQPGLG----HEHRN  829

Query  359  PRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            P DG L      A       + Q+W NSY
Sbjct  830  PSDGNLSSAAAAA------QANQMWPNSY  852



>ref|XP_011467574.1| PREDICTED: uncharacterized protein LOC101307606 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=731

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 24/153 (16%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +  + G++  N S AP      DD   SQYKD +HL  L Q             R
Sbjct  598  GSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYKDGNHLTPLHQ-----------SPR  644

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--QNYASLGYNPNFYHSQTGISLDHHH  346
            T+S+   + Y N+  QNQQ +G+RQ Q    PS  Q+Y S+GY P++Y+SQ GI+     
Sbjct  645  TLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQHYGSMGY-PDYYNSQMGIT--QER  701

Query  347  QQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  702  QRQSLNESPFAPGIPDLSPQQL---QQIWQRTY  731



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +    GSF  N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  672  GSFGASNNNHGSFLHNASATPGSIADYDDVFRPQYKDGNHLTALYQ-----------SSR  720

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P + + N+  QNQQ +G+RQ Q    PSQ  +  G+ P+FYHSQ  ++ +   Q+
Sbjct  721  TLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQLQSYRGH-PDFYHSQVDVTQELQRQR  779

Query  353  QN  358
             N
Sbjct  780  LN  781



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +    GSF  N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  677  GSFGASNNNHGSFLHNASATPGSIADYDDVFRPQYKDGNHLTALYQ-----------SSR  725

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P + + N+  QNQQ +G+RQ Q    PSQ  +  G+ P+FYHSQ  ++ +   Q+
Sbjct  726  TLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQLQSYRGH-PDFYHSQVDVTQELQRQR  784

Query  353  QN  358
             N
Sbjct  785  LN  786



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +    GSF  N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  695  GSFGASNNNHGSFLHNASATPGSIADYDDVFRPQYKDGNHLTALYQ-----------SSR  743

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P + + N+  QNQQ +G+RQ Q    PSQ  +  G+ P+FYHSQ  ++ +   Q+
Sbjct  744  TLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQLQSYRGH-PDFYHSQVDVTQELQRQR  802

Query  353  QN  358
             N
Sbjct  803  LN  804



>ref|XP_008380341.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=799

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G+FG +    GSF  N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  667  GSFGASNNNHGSFLHNASATPGSIADYDDVFRPQYKDGNHLTALYQ-----------SSR  715

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P + + N+  QNQQ +G+RQ Q    PSQ  +  G+ P+FYHSQ  ++ +   Q+
Sbjct  716  TLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQLQSYRGH-PDFYHSQVDVTQELQRQR  774

Query  353  QN  358
             N
Sbjct  775  LN  776



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 83/159 (52%), Gaps = 32/159 (20%)
 Frame = +2

Query  8    FGNTGT-IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGHGS  178
            FG  G+ +  +FPLN ++AP++    +D LSSQ++D++HL S   QQ E+   W  G  S
Sbjct  601  FGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSNHLASSLQQQNEHLAAWHQGQQS  657

Query  179  RTMSAAPANTYYNIQAQNQQPSGFR--------QVQQPSQNYASLGYNPNFYHSQTGISL  334
             +    P + YY+   QNQQP GFR          QQ  Q++    Y  + YHSQ  +SL
Sbjct  658  NSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGHSYG-SHYHSQASMSL  713

Query  335  D--HHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            D  HH QQQN RD              K + QQLW N+Y
Sbjct  714  DHLHHQQQQNARDA------------SKQTHQQLWPNNY  740



>gb|KJB57296.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=677

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVEN  148
            FG++  IPG  PLNP  AP+ T++G DD LSSQYKD++HLMSLQQV N
Sbjct  622  FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDSNHLMSLQQVIN  669



>gb|KDP46910.1| hypothetical protein JCGZ_10401 [Jatropha curcas]
Length=883

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 70/145 (48%), Gaps = 15/145 (10%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGS  178
            G  GN+    GSF  +PSA  + S+ G +D L SQYK+ ++   L Q  +   W +  GS
Sbjct  749  GGLGNSTNFSGSFLNDPSATINRSVVGYNDLLRSQYKEGNNFTMLHQNHSLSSWDYEPGS  808

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQN  358
            R +S  P N YYN Q    QP  ++Q Q  SQNY +       +HSQ  I      QQQN
Sbjct  809  RPLSTVPNNGYYNFQG--GQPPMYQQGQLLSQNYGA-----PVFHSQQRIL--REEQQQN  859

Query  359  PRDGPLgggggNAQVQPKPSSQQLW  433
              D PL    G     P    +QLW
Sbjct  860  LGDLPLSSSQG-----PSKQVRQLW  879



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 80/159 (50%), Gaps = 27/159 (17%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S   QQ +NS  W  G    
Sbjct  651  FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSSLQQQNDNSAAWHQGQQPN  707

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYNPNF--------YHSQTGI  328
            SR +   P + YY+    QNQQP GFRQ QQ  Q   S     +F        YHSQ  +
Sbjct  708  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAM  764

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            SLDH H Q             NA+   K + QQLW N+Y
Sbjct  765  SLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  795



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 80/159 (50%), Gaps = 27/159 (17%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S   QQ +NS  W  G    
Sbjct  650  FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSSLQQQNDNSAAWHQGQQPN  706

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYNPNF--------YHSQTGI  328
            SR +   P + YY+    QNQQP GFRQ QQ  Q   S     +F        YHSQ  +
Sbjct  707  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAM  763

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            SLDH H Q             NA+   K + QQLW N+Y
Sbjct  764  SLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  794



>ref|XP_008342489.1| PREDICTED: uncharacterized protein LOC103405294 [Malus domestica]
Length=843

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FG +    GS   N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  711  GRFGASNNTHGSLLHNASATPGSIPDYDDVFRPQYKDGNHLAALYQ-----------SSR  759

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P   + N+   NQQ +G+RQ Q    P+Q    LG+ P+FY SQ  ++ +H  Q+
Sbjct  760  TLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPTQLQNYLGH-PDFYFSQKDVTQEHQRQR  818

Query  353  QN  358
             N
Sbjct  819  LN  820



>ref|XP_008362365.1| PREDICTED: uncharacterized protein LOC103426056 [Malus domestica]
Length=843

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSR  181
            G FG +    GS   N SA P +    DD    QYKD +HL +L Q            SR
Sbjct  711  GRFGASNNTHGSLLHNASATPGSIPDYDDVFRPQYKDGNHLAALYQ-----------SSR  759

Query  182  TMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQNYASLGYNPNFYHSQTGISLDHHHQQ  352
            T+ + P   + N+   NQQ +G+RQ Q    P+Q    LG+ P+FY SQ  ++ +H  Q+
Sbjct  760  TLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPTQLQNYLGH-PDFYFSQKDVTQEHQRQR  818

Query  353  QN  358
             N
Sbjct  819  LN  820



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 80/159 (50%), Gaps = 27/159 (17%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S   QQ +NS  W  G    
Sbjct  655  FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSSLQQQNDNSAAWHQGQQPN  711

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYNPNF--------YHSQTGI  328
            SR +   P + YY+    QNQQP GFRQ QQ  Q   S     +F        YHSQ  +
Sbjct  712  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAM  768

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            SLDH H Q             NA+   K + QQLW N+Y
Sbjct  769  SLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  799



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 80/159 (50%), Gaps = 27/159 (17%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S   QQ +NS  W  G    
Sbjct  654  FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSSLQQQNDNSAAWHQGQQPN  710

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYNPNF--------YHSQTGI  328
            SR +   P + YY+    QNQQP GFRQ QQ  Q   S     +F        YHSQ  +
Sbjct  711  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAM  767

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            SLDH H Q             NA+   K + QQLW N+Y
Sbjct  768  SLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  798



>dbj|BAJ94362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 72/159 (45%), Gaps = 30/159 (19%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGH  172
            G FG    +P +F LN   PSA  +T+ G D  + SQYKD +  +SLQQ EN  MW+HG 
Sbjct  706  GGFGTANGMPQNFALNQSNPSA--TTAPGFDGTMPSQYKDGNPYISLQQGENPAMWMHGA  763

Query  173  GSRTMSAAPANTY--------YNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGI  328
            GSR M    AN               Q     G RQ Q PSQ  A+LG       SQ G+
Sbjct  764  GSRGMPPLAANPLYGYQGQQQGYQGQQQGHQGGLRQGQMPSQYGAALG------QSQPGL  817

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              +H    +NP DG       N        + Q+W N Y
Sbjct  818  GPEH----RNPSDG-------NLSAAAAAQANQMWPNGY  845



>dbj|BAK03133.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 72/159 (45%), Gaps = 30/159 (19%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGH  172
            G FG    +P +F LN   PSA  +T+ G D  + SQYKD +  +SLQQ EN  MW+HG 
Sbjct  399  GGFGTANGMPQNFALNQSNPSA--TTAPGFDGTMPSQYKDGNPYISLQQGENPAMWMHGA  456

Query  173  GSRTMSAAPANTY--------YNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGI  328
            GSR M    AN               Q     G RQ Q PSQ  A+LG       SQ G+
Sbjct  457  GSRGMPPLAANPLYGYQGQQQGYQGQQQGHQGGLRQGQMPSQYGAALG------QSQPGL  510

Query  329  SLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              +H    +NP DG       N        + Q+W N Y
Sbjct  511  GPEH----RNPSDG-------NLSAAAAAQANQMWPNGY  538



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 76/159 (48%), Gaps = 42/159 (26%)
 Frame = +2

Query  8    FGNTGTIP-GSFPLNPS-AAP-STSLGIDDGLSSQYKDNHHLMSLQQV------------  142
             GN+  +  G+F LN    AP   +   +D LS QYK N++L+ LQQ             
Sbjct  688  VGNSSNVEAGNFLLNQQQVAPIGATFSYEDALSLQYKQNNYLLYLQQQQHQQQQQQQQQQ  747

Query  143  ---------------------ENSGMWLHGHGSRTMSAAPANTYYNIQ---AQNQQPSGF  250
                                 EN  MWL+G GS+TMS  P+NTYYN++      Q     
Sbjct  748  QQQQQQQQQQQQQQQQQQQQNENFPMWLNGPGSQTMSGVPSNTYYNLEAQQQSQQVRQAQ  807

Query  251  RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRD  367
            +Q QQ  Q     GY PN+Y SQTG+S++   QQQNPRD
Sbjct  808  QQAQQAQQAQQQYGY-PNYYQSQTGMSME--QQQQNPRD  843



>ref|XP_002870069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=802

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 80/163 (49%), Gaps = 32/163 (20%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP++A ++    +D LSSQ+ D +HL S   QQ ENS  W  G    
Sbjct  655  FGGGAASSNNFPLNPTSAANS---YEDVLSSQFNDGNHLASSLQQQNENSAAWHQGQQPN  711

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFR------------QVQQPSQNYASLGYNPNFYHS  316
            SR +   P + YY+    QNQQP GFR            Q QQ  Q+Y   GY  + YHS
Sbjct  712  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQPSQQQQQQQHYGGHGY-VSPYHS  767

Query  317  QTGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            Q  +SL+H H Q             NA+   K + QQLW N+Y
Sbjct  768  QAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPNNY  802



>ref|XP_010434571.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X3 [Camelina sativa]
Length=798

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 80/162 (49%), Gaps = 31/162 (19%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D LSSQ+KD++HL S   QQ +NS  W  G    
Sbjct  652  FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSSLQQQNDNSAAWHQGQQPN  708

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQPSQNYASLGYNPNFYHSQ  319
            SR +   P + YY+    QNQQP GFR             QQ  Q++   GY  + YHSQ
Sbjct  709  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQQQQHFGGHGYV-SPYHSQ  764

Query  320  TGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  765  GAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  798



>ref|XP_010434569.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X1 [Camelina sativa]
 ref|XP_010434570.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=799

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 80/162 (49%), Gaps = 31/162 (19%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--G  175
            FG       +FPLNP+ A ++    +D LSSQ+KD++HL S   QQ +NS  W  G    
Sbjct  653  FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSSLQQQNDNSAAWHQGQQPN  709

Query  176  SRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQPSQNYASLGYNPNFYHSQ  319
            SR +   P + YY+    QNQQP GFR             QQ  Q++   GY  + YHSQ
Sbjct  710  SRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQQQQHFGGHGYV-SPYHSQ  765

Query  320  TGISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
              +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  766  GAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  799



>gb|KHN22963.1| hypothetical protein glysoja_030633 [Glycine soja]
Length=980

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +2

Query  8    FGNTGTIPG-SFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH  166
            FG++ +IPG SF LNP AAP+ T++G +D ++SQ+KDN+H+MSLQQ   +   +H
Sbjct  655  FGSSTSIPGGSFSLNPPAAPTGTTIGYEDVINSQFKDNNHMMSLQQFTCTTSSIH  709



>ref|XP_006414144.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
 gb|ESQ55597.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
Length=799

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 79/160 (49%), Gaps = 24/160 (15%)
 Frame = +2

Query  8    FGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHL-MSLQQV-ENSGMWLHGHGSR  181
            FG       +FPL P+ + ++    +D LSSQ+KD +HL +SLQQ  ENS  W  G  S 
Sbjct  650  FGGGAPSSNNFPLTPTTSANS---YEDVLSSQFKDRNHLALSLQQQNENSAAWHQGQQSN  706

Query  182  TMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQPSQNYASLGYNPNFYHSQTG  325
            +    P + YY+    Q+QQP GFR             QQ  Q++   GY  + YHSQ  
Sbjct  707  SR-VVPGSGYYSFPGHQSQQPPGFRQAQQLQQQQQPSQQQQQQHFGGHGY-ASPYHSQAA  764

Query  326  ISLDHHHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            +SL+H H Q             NA+   K + QQLW N+Y
Sbjct  765  MSLEHLHHQHQ-----HQQQQQNARDASKQTQQQLWPNNY  799



>ref|XP_009377414.1| PREDICTED: uncharacterized protein LOC103966021 [Pyrus x bretschneideri]
Length=822

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 19/121 (16%)
 Frame = +2

Query  5    AFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRT  184
            +FG +    GS   N SA P +    DD    QYKD +HL +L Q            SRT
Sbjct  691  SFGASNNTHGSLLHNASATPGSIPDYDDVFRPQYKDGNHLATLYQ-----------SSRT  739

Query  185  MSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--QNYASLGYNPNFYHSQTGISLDHHHQ  349
            + + P + + N+   NQQ +G+RQ    Q P+  QNY     +P+FY SQ  ++ +H  Q
Sbjct  740  LPSVPDSAFNNLLGHNQQHAGYRQGRAGQLPTKLQNYRG---HPDFYFSQKDVTQEHQRQ  796

Query  350  Q  352
            +
Sbjct  797  R  797



>ref|XP_009131438.1| PREDICTED: flocculation protein FLO11 [Brassica rapa]
Length=780

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 78/161 (48%), Gaps = 32/161 (20%)
 Frame = +2

Query  8    FGNTGT-IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGHGS  178
            FG  G+ +  +FPLN ++AP++    +D LSSQ++D+ HL S   QQ E+   W  G  S
Sbjct  637  FGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQQQNEHLAAWHQGQQS  693

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNF--------YHSQTGISL  334
             +    P + YY+   QNQQP GFRQ Q   Q         +F        YHSQ  +SL
Sbjct  694  NSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQQHFGGHGYGSPYHSQAPMSL  750

Query  335  DH----HHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            DH    H QQQN RD                  QQLW N+Y
Sbjct  751  DHLHHQHQQQQNARDASKQTHQ-----------QQLWPNNY  780



>ref|XP_008779718.1| PREDICTED: uncharacterized protein LOC103699456 [Phoenix dactylifera]
Length=147

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 44/87 (51%), Gaps = 2/87 (2%)
 Frame = +2

Query  14   NTGTIPGSFPLNPSAA-PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMS  190
            N+  IPGS+   PS    S  +G    L SQ++  +  +   Q EN+  W HG   RT +
Sbjct  38   NSANIPGSYREAPSTVFASRRVGYGGALGSQFRGVNRFLPPHQGENAPTWDHGASRRTAT  97

Query  191  AAPANTYYNIQAQNQQPSGFRQVQQPS  271
            A P  T ++ Q +NQ     R+ QQPS
Sbjct  98   ALPGRTSFSFQGRNQHRR-VREGQQPS  123



>gb|KJB75412.1| hypothetical protein B456_012G040900 [Gossypium raimondii]
Length=860

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  5    AFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKD---NHHLMSLQQVENSGMWLHGH  172
            +  N+   PGSF  +  A +  + +  DD L SQY +   N +L  LQQ + S  W + H
Sbjct  715  SLENSSGSPGSFLHDLLADSAGSKVAYDDFLCSQYSNGGANFNL--LQQNDGSATWDYRH  772

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGF-RQVQQPSQNYASLGYNPNFYHSQTGISLD  337
            GSRT S  P N YY++  QN Q +G+ +  Q   Q + +LGY P+ Y+S   ++++
Sbjct  773  GSRTTSTIPDNAYYSLNGQNPQHAGYQQAQQLAQQLHEALGY-PSIYNSHAAMAIE  827



>emb|CDX78828.1| BnaA01g08950D [Brassica napus]
Length=698

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 81/161 (50%), Gaps = 33/161 (20%)
 Frame = +2

Query  8    FGNTGT-IPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMSL--QQVENSGMWLHGHGS  178
            FG  G+ +  +FPLN ++AP++    +D LSSQ++D+ HL S   QQ E+   W  G  S
Sbjct  556  FGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQQQNEHLAAWHQGQQS  612

Query  179  RTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ--------NYASLGYNPNFYHSQTGISL  334
             +    P + YY+   QNQQP GFRQ Q   Q        ++   GY  + YHSQ  +SL
Sbjct  613  NSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGHGYG-SPYHSQAPMSL  668

Query  335  DH----HHQQQNPRDGPLgggggNAQVQPKPSSQQLWQNSY  445
            DH    H QQQN RD                  QQLW N+Y
Sbjct  669  DHLHHQHQQQQNARDASKQTHQ-----------QQLWPNNY  698



>gb|EMS61509.1| hypothetical protein TRIUR3_20581 [Triticum urartu]
Length=767

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    GAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSSQYKDNHHLMSLQQVENSGMWLH  166
            G FG    +P +F LN S  P+T+  G D  + SQYKD +  MSLQQ EN  MW+H
Sbjct  647  GGFGTANGMPQNFALNQSNPPATTAPGFDGAMPSQYKDGNPYMSLQQGENPAMWMH  702



>gb|KHG01632.1| Segment polarity dishevelled DVL-3 [Gossypium arboreum]
Length=861

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  5    AFGNTGTIPGSFPLNPSA-APSTSLGIDDGLSSQYKD---NHHLMSLQQVENSGMWLHGH  172
            +  N+   PGSF  +  A +  +    DD L SQY +   N +L  LQQ + S  W + H
Sbjct  715  SLENSSGSPGSFLHDLLADSAGSKAAYDDFLRSQYSNGGANFNL--LQQNDGSAAWDYRH  772

Query  173  GSRTMSAAPANTYYNIQAQNQQPSGF-RQVQQPSQNYASLGYNPNFYHSQTGISLD  337
            G+RT S  P N YY++  QN Q +G+ +  Q   Q + +LGY P+ Y+S   ++++
Sbjct  773  GTRTTSTIPDNAYYSLNGQNHQHAGYQQAQQLAQQLHEALGY-PSIYNSHAAMAIE  827



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690