BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS166H04

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    207   7e-58   Solanum tuberosum [potatoes]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        206   7e-58   Solanum lycopersicum
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         202   3e-56   Jatropha curcas
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        201   6e-56   Nicotiana sylvestris
dbj|BAG16527.1|  putative aconitase                                     201   8e-56   Capsicum chinense [bonnet pepper]
ref|XP_002524184.1|  aconitase, putative                                199   5e-55   Ricinus communis
ref|XP_006376779.1|  aconitate hydratase family protein                 198   6e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        196   4e-54   Nicotiana tomentosiformis
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        194   2e-53   Populus euphratica
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    193   4e-53   Populus euphratica
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    192   1e-52   Sesamum indicum [beniseed]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        192   1e-52   Nelumbo nucifera [Indian lotus]
emb|CDP10817.1|  unnamed protein product                                191   2e-52   Coffea canephora [robusta coffee]
emb|CDP05740.1|  unnamed protein product                                191   3e-52   Coffea canephora [robusta coffee]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             191   4e-52   Populus trichocarpa [western balsam poplar]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   189   5e-52   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             190   8e-52   Citrus clementina [clementine]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    187   6e-51   Solanum tuberosum [potatoes]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        187   7e-51   Eucalyptus grandis [rose gum]
gb|EPS60517.1|  hypothetical protein M569_14286                         186   8e-51   Genlisea aurea
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   184   6e-50   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             184   6e-50   
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             184   7e-50   Citrus clementina [clementine]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   183   8e-50   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   184   9e-50   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   183   1e-49   Citrus sinensis [apfelsine]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    180   1e-48   Nicotiana tomentosiformis
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   181   1e-48   Citrus sinensis [apfelsine]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    180   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    180   4e-48   Nicotiana tomentosiformis
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        178   9e-48   Vitis vinifera
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    177   2e-47   Glycine max [soybeans]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                177   3e-47   Erythranthe guttata [common monkey flower]
gb|KJB60837.1|  hypothetical protein B456_009G327800                    175   9e-47   Gossypium raimondii
gb|KJB60836.1|  hypothetical protein B456_009G327800                    175   9e-47   Gossypium raimondii
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    174   1e-46   Nicotiana sylvestris
ref|XP_007045642.1|  Aconitase 3                                        175   2e-46   
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    174   3e-46   Glycine max [soybeans]
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    174   3e-46   Nicotiana sylvestris
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        174   4e-46   Solanum lycopersicum
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        172   2e-45   Glycine soja [wild soybean]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    172   2e-45   Gossypium raimondii
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         170   1e-44   Jatropha curcas
gb|KJB50479.1|  hypothetical protein B456_008G173400                    169   2e-44   Gossypium raimondii
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                169   2e-44   Erythranthe guttata [common monkey flower]
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      166   3e-44   Gossypium arboreum [tree cotton]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        167   8e-44   Sesamum indicum [beniseed]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    167   9e-44   Solanum tuberosum [potatoes]
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...    160   2e-43   
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        166   2e-43   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    166   2e-43   Glycine max [soybeans]
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    166   2e-43   Nicotiana sylvestris
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    166   3e-43   Nicotiana tomentosiformis
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        166   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             165   4e-43   Phaseolus vulgaris [French bean]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      165   4e-43   Gossypium arboreum [tree cotton]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    164   6e-43   Gossypium raimondii
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    164   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    164   1e-42   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        164   1e-42   Cucumis melo [Oriental melon]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    164   1e-42   Cicer arietinum [garbanzo]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    164   1e-42   Gossypium raimondii
ref|XP_003596988.1|  Aconitate hydratase                                164   1e-42   Medicago truncatula
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    163   2e-42   Cucumis sativus [cucumbers]
ref|NP_567763.2|  aconitase 2                                           163   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    162   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             161   9e-42   
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             161   9e-42   Eutrema salsugineum [saltwater cress]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        161   1e-41   Prunus mume [ume]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    160   1e-41   Glycine max [soybeans]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    161   1e-41   Glycine max [soybeans]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    161   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             160   2e-41   Prunus persica
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    160   2e-41   
emb|CDY14291.1|  BnaA08g14220D                                          160   3e-41   Brassica napus [oilseed rape]
emb|CDY66424.1|  BnaAnng22230D                                          160   3e-41   Brassica napus [oilseed rape]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    160   3e-41   Gossypium raimondii
gb|KJB30569.1|  hypothetical protein B456_005G149700                    160   3e-41   Gossypium raimondii
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             160   3e-41   Capsella rubella
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             160   3e-41   
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    159   6e-41   Brassica rapa
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    158   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    158   1e-40   
emb|CDY50945.1|  BnaC03g74450D                                          158   2e-40   Brassica napus [oilseed rape]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             157   4e-40   Capsella rubella
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    157   5e-40   Elaeis guineensis
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    156   7e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    155   2e-39   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                          155   2e-39   
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    154   2e-39   Brassica rapa
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    154   3e-39   Phoenix dactylifera
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    154   4e-39   Arabis alpina [alpine rockcress]
ref|NP_178634.2|  aconitate hydratase 3                                 152   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003605929.1|  Aconitate hydratase                                152   2e-38   Medicago truncatula
emb|CDX93088.1|  BnaA03g38100D                                          151   5e-38   
emb|CDY18054.1|  BnaC07g04160D                                          150   5e-38   Brassica napus [oilseed rape]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    150   7e-38   Camelina sativa [gold-of-pleasure]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    150   7e-38   Arabis alpina [alpine rockcress]
gb|KHG02134.1|  hypothetical protein F383_25649                         150   1e-37   Gossypium arboreum [tree cotton]
ref|XP_002870438.1|  predicted protein                                  149   3e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    148   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        148   5e-37   Vitis vinifera
emb|CDY56501.1|  BnaAnng14360D                                          147   7e-37   Brassica napus [oilseed rape]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             147   8e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            145   3e-36   Phaseolus vulgaris [French bean]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    146   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        145   4e-36   Fragaria vesca subsp. vesca
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    144   2e-35   Cicer arietinum [garbanzo]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    143   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_002532564.1|  aconitase, putative                                140   2e-34   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    137   3e-33   Phoenix dactylifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    136   6e-33   Elaeis guineensis
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    135   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    135   1e-32   Elaeis guineensis
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    135   2e-32   Phoenix dactylifera
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    134   4e-32   
gb|EEC83022.1|  hypothetical protein OsI_28099                          126   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          127   6e-30   Sorghum bicolor [broomcorn]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    127   1e-29   
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          127   1e-29   Amborella trichopoda
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    126   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007020811.1|  Aconitase 3                                        126   2e-29   
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...    125   3e-29   
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         124   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    124   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO62410.1|  aconitase                                               122   5e-28   Solanum pennellii
gb|AAP30039.1|  aconitase                                               121   9e-28   Solanum pennellii
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    120   3e-27   Brachypodium distachyon [annual false brome]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           119   7e-27   Nicotiana tabacum [American tobacco]
gb|KHG08189.1|  hypothetical protein F383_11434                         117   2e-26   Gossypium arboreum [tree cotton]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    117   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      117   2e-26   Citrus limon [lemon]
emb|CBE71057.1|  aconitate hydratase 3                                  117   3e-26   Citrus clementina [clementine]
gb|ADM34980.1|  cytosolic aconitase                                     117   3e-26   Pyrus pyrifolia [sha li]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        116   5e-26   Glycine soja [wild soybean]
emb|CBE71058.1|  aconitate hydratase 2                                  116   5e-26   Citrus clementina [clementine]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    115   1e-25   Gossypium raimondii
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    115   1e-25   
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    114   2e-25   Cucurbita maxima [Boston marrow]
ref|XP_007020807.1|  Aconitase 3                                        112   2e-24   
dbj|BAJ85661.1|  predicted protein                                      110   7e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             109   2e-23   
emb|CAA58046.1|  aconitase                                              108   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002445994.1|  hypothetical protein SORBIDRAFT_06g000200          100   2e-23   
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    108   3e-23   Arabis alpina [alpine rockcress]
ref|XP_008363093.1|  PREDICTED: aconitate hydratase 1-like              100   3e-23   
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   108   3e-23   Fragaria vesca subsp. vesca
emb|CDX69174.1|  BnaC01g02790D                                          107   4e-23   
emb|CAB36543.1|  putative aconitase                                     107   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195308.1|  aconitate hydratase 1                                 107   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   107   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              107   7e-23   Brassica rapa
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             107   7e-23   Capsella rubella
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   107   7e-23   Tarenaya hassleriana [spider flower]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   107   8e-23   Brassica rapa
ref|XP_007046597.1|  Aconitase 1                                        107   9e-23   
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   106   1e-22   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   106   1e-22   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   106   1e-22   Citrus sinensis [apfelsine]
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                   105   2e-22   Citrus sinensis [apfelsine]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              106   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             105   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg             105   3e-22   
emb|CDX75532.1|  BnaA01g01700D                                          105   3e-22   
emb|CDY41626.1|  BnaC03g62580D                                          104   5e-22   Brassica napus [oilseed rape]
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               104   6e-22   Triticum urartu
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             104   6e-22   Prunus persica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   104   6e-22   Prunus mume [ume]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    104   6e-22   Zea mays [maize]
gb|KHN41868.1|  Aconitate hydratase 1                                   104   7e-22   Glycine soja [wild soybean]
gb|AAL13084.1|  putative aconitase                                      104   7e-22   Prunus avium [gean]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        104   8e-22   Gossypium arboreum [tree cotton]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        104   8e-22   Gossypium arboreum [tree cotton]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    103   9e-22   Gossypium raimondii
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         103   1e-21   Jatropha curcas
emb|CBE71056.1|  aconitate hydratase 1                                  103   1e-21   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   103   1e-21   Citrus sinensis [apfelsine]
ref|XP_010113288.1|  Aconitate hydratase 1                              103   2e-21   
emb|CBI24446.3|  unnamed protein product                                102   2e-21   Vitis vinifera
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               102   2e-21   
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             102   2e-21   Citrus clementina [clementine]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   102   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    102   3e-21   Zea mays [maize]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              102   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   102   3e-21   Vitis vinifera
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   102   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              102   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   102   3e-21   
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   102   4e-21   Glycine max [soybeans]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             102   4e-21   Populus trichocarpa [western balsam poplar]
ref|NP_001147431.1|  aconitase2                                         102   4e-21   Zea mays [maize]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             102   4e-21   Phaseolus vulgaris [French bean]
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    101   9e-21   Medicago truncatula
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   101   9e-21   
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          101   9e-21   Sorghum bicolor [broomcorn]
emb|CDY24823.1|  BnaA08g14870D                                          100   1e-20   Brassica napus [oilseed rape]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   100   1e-20   Populus euphratica
ref|XP_001779205.1|  predicted protein                                  100   1e-20   
ref|XP_006383042.1|  aconitate hydratase family protein                 100   1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    100   2e-20   Glycine max [soybeans]
dbj|BAJ92965.1|  predicted protein                                      100   2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    100   2e-20   Setaria italica
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                 99.8    3e-20   Eucalyptus grandis [rose gum]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                   99.8    3e-20   Eucalyptus grandis [rose gum]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...  99.8    3e-20   
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like            99.0    5e-20   Tarenaya hassleriana [spider flower]
emb|CAN83844.1|  hypothetical protein VITISV_003004                   99.0    5e-20   Vitis vinifera
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like            98.6    6e-20   Cicer arietinum [garbanzo]
gb|EEC74472.1|  hypothetical protein OsI_09921                        98.6    7e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                     98.6    7e-20   
ref|XP_003612247.1|  Aconitate hydratase                              98.6    7e-20   Medicago truncatula
gb|KJB17578.1|  hypothetical protein B456_003G006000                  98.2    9e-20   Gossypium raimondii
ref|XP_002530635.1|  aconitase, putative                              97.8    1e-19   Ricinus communis
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                   97.1    2e-19   Cucumis melo [Oriental melon]
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850        97.1    2e-19   Sorghum bicolor [broomcorn]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...  97.1    2e-19   Brachypodium distachyon [annual false brome]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572           96.3    4e-19   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331           96.3    4e-19   
ref|XP_003590814.1|  Aconitate hydratase                              96.3    4e-19   
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...  95.9    6e-19   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...  95.9    6e-19   Zea mays [maize]
gb|ADZ57218.1|  aconitase protein                                     94.7    1e-18   Litchi chinensis [litchi]
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like            94.0    2e-18   Eucalyptus grandis [rose gum]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic             94.0    3e-18   Triticum urartu
ref|XP_004166975.1|  PREDICTED: aconitate hydratase 1-like            92.4    3e-18   
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...  93.6    4e-18   
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like            93.2    4e-18   Cucumis sativus [cucumbers]
gb|KGN48958.1|  Aconitase                                             93.2    4e-18   Cucumis sativus [cucumbers]
ref|XP_001770969.1|  predicted protein                                92.4    8e-18   
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                   92.4    8e-18   Eucalyptus grandis [rose gum]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic             92.4    1e-17   
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic             91.7    2e-17   
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                      90.5    3e-17   Glycine soja [wild soybean]
gb|EEE58288.1|  hypothetical protein OsJ_09326                        90.1    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100637.1|  Aconitate hydratase                              90.1    5e-17   
emb|CDY44621.1|  BnaC04g06410D                                        83.2    8e-17   Brassica napus [oilseed rape]
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                      85.1    3e-15   Glycine soja [wild soybean]
emb|CDX91508.1|  BnaC04g06420D                                        76.3    2e-14   
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907           79.0    2e-13   
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                 77.8    6e-13   Citrus sinensis [apfelsine]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937           77.4    8e-13   
gb|EJY70620.1|  Aconitate hydratase 1 family protein                  71.6    5e-11   Oxytricha trifallax
gb|ACG25861.1|  hypothetical protein                                  63.9    2e-10   Zea mays [maize]
ref|XP_004031131.1|  hypothetical protein IMG5_146680                 69.7    2e-10   Ichthyophthirius multifiliis
emb|CDW89012.1|  aconitate hydratase 1 family protein                 67.8    8e-10   Stylonychia lemnae
ref|XP_002111662.1|  hypothetical protein TRIADDRAFT_63287            67.8    1e-09   Trichoplax adhaerens
ref|XP_001016756.1|  aconitate hydratase                              67.4    1e-09   Tetrahymena thermophila SB210
gb|AGC69746.1|  putative iron regulatory protein                      67.4    1e-09   Tieghemostelium lacteum
ref|XP_004362727.1|  putative iron regulatory protein                 67.0    2e-09   Cavenderia fasciculata
ref|XP_004030259.1|  hypothetical protein IMG5_164920                 66.2    3e-09   Ichthyophthirius multifiliis
gb|EJY64435.1|  Aconitate hydratase 1 family protein                  65.9    4e-09   Oxytricha trifallax
dbj|BAN16539.1|  ADB0003847                                           65.5    5e-09   Acytostelium subglobosum
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                  65.5    6e-09   Tetrahymena thermophila SB210
ref|XP_641837.1|  hypothetical protein DDB_G0279159                   65.1    6e-09   Dictyostelium discoideum AX4
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  63.9    2e-08   Crassostrea gigas
emb|CDR97928.1|  aconitate hydratase 1 family protein, putative       63.9    2e-08   Babesia bigemina
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  63.5    2e-08   Crassostrea gigas
gb|KFM82338.1|  hypothetical protein X975_14216                       63.5    2e-08   Stegodyphus mimosarum
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein         63.5    2e-08   Ixodes ricinus
ref|XP_003747109.1|  PREDICTED: cytoplasmic aconitate hydratase       63.2    3e-08   Galendromus occidentalis
gb|EFA77648.1|  putative iron regulatory protein                      63.2    3e-08   Heterostelium album PN500
ref|XP_003427264.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  62.4    4e-08   
ref|XP_009495769.1|  cytoplasmic aconitate hydratase                  62.4    5e-08   Fonticula alba
emb|CDW88502.1|  aconitate hydratase 1 family protein                 62.0    6e-08   Stylonychia lemnae
ref|XP_002591326.1|  hypothetical protein BRAFLDRAFT_121463           61.6    1e-07   Branchiostoma floridae
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                 61.2    1e-07   
ref|XP_731148.1|  aconitate hydratase 1                               61.2    1e-07   Plasmodium yoelii
emb|CAB41634.1|  iron regulatory protein 1-like protein               60.5    2e-07   Pacifastacus leniusculus
ref|XP_001612299.1|  aconitate hydratase 1 family protein             60.5    2e-07   Babesia bovis T2Bo
gb|ETN81082.1|  hypothetical protein NECAME_08744                     56.2    2e-07   Necator americanus
ref|XP_001451848.1|  hypothetical protein                             60.5    2e-07   Paramecium tetraurelia strain d4-2
ref|XP_004833677.1|  aconitate hydratase, putative                    60.1    3e-07   Theileria equi strain WA
ref|XP_001462507.1|  hypothetical protein                             59.3    3e-07   Paramecium tetraurelia strain d4-2
dbj|BAM15611.1|  IRP-like protein                                     60.1    3e-07   Plasmodium gallinaceum
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137            60.1    3e-07   Dictyostelium purpureum
ref|XP_002670969.1|  aconitase                                        60.1    3e-07   
ref|XP_007543966.1|  PREDICTED: cytoplasmic aconitate hydratase i...  59.7    3e-07   
ref|XP_002413165.1|  RNA-binding translational regulator IRP, put...  59.7    3e-07   
ref|XP_008433053.1|  PREDICTED: cytoplasmic aconitate hydratase       59.7    3e-07   
ref|XP_011505192.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  59.7    3e-07   
ref|NP_001133702.1|  Iron-responsive element-binding protein 1        59.3    4e-07   
ref|XP_676833.1|  IRP-like protein                                    59.3    5e-07   
emb|CCF75173.1|  unnamed protein product                              59.3    5e-07   
gb|KIH47319.1|  hypothetical protein ANCDUO_22624                     56.2    5e-07   
ref|XP_008622476.1|  aconitate hydratase 1                            58.9    6e-07   
gb|EUD71732.1|  aconitate hydratase 1                                 58.9    6e-07   
ref|XP_673124.1|  hypothetical protein                                57.8    8e-07   
gb|AJO69941.1|  IRP1A                                                 58.5    8e-07   
ref|XP_002259934.1|  IRP-like protein                                 58.5    9e-07   
gb|EKF31280.1|  aconitase, putative                                   58.2    1e-06   
ref|XP_004223595.1|  aconitate hydratase I                            58.2    1e-06   
gb|ESS68845.1|  aconitase                                             58.2    1e-06   
ref|XP_745570.1|  IRP-like protein                                    58.2    1e-06   
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like  58.2    1e-06   
ref|XP_821896.1|  aconitase                                           58.2    1e-06   
gb|EKG02789.1|  aconitase, putative                                   58.2    1e-06   
ref|XP_007546874.1|  PREDICTED: iron-responsive element-binding p...  58.2    1e-06   
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase       57.8    1e-06   
ref|XP_009689838.1|  aconitate hydratase 3, mitochondrial precursor   57.8    1e-06   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...  57.8    2e-06   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...  57.8    2e-06   
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase       57.8    2e-06   
ref|XP_008815728.1|  aconitate hydratase 1                            57.8    2e-06   
ref|XP_005754206.1|  PREDICTED: cytoplasmic aconitate hydratase-like  57.8    2e-06   
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...  57.8    2e-06   
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase       57.4    2e-06   
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase       57.4    2e-06   
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like  57.4    2e-06   
ref|XP_010733493.1|  PREDICTED: iron-responsive element-binding p...  57.4    2e-06   
ref|XP_002069487.1|  GK11552                                          57.4    2e-06   
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase       57.4    2e-06   
ref|XP_005814479.1|  PREDICTED: iron-responsive element-binding p...  57.4    2e-06   
ref|XP_008409420.1|  PREDICTED: iron-responsive element-binding p...  57.4    2e-06   
emb|CDI83859.1|  aconitate hydratase, putative                        57.4    2e-06   
ref|XP_766571.1|  aconitate hydratase                                 57.0    3e-06   
ref|XP_953725.1|  iron-responsive element binding protein/aconitase   57.0    3e-06   
emb|CDQ69390.1|  unnamed protein product                              57.0    3e-06   
ref|XP_004069532.1|  PREDICTED: iron-responsive element-binding p...  57.0    3e-06   
ref|XP_002140470.1|  aconitate hydratase                              56.6    4e-06   
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...  56.6    4e-06   
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                  56.6    4e-06   
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase       56.6    4e-06   
ref|XP_004333274.1|  aconitate hydratase                              56.2    4e-06   
emb|CCC94388.1|  unnamed protein product                              56.6    4e-06   
ref|XP_001614200.1|  aconitate hydratase I                            56.6    4e-06   
gb|EHH57327.1|  hypothetical protein EGM_06925                        56.2    5e-06   
gb|EHH24050.1|  hypothetical protein EGK_07631                        56.2    5e-06   
ref|XP_002053064.1|  GJ23540                                          56.2    5e-06   
ref|XP_004570327.1|  PREDICTED: iron-responsive element-binding p...  56.2    5e-06   
ref|XP_005931759.1|  PREDICTED: iron-responsive element-binding p...  56.2    5e-06   
ref|XP_005731484.1|  PREDICTED: iron-responsive element-binding p...  56.2    5e-06   
emb|CAF98392.1|  unnamed protein product                              56.2    6e-06   
ref|XP_006782496.1|  PREDICTED: iron-responsive element-binding p...  56.2    6e-06   
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase       55.8    6e-06   
ref|XP_003447608.1|  PREDICTED: iron-responsive element-binding p...  55.8    6e-06   
ref|XP_011505193.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  55.8    6e-06   
ref|XP_008292786.1|  PREDICTED: iron-responsive element-binding p...  55.8    6e-06   
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase       55.8    6e-06   
ref|XP_827883.1|  aconitase                                           55.8    7e-06   
emb|CBH16617.1|  aconitase, putative                                  55.8    7e-06   
ref|XP_005184263.1|  PREDICTED: cytoplasmic aconitate hydratase       55.5    8e-06   
ref|XP_004575994.1|  PREDICTED: cytoplasmic aconitate hydratase-like  55.5    8e-06   
gb|EYC17822.1|  hypothetical protein Y032_0029g1889                   55.5    9e-06   
ref|XP_007948891.1|  PREDICTED: cytoplasmic aconitate hydratase       55.5    9e-06   
gb|AAF29446.1|AF127456_1  aconitase                                   55.5    9e-06   
gb|EYC17821.1|  hypothetical protein Y032_0029g1889                   55.5    9e-06   
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein          55.5    9e-06   
ref|XP_009044065.1|  hypothetical protein LOTGIDRAFT_181349           55.5    9e-06   
ref|XP_002071941.1|  GK22582                                          55.5    1e-05   
ref|XP_006102185.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  55.5    1e-05   
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like  55.1    1e-05   
gb|EYC17823.1|  hypothetical protein Y032_0029g1889                   55.1    1e-05   
ref|XP_003487432.1|  PREDICTED: cytoplasmic aconitate hydratase-like  55.1    1e-05   
ref|XP_007255248.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  55.1    1e-05   
ref|XP_001998570.1|  GI23565                                          55.1    1e-05   
ref|XP_003727326.1|  PREDICTED: cytoplasmic aconitate hydratase i...  55.1    1e-05   
ref|XP_010787893.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase          55.1    1e-05   
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...  55.1    1e-05   
ref|XP_006192563.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
emb|CCC52311.1|  aconitase, (fragment)                                55.1    1e-05   
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase       55.1    1e-05   
ref|XP_006629138.1|  PREDICTED: iron-responsive element-binding p...  55.1    1e-05   
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase       54.7    1e-05   
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase       54.7    1e-05   
ref|XP_791082.2|  PREDICTED: cytoplasmic aconitate hydratase isof...  54.7    1e-05   
gb|ACF33175.1|  aconitase-1                                           54.7    2e-05   
gb|EYC17824.1|  hypothetical protein Y032_0029g1889                   54.7    2e-05   
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase       54.7    2e-05   
ref|XP_011380734.1|  PREDICTED: cytoplasmic aconitate hydratase       54.7    2e-05   
ref|XP_002765934.1|  aconitase, putative                              54.7    2e-05   
ref|XP_002069634.1|  GK11469                                          54.7    2e-05   
ref|XP_003754950.1|  PREDICTED: iron-responsive element-binding p...  54.7    2e-05   
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase       54.7    2e-05   
ref|XP_003401470.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  54.7    2e-05   
ref|XP_003967645.1|  PREDICTED: iron-responsive element-binding p...  54.7    2e-05   
ref|XP_011192810.1|  PREDICTED: cytoplasmic aconitate hydratase-like  54.3    2e-05   
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like  54.3    2e-05   
ref|XP_001954497.1|  GF18293                                          54.3    2e-05   
ref|XP_011058028.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  54.3    2e-05   
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|WP_005799364.1|  aconitate hydratase                              53.9    3e-05   
ref|XP_007904798.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.9    3e-05   
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.9    3e-05   
ref|XP_001358125.2|  GA18513                                          53.9    3e-05   
ref|XP_002012756.1|  GL23781                                          53.9    3e-05   
gb|EPQ05176.1|  Cytoplasmic aconitate hydratase                       53.9    3e-05   
gb|EGI63266.1|  Cytoplasmic aconitate hydratase                       53.9    3e-05   
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|XP_007967222.1|  PREDICTED: cytoplasmic aconitate hydratase       53.9    3e-05   
ref|WP_043425496.1|  hypothetical protein                             50.8    3e-05   
ref|XP_002429734.1|  aconitase, putative                              53.5    4e-05   
ref|XP_005862172.1|  PREDICTED: cytoplasmic aconitate hydratase-like  53.5    4e-05   
ref|XP_002032253.1|  GM23623                                          53.5    4e-05   
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.5    4e-05   
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase       53.5    4e-05   
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                  53.5    4e-05   
ref|XP_011198599.1|  PREDICTED: cytoplasmic aconitate hydratase-like  53.5    4e-05   
ref|XP_006027291.1|  PREDICTED: iron-responsive element-binding p...  53.5    4e-05   
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase       53.5    4e-05   
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase       53.5    4e-05   
ref|WP_036812270.1|  aconitate hydratase                              53.5    4e-05   
ref|WP_010109801.1|  aconitate hydratase                              53.5    4e-05   
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase       53.5    4e-05   
ref|NP_001080577.1|  aconitase 1, soluble                             53.5    4e-05   
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  53.5    4e-05   
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                  53.5    4e-05   
ref|XP_004712473.1|  PREDICTED: cytoplasmic aconitate hydratase       53.5    5e-05   
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    5e-05   
ref|XP_006609084.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.1    5e-05   
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
emb|CDS50048.1|  Aconitate hydratase                                  53.1    5e-05   
ref|XP_010072074.1|  PREDICTED: cytoplasmic aconitate hydratase-like  52.8    5e-05   
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_008059371.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_003966778.1|  PREDICTED: cytoplasmic aconitate hydratase-like  53.1    5e-05   
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    5e-05   
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    6e-05   
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    6e-05   
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    6e-05   
ref|XP_007176909.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    6e-05   
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    6e-05   
ref|XP_007478070.1|  PREDICTED: iron-responsive element-binding p...  53.1    6e-05   
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    6e-05   
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.1    6e-05   
ref|XP_006261404.1|  PREDICTED: iron-responsive element-binding p...  53.1    6e-05   
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...  53.1    6e-05   
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.1    6e-05   
ref|XP_003695791.1|  PREDICTED: cytoplasmic aconitate hydratase       53.1    6e-05   
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  53.1    6e-05   
ref|XP_392993.2|  PREDICTED: cytoplasmic aconitate hydratase-like...  53.1    6e-05   
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    6e-05   
ref|WP_008907319.1|  aconitate hydratase                              52.8    6e-05   
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  52.8    7e-05   
ref|XP_002776365.1|  aconitase, putative                              52.8    7e-05   
ref|XP_005294554.1|  PREDICTED: iron-responsive element-binding p...  52.8    7e-05   
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                      52.8    7e-05   
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    7e-05   
ref|XP_005683624.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  52.8    7e-05   
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                 52.8    7e-05   
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    7e-05   
ref|XP_009306687.1|  putative aconitase                               52.8    7e-05   
ref|XP_006888329.1|  PREDICTED: iron-responsive element-binding p...  52.8    7e-05   
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    7e-05   
gb|ESS32610.1|  aconitate hydratase ACN/IRP                           52.8    7e-05   
ref|WP_010588057.1|  aconitate hydratase                              52.8    7e-05   
gb|EDL98627.1|  rCG55067                                              52.8    7e-05   
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    7e-05   
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    7e-05   
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    7e-05   
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    7e-05   
ref|NP_001126764.1|  cytoplasmic aconitate hydratase                  52.8    7e-05   
ref|NP_059017.1|  cytoplasmic aconitate hydratase                     52.8    7e-05   
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                  52.8    7e-05   
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    7e-05   
gb|KFH13093.1|  aconitate hydratase ACN/IRP                           52.8    8e-05   
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
gb|EPR62226.1|  aconitate hydratase ACN/IRP                           52.8    8e-05   
ref|XP_002366326.1|  aconitate hydratase, putative                    52.8    8e-05   
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...  52.8    8e-05   
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|NP_002188.1|  cytoplasmic aconitate hydratase                     52.8    8e-05   
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    8e-05   
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...  52.8    8e-05   
ref|XP_010121598.1|  PREDICTED: cytoplasmic aconitate hydratase-like  51.6    8e-05   
ref|XP_006870949.1|  PREDICTED: iron-responsive element-binding p...  52.8    8e-05   
ref|WP_007850807.1|  aconitate hydratase                              52.8    8e-05   
gb|KFG60936.1|  aconitate hydratase ACN/IRP                           52.8    8e-05   
gb|KFG42597.1|  aconitate hydratase ACN/IRP                           52.8    8e-05   
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|WP_010461583.1|  aconitate hydratase                              52.8    8e-05   
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_007950031.1|  PREDICTED: iron-responsive element-binding p...  52.8    8e-05   
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   
ref|XP_003413887.1|  PREDICTED: iron-responsive element-binding p...  52.8    8e-05   
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase       52.8    8e-05   



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   207 bits (526),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  157



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   206 bits (525),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  111  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  155



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   202 bits (513),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  110  IVTALPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  158



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   201 bits (512),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  112  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   201 bits (511),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T+
Sbjct  51   YSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKGILTA  110

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  111  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  155



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   199 bits (505),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 88/109 (81%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  IVTPLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  156



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   198 bits (504),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  155



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   196 bits (499),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  157



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  113  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  161



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   193 bits (491),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIR+CDNFQ
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRHCDNFQ  155



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I + LPKPGGGEFGKFYSLPAL DPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  123  ILSGLPKPGGGEFGKFYSLPALKDPRIDKLPYSIRILLESAIRNCDNFQ  171



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I TSLPKPGGGEFGKFYSLPA+NDPRIDKLPYSI+ILLE+AIRNCDNFQ
Sbjct  104  ILTSLPKPGGGEFGKFYSLPAINDPRIDKLPYSIKILLESAIRNCDNFQ  152



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  122  TLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQ  170



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  317  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  496
            +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KGI TSL
Sbjct  68   SSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKGILTSL  127

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PKPGGG+FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  128  PKPGGGDFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  171



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  111  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  159



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   189 bits (481),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  162



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   190 bits (482),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  162



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   187 bits (475),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 7/109 (6%)
 Frame = +2

Query  308  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  481
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I TSLPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  93   ILTSLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  141



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   187 bits (475),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPK GGG FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTTLPKAGGGHFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  156



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   186 bits (472),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            +  +LPKPGGGEFGK+YSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  77   LLQTLPKPGGGEFGKYYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  125



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   184 bits (466),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   184 bits (466),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  160



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   184 bits (468),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  160



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   184 bits (467),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   183 bits (465),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQ
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQ  224



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  156



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  338  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGE  517
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI TSLPKPGGGE
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLPKPGGGE  120

Query  518  FGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  121  FGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  157



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            IFTSLPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQ
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQ  224



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 5/109 (5%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L F SAFRS R     WSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRSRR-----WSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I TS+PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  121  ILTSVPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  169



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   177 bits (450),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +2

Query  305  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  97   LTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  144



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  478
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  479  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GI + LPKP GGEFGKFYSLPALNDPRIDKLPYSI+ILLE+AIRNCDNFQ
Sbjct  121  GILSGLPKPEGGEFGKFYSLPALNDPRIDKLPYSIKILLESAIRNCDNFQ  170



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   175 bits (443),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  317  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  496
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  150



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   175 bits (443),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  317  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  496
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  150



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQ
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQ  177



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   175 bits (443),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  107  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  155



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   174 bits (441),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +2

Query  305  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             TSLP+PGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  144



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQ
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQ  177



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   174 bits (440),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 83/103 (81%), Positives = 90/103 (87%), Gaps = 7/103 (7%)
 Frame = +2

Query  326  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIFTSLP  499
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98

Query  500  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  99   KPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  141



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +2

Query  305  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             TSLP+PGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  144



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  317  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  496
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  150



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   170 bits (430),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 6/109 (6%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+LPKPGGGEFGKFY+LPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  111  ILTNLPKPGGGEFGKFYNLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  159



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + TSLP+PGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  VLTSLPRPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  156



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   169 bits (428),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 81/96 (84%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = +2

Query  344  SVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  520
            S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIFTSLPKPGGGEF
Sbjct  60   SAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLPKPGGGEF  119

Query  521  GKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  120  GKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQ  155



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  156



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   167 bits (423),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 88/104 (85%), Gaps = 4/104 (4%)
 Frame = +2

Query  326  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIFTSL  496
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PK GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  114  PKSGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQ  157



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   167 bits (423),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 79/106 (75%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = +2

Query  314  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLPALNDPRI+KLP+SIRILLE+AIRNCDNF 
Sbjct  95   SLPKPGGGEFGKFYSLPALNDPRINKLPFSIRILLESAIRNCDNFH  140



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+G++YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+Q
Sbjct  107  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQ  157



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   166 bits (420),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +2

Query  308  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             TSLPKPGGGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  107  LTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDGFQ  154



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   166 bits (420),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  91   NLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  139



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   166 bits (420),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 11/111 (10%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  475
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  99   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  149



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   166 bits (420),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 90/111 (81%), Gaps = 11/111 (10%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  475
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  95   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  145



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   166 bits (419),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  478
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  479  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
               TSLPKPGGGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  105  ANLTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDGFQ  154



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  344  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFG  523
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLPKPGGGEFG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLPKPGGGEFG  108

Query  524  KFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  109  KFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  143



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +2

Query  317  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  496
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  497  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  106  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  149



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + TSLPKPGGGEFGKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  153



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   164 bits (416),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+G++YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+Q
Sbjct  108  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQ  158



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGEFGK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQ  149



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGEFGK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQ  149



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   164 bits (415),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  347  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  526
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LPKPGGGEFGK
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLPKPGGGEFGK  111

Query  527  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            FYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  112  FYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  145



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + TSLPKPGGGEFGKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  153



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  308  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNL  92

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  93   TSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  139



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGE+GK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  101  NLTSLPKPGGGEYGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQ  149



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   163 bits (412),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+Q
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNYQ  155



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   162 bits (411),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+Q
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNYQ  155



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   161 bits (408),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 76/111 (68%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+G +YSLPALNDPR+DKLP+S+RILLE+AIRNCDN+Q
Sbjct  105  KDILTSLPKPGGGEYGNYYSLPALNDPRVDKLPFSVRILLESAIRNCDNYQ  155



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   161 bits (408),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKP GGE+GK+YSLPALNDPRID+LPYS+RILLE+AIRNCDN+Q
Sbjct  108  KDILTSLPKPDGGEYGKYYSLPALNDPRIDRLPYSVRILLESAIRNCDNYQ  158



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   161 bits (408),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  353  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  529
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLPKPGGGEFGKF  123

Query  530  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  156



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  144



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   161 bits (407),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  154



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   161 bits (407),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  151



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  144



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   161 bits (407),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGG +GK+YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+Q
Sbjct  107  KDILTSLPKPGGGAYGKYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQ  157



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  353  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  529
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLPKPGGGEFGKF  123

Query  530  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  156



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   160 bits (405),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = +2

Query  350  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  526
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLPKPGGGEFGK  118

Query  527  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            FYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  119  FYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  152



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   160 bits (405),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K + TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+Q
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQ  155



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   160 bits (405),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K + TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+Q
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQ  155



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   160 bits (405),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQ
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQ  152



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   160 bits (405),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQ
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQ  152



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            K I TSLPKPGGGE+GK+YSLPALNDPR+DKLPYS+RILLE+AIRN DN+Q
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRVDKLPYSVRILLESAIRNYDNYQ  155



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  107  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  153



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   159 bits (402),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +2

Query  311  TFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+Q
Sbjct  108  LTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQ  155



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  152



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   158 bits (400),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKP GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  105  TTLPKPSGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  151



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   158 bits (399),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 6/111 (5%)
 Frame = +2

Query  302  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  475
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  476  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KGIFT+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  105  KGIFTTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  155



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   157 bits (396),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  323  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  499
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105

Query  500  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  106  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  148



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   157 bits (396),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  508
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLPKP 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLPKPR  127

Query  509  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  128  GGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  167



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   156 bits (394),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  362  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  541
            HGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K IFTSLPKPGGGEFGKFYSLP
Sbjct  87   HGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKEIFTSLPKPGGGEFGKFYSLP  146

Query  542  ALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ALNDPR++KLPYSIRILLE+AIRNCD FQ
Sbjct  147  ALNDPRVEKLPYSIRILLESAIRNCDGFQ  175



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   155 bits (392),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  151



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   155 bits (392),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  151



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   154 bits (390),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  109  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  155



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 75/100 (75%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  508
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I TSLPKPG
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLPKPG  128

Query  509  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGEFGKFYSLPAL+DPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  129  GGEFGKFYSLPALSDPRIDKLPYSIRILLESAIRNCDNFQ  168



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +2

Query  302  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS--EN  469
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+AS  E+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  470  PFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             +K I TSLPKP GGE+GK+YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+Q
Sbjct  107  AYKDILTSLPKPDGGEYGKYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQ  159



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   152 bits (385),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 8/107 (7%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQ
Sbjct  104  TTLPKPGGGEFGKFYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQ  150



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   152 bits (383),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  508
            RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG  TSLPKPG
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLPKPG  99

Query  509  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  100  GGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQ  139



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   151 bits (381),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  154



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   150 bits (380),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKPGGGEFGKFYSLPALND RIDKLPY+IRILLE+AIRNCDNFQ
Sbjct  100  TTLPKPGGGEFGKFYSLPALNDSRIDKLPYTIRILLESAIRNCDNFQ  146



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   150 bits (379),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  505
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  99

Query  506  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  100  GGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  140



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  487
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  488  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            T+LPKP GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  100  TTLPKPDGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  146



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = +2

Query  341  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  520
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLPKPGGGEF
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLPKPGGGEF  117

Query  521  GKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  118  GKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  153



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   149 bits (375),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  508
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  ++MASE+P+KGIFT+LPKPG
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLPKPG  97

Query  509  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  98   GGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  137



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   148 bits (374),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  505
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  100

Query  506  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  101  GGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  141



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 74/110 (67%), Positives = 84/110 (76%), Gaps = 9/110 (8%)
 Frame = +2

Query  302  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  478
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLR--------SVNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  479  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GI T LPK  GGEFGK+YSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQ
Sbjct  98   GILTGLPKASGGEFGKYYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQ  147



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score =   147 bits (372),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKGI  484
            T + AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE+ PFKGI
Sbjct  42   TSSPAFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGI  97

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            FT+LPKPGGGEFGKFYSLPALNDPRIDKLPY IRILLE+AIRNCDNFQ
Sbjct  98   FTTLPKPGGGEFGKFYSLPALNDPRIDKLPYYIRILLESAIRNCDNFQ  145



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = +2

Query  311  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  484
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  485  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  108  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  155



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   145 bits (367),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  350  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  529
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLPKPGGGEFGKF
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLPKPGGGEFGKF  109

Query  530  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  110  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  142



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  308  LTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+L KP GGE+GKFYSLPALNDPRID+LPYS+RILLE+AIRNCD+F 
Sbjct  98   ILTTLHKPDGGEYGKFYSLPALNDPRIDRLPYSVRILLESAIRNCDSFH  146



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   145 bits (366),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +2

Query  305  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKG  481
            P +F +       +  RWSHGV W++P +L +QIR+ APV+    R+IATMA E+ PFK 
Sbjct  42   PRSFTAQRLLSSSAATRWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKE  101

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
              TSLPKPGGGE+GKFYSL +L DPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  102  HLTSLPKPGGGEYGKFYSLTSLKDPRIDRLPYSIRILLESAIRNCDNFQ  150



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +2

Query  329  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  508
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG  TSLPKPG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLPKPG  99

Query  509  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGEFGKFYSLP+LNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  100  GGEFGKFYSLPSLNDPRIEKLPYSIRILLESAIRNCDNFQ  139



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 6/103 (6%)
 Frame = +2

Query  323  AFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  499
             FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +TMA E+PFKGIFTSLP
Sbjct  61   GFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFKGIFTSLP  115

Query  500  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  116  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  158



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 9/109 (8%)
 Frame = +2

Query  302  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  481
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P   
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP---  104

Query  482  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
                  KPGGGEFGKFYSL AL+DPRID+LPYSI+ILLE+AIRNCDNFQ
Sbjct  105  ---XXXKPGGGEFGKFYSLTALDDPRIDRLPYSIKILLESAIRNCDNFQ  150



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  362  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  541
            H  DW+SP S  AQIRS+A V   F R+ ATMA+ N ++ I TSL KPGGGEFGK+YSLP
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSLSKPGGGEFGKYYSLP  126

Query  542  ALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ALNDPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  127  ALNDPRIDRLPYSIRILLESAIRNCDEFQ  155



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   136 bits (343),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  362  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  541
            H  DW+SP S  AQIRS+A V + F R+ ATMA+ N ++ I +SL KPGGGEFGK+YSLP
Sbjct  62   HFGDWRSPLSHRAQIRSSAAVADRFERRFATMATRNSYESILSSLSKPGGGEFGKYYSLP  121

Query  542  ALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ALNDPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  122  ALNDPRIDRLPYSIRILLESAIRNCDEFQ  150



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   135 bits (341),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = +2

Query  329  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPK  502
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLPK
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLPK  119

Query  503  PGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             GGGE+GK+YSLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  120  TGGGEYGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  161



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   135 bits (341),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  371  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  550
            DW+SP S  AQIR +A V   F R  ATMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  68   DWRSPLSHRAQIRYSAAVAERFERYFATMATRNAYESILTSLPKPGGGEFGKYYSLPALN  127

Query  551  DPRIDKLPYSIRILLEAAIRNCDNFQ  628
            DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  128  DPRIDRLPYSIRILLESAIRNCDEFQ  153



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  371  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  550
            DW+SP S  AQIR +A V   F R   TMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  69   DWRSPLSHRAQIRYSATVAERFERHFTTMATRNAYESILTSLPKPGGGEFGKYYSLPALN  128

Query  551  DPRIDKLPYSIRILLEAAIRNCDNFQ  628
            DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  129  DPRIDRLPYSIRILLESAIRNCDEFQ  154



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = +2

Query  320  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  493
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            L KP  GE+GKFYSLPALNDPRID+LPYS+RILLE+AIRNCD+F 
Sbjct  102  LHKPDVGEYGKFYSLPALNDPRIDRLPYSVRILLESAIRNCDSFH  146



>gb|EEC83022.1| hypothetical protein OsI_28099 [Oryza sativa Indica Group]
Length=396

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 74/101 (73%), Gaps = 10/101 (10%)
 Frame = +2

Query  356  WSHGVDWKSPASLT---------AQIRSAAPVLNDFHRKIA-TMASENPFKGIFTSLPKP  505
            W+    W   AS +         AQI + AP +   HR++A T A+E+PFK I T+LPKP
Sbjct  51   WAAAGGWSGRASSSPVVGCGACRAQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKP  110

Query  506  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GGGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  111  GGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  151



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  365  GVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPA  544
            G DW+SP     +IRS++ V+  F RK+ T A+EN FK + TSLPKP GGE+GK+YSLPA
Sbjct  64   GSDWRSPIGPRPRIRSSSTVIQLFDRKMTTTATENVFKDVLTSLPKPEGGEYGKYYSLPA  123

Query  545  LNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            LNDPRID+LPYSIRILLE+AIRNCD+FQ
Sbjct  124  LNDPRIDRLPYSIRILLESAIRNCDDFQ  151



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   127 bits (320),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  386  ASLTAQIRSAA-PVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  562
            A   AQI +AA P +  F R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI
Sbjct  73   AGARAQIGAAAVPAVERFQRRMATQATEHAFKDILTSLPKPGGGEYGKFYSLPALNDPRI  132

Query  563  DKLPYSIRILLEAAIRNCDNFQ  628
            DKLPYSIRILLE+AIRNCDNFQ
Sbjct  133  DKLPYSIRILLESAIRNCDNFQ  154



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   127 bits (319),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  386  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  565
            A   AQI +A P +  F R++AT A+ + FK I TSLPKPGGGE+GKFYSLPALNDPRID
Sbjct  65   AGARAQIGAAVPAVEQFQRRMATQATVHAFKDILTSLPKPGGGEYGKFYSLPALNDPRID  124

Query  566  KLPYSIRILLEAAIRNCDNFQ  628
            KLPYS+RILLE+AIRNCDNFQ
Sbjct  125  KLPYSVRILLESAIRNCDNFQ  145



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  374  WKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  553
            W+SP S  A IRS+   L+ F R++ATMA++N ++ I TSLPKP GGEFGK+YSLP+LND
Sbjct  51   WRSPLSHRAFIRSSTINLDRFERRLATMATQNVYESILTSLPKPSGGEFGKYYSLPSLND  110

Query  554  PRIDKLPYSIRILLEAAIRNCDNFQ  628
            PRIDKLPYSIRILLE+AIRNCD+F+
Sbjct  111  PRIDKLPYSIRILLESAIRNCDDFE  135



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   126 bits (317),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  350  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  529
            P   H  D +SP S  A +RS+A V + F R+ ATMAS+N ++ I T+L KPGGGEFGK+
Sbjct  52   PPARHLADLRSPISHRALVRSSAAVADRFERRFATMASKNSYESILTTLSKPGGGEFGKY  111

Query  530  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            Y LPAL DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  112  YCLPALTDPRIDRLPYSIRILLESAIRNCDEFQ  144



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 70/93 (75%), Gaps = 7/93 (8%)
 Frame = +2

Query  350  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  529
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S +     +       G E+G+F
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGSVDKSSQAW-------GREYGRF  119

Query  530  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            YSLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  120  YSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  152



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score =   125 bits (315),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  386  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  565
            A   AQI +A P +    R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI+
Sbjct  63   AGARAQIGAAVPAVERLQRRMATQATEHAFKNILTSLPKPGGGEYGKFYSLPALNDPRIE  122

Query  566  KLPYSIRILLEAAIRNCDNFQ  628
            KLPYSIRILLE+AIRNCDNFQ
Sbjct  123  KLPYSIRILLESAIRNCDNFQ  143



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   124 bits (311),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/58 (93%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASE+PFKGIFT+LPKPGGGEFGKFYSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQ
Sbjct  1    MASEHPFKGIFTTLPKPGGGEFGKFYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQ  58



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   124 bits (310),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +2

Query  347  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  526
            VPR SH  D +SP S  A +RS A V   F R+ ATMA+ N ++ I T+L KPGGG+FGK
Sbjct  43   VPR-SHLSDGRSPISHRALVRSYAAVAYRFERRFATMATRNSYESILTTLRKPGGGDFGK  101

Query  527  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            +YSLPAL DPRI++LPYSIRILLE+AIRNCD FQ
Sbjct  102  YYSLPALTDPRIERLPYSIRILLESAIRNCDEFQ  135



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   122 bits (305),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  58



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   121 bits (304),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE++IRNCDNFQ
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESSIRNCDNFQ  58



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   120 bits (300),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 3/80 (4%)
 Frame = +2

Query  398  AQIRS-AAPVL-NDFHRK-IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  568
            AQI + AAP     FHR+ +AT A+E+ FK I TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  66   AQIGAVAAPAAGTSFHRRRMATSATEHAFKNILTSLPKPGGGEFGKFYSLPALNDPRIDK  125

Query  569  LPYSIRILLEAAIRNCDNFQ  628
            LPYSIRILLE+AIRNCD+FQ
Sbjct  126  LPYSIRILLESAIRNCDDFQ  145



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   119 bits (297),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFKGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYS RILLE+AIRNCDNFQ
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSSRILLESAIRNCDNFQ  58



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQ
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQ  58



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  58



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  58



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQ  58



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPFK   TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  1    MASENPFKPNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  58



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + +ENPFKG  TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  6    LTNENPFKGNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  63



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+E+PFK I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAAEHPFKEILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQ  58



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQ
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQ  58



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASE+PFK I T L KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  1    MASEHPFKEILTGLSKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  58



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK   TSLPKPGGGEFGK+YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  1    MAAENPFKENLTSLPKPGGGEFGKYYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  58



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 5/74 (7%)
 Frame = +2

Query  407  RSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIR  586
            R  AP LN     +    SE+ FK I TSLPKPGG EFGKFYSLPALNDPRID+LPYSIR
Sbjct  11   RLMAPQLN-----LGMKCSEHAFKAILTSLPKPGGEEFGKFYSLPALNDPRIDRLPYSIR  65

Query  587  ILLEAAIRNCDNFQ  628
            ILLE+AIRNCDNFQ
Sbjct  66   ILLESAIRNCDNFQ  79



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +2

Query  380  SPASLTAQIR-SAAPVLN-DFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  553
            SP+S   + R S AP       R++A   +E+ +  I TSLPKPGGGE+GKFYSLPALND
Sbjct  58   SPSSAAVRGRGSVAPAAQRSQQRRMAASGTEHAYSNILTSLPKPGGGEYGKFYSLPALND  117

Query  554  PRIDKLPYSIRILLEAAIRNCDNFQ  628
            PRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  118  PRIDKLPYSIRILLESAIRNCDGFQ  142



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRID+LPYSIRILLE+AIRNCDN+Q
Sbjct  97   ASEHAYKDILTSLPKPGGGEYGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDNYQ  153



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            +++MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  20   LSSMASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEF  79

Query  626  Q  628
            Q
Sbjct  80   Q  80



>ref|XP_002445994.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
 gb|EES10322.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
Length=106

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            A+++ FK I  SLPKPGGGE+GKF+SLPALNDPRID+LPYSIR+LLE+AIR+CDNFQ
Sbjct  6    ATKHAFKSILASLPKPGGGEYGKFFSLPALNDPRIDRLPYSIRVLLESAIRHCDNFQ  62



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ IF +L KP GGEFG +YSLPALNDPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSIFKALEKPDGGEFGNYYSLPALNDPRIDRLPYSIRILLESAIRNCDEFQ  58



>ref|XP_008363093.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=107

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  SL KP GGEFGK+YSLPALNDPR+DKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MAAENPFKSILKSLEKPDGGEFGKYYSLPALNDPRVDKLPYSIKILLESAIRNCDEFQ  58



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ASENPF+ I  +L KPGGGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  5    ASENPFRSILKALEKPGGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  61



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            +   ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+
Sbjct  7    VKNAASEHSYKDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNY  66

Query  626  Q  628
            Q
Sbjct  67   Q  67



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   107 bits (266),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF  IF +L +P GGEFGK+YSLP LNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFHSIFKTLERPDGGEFGKYYSLPDLNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   107 bits (266),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPF  I  +L KPGGGEFGK+YSLPAL+DPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFNSILKTLEKPGGGEFGKYYSLPALDDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE AIRNCD FQ
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLELAIRNCDEFQ  58



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS+NPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASDNPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            +   ASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  25   VCVSASENPFRSILKALEKPDGGEFGSYYSLPALNDPRIDKLPYSIRILLESAIRNCDEF  84

Query  626  Q  628
            Q
Sbjct  85   Q  85



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   104 bits (260),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ++SENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  8    LSSENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  65



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            +A   +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  1    MAASGTEHAYNNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGF  60

Query  626  Q  628
            Q
Sbjct  61   Q  61



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  ASLTAQIRSAA---PVLNDFHR-KIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  553
            A L   + ++A   P  +  HR ++   A+++ FK I TSL KPGGGE+GKF+SLPALND
Sbjct  49   ARLVPDVTTSAKLQPRDDALHRIRVGVGATKHAFKRILTSLIKPGGGEYGKFFSLPALND  108

Query  554  PRIDKLPYSIRILLEAAIRNCDNFQ  628
            PRIDKLPYSIR+LLE+AIR+CDNFQ
Sbjct  109  PRIDKLPYSIRVLLESAIRHCDNFQ  133



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   104 bits (259),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPF  I T+L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQ
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQ  59



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   104 bits (259),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQ  58



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   104 bits (259),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   104 bits (259),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   103 bits (258),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M +ENPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MVNENPFTSILKTLEKPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQ  58



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQ  58



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQ  58



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  464  ENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ENPFK I  +L KP GGEFGK+YSLPALNDPRI+KLPYSIRILLE+AIRNCD FQ
Sbjct  64   ENPFKSILKTLEKPDGGEFGKYYSLPALNDPRIEKLPYSIRILLESAIRNCDEFQ  118



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  428  NDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAI  607
            ++F ++    AS NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AI
Sbjct  10   SNFSKRKNNYASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLESAI  69

Query  608  RNCDNFQ  628
            RNCD FQ
Sbjct  70   RNCDEFQ  76



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  40   TEHAYSNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQ  95



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L  P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQSPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQ  58



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ N ++ I  +L KPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQ
Sbjct  1    MATRNVYESILKTLEKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQ  58



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQ
Sbjct  5    STATKHAFKRILTSLIKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQ  63



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLESAIRNCDEFQ  58



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MAS NPF+ I T+L +P GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MASANPFQKILTALERPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQ
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQ  58



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPF  I  +L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQ
Sbjct  1    MATENPFNSILRTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQ  59



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQ
Sbjct  1    MANENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQ  57



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQ
Sbjct  6    ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQ  62



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M +ENPF  I  +L KPGGG EFGK+YSLPALNDPRID+LPYS+RILLE+AIRNCD FQ
Sbjct  1    MVTENPFSSILRTLEKPGGGGEFGKYYSLPALNDPRIDRLPYSVRILLESAIRNCDEFQ  59



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDN  622
            +AT+ SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++LPYSIRIL+E+AIRNCDN
Sbjct  1    MATLTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVESAIRNCDN  60

Query  623  FQ  628
            F+
Sbjct  61   FK  62



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQ
Sbjct  67   ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQ  123



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  440  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  616
            R +ATMA  N  F  + TSLPKPGGGE+GK+YSLPALNDPRI++LPYSIR LLE+AIRNC
Sbjct  72   RGLATMADGNSRFGHVLTSLPKPGGGEYGKYYSLPALNDPRIERLPYSIRYLLESAIRNC  131

Query  617  DNFQ  628
            D FQ
Sbjct  132  DGFQ  135



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  440  RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCD  619
            +++    SENPF+ I  +L KP GGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD
Sbjct  20   QELRIFTSENPFRSILKTLEKPDGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCD  79

Query  620  NFQ  628
             FQ
Sbjct  80   EFQ  82



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQ
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQ  57



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ASENPF  + T LPKP GG +GKFYSL  LNDPR+D LPYSIR LLEAAIRNCDNFQ
Sbjct  1    ASENPFSSLITDLPKPDGGSYGKFYSLVKLNDPRVDSLPYSIRYLLEAAIRNCDNFQ  57



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQ
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQ  57



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPF  I T+L KPGG GEFGK++SLPALND RID+LPYS+RILLE+AIRNCD FQ
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDRRIDRLPYSVRILLESAIRNCDEFQ  59



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIR
Sbjct  93   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIR  152

Query  611  NCDNFQ  628
            NCD FQ
Sbjct  153  NCDEFQ  158



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A++N +  I T L KPGGGE FGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  81   FERRFASAATKNSYDEILTGLGKPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  140

Query  611  NCDNFQ  628
            NCD FQ
Sbjct  141  NCDEFQ  146



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLESAIRNCDEFQ  58



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLESAIRNCDEFQ  58



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A+ N +  I T L +PGGGE FGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  84   FERRFASAATRNSYDEILTGLGRPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  143

Query  611  NCDNFQ  628
            NCD+FQ
Sbjct  144  NCDDFQ  149



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M  ENPF+ I  +L +P GGE+GKF+SLP+LNDPRI+KLPYSIRILLE+AIRNCD FQ
Sbjct  1    MDCENPFRRILKTLERPDGGEYGKFFSLPSLNDPRIEKLPYSIRILLESAIRNCDEFQ  58



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            S NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  6    SSNPFASILKTLEKPXGGEFGKYYSLPALGDPRIDRLPYSIRILLESAIRNCDEFQ  61



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L KPGG G FG +YSLPALND RID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLEKPGGDGHFGNYYSLPALNDSRIDELPYSIRILLESAIRNCDEFQ  59



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIR
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIR  140

Query  611  NCDNFQ  628
            NCD FQ
Sbjct  141  NCDEFQ  146



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIR
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIR  140

Query  611  NCDNFQ  628
            NCD FQ
Sbjct  141  NCDEFQ  146



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA++NPF  I  +L KPGGG EFGK+YSLPALND RID LPYSIRILLE+AIRNCD FQ
Sbjct  1    MATQNPFNNILKTLEKPGGGGEFGKYYSLPALNDSRIDALPYSIRILLESAIRNCDEFQ  59



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+EN F  I  +L KP GGEFGK+Y LPALNDPRIDKLPY I+ILLE+AIRNCD FQ
Sbjct  1    MAAENAFNTILKTLEKPDGGEFGKYYCLPALNDPRIDKLPYCIKILLESAIRNCDEFQ  58



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M +E+PFK I  +L K  GG FGK+YSLPALNDPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  1    MVNESPFKSILKTLEKADGGAFGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDEFQ  58



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            MA+ENPF  I  +L  P GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F
Sbjct  1    MATENPFNSILKTLENPEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEF  57



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A+ N +  I T L +PG G EFGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  86   FERRFASAATRNTYDEILTGLKRPGAGDEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  145

Query  611  NCDNFQ  628
            NCD+FQ
Sbjct  146  NCDDFQ  151



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  434  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  610
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLP L DPRID+LPYSIRILLE+AIR
Sbjct  88   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPRLADPRIDRLPYSIRILLESAIR  147

Query  611  NCDNFQ  628
            NCD FQ
Sbjct  148  NCDEFQ  153



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  437  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  616
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+KLPYSI+ILLE+AIRNC
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLESAIRNC  104

Query  617  DNFQ  628
            DNFQ
Sbjct  105  DNFQ  108



>ref|XP_002976825.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
 gb|EFJ21935.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
Length=949

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  437  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  616
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+KLPYSI+ILLE+AIRNC
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLESAIRNC  104

Query  617  DNFQ  628
            DNFQ
Sbjct  105  DNFQ  108



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++LPYSIRIL+E+AIRNCDNF+
Sbjct  35   SEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVESAIRNCDNFK  91



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  440  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  616
            R +ATMA  +  F  + TSLPKPGGGE+GK+YSLPALND RI++LPYSIR LLE+AIRNC
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLESAIRNC  133

Query  617  DNFQ  628
            D FQ
Sbjct  134  DGFQ  137



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  440  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  616
            R +ATMA  +  F  + TSLPKPGGGE+GK+YSLPALND RI++LPYSIR LLE+AIRNC
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLESAIRNC  133

Query  617  DNFQ  628
            D FQ
Sbjct  134  DGFQ  137



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  500  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            KPGGGEFGKFY LPALNDPRIDKLPYSIRILLE+AIRNCDNFQ
Sbjct  1    KPGGGEFGKFYRLPALNDPRIDKLPYSIRILLESAIRNCDNFQ  43



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +2

Query  455  MASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            M SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+LP SI++LLE+AIRNCD FQ
Sbjct  1    MGSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLESAIRNCDEFQ  59



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  14   ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIRNCDEFQ  71



>ref|XP_004166975.1| PREDICTED: aconitate hydratase 1-like, partial [Cucumis sativus]
Length=466

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEF  57



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +2

Query  446  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDN  622
            +   A+ N +  I TSL KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIRNCD 
Sbjct  5    VVLAATRNSYDEILTSLAKPGGGPEFGKYYSLPALSDPRIERLPYSIRILLESAIRNCDE  64

Query  623  FQ  628
            FQ
Sbjct  65   FQ  66



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEF  57



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEF  57



>ref|XP_001770969.1| predicted protein [Physcomitrella patens]
 gb|EDQ64299.1| predicted protein [Physcomitrella patens]
Length=898

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            AS+NPF  + T LPK  GG +G++YSL  LNDPR+D+LPYSIR LLE+AIRNCDNFQ
Sbjct  6    ASKNPFSNLVTDLPKASGGSYGQYYSLVKLNDPRVDELPYSIRYLLESAIRNCDNFQ  62



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  449  ATMASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            A   SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+LP SI++LLE+AIRNCD F
Sbjct  26   AEQRSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLESAIRNCDEF  85

Query  626  Q  628
            Q
Sbjct  86   Q  86



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  458   ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
             A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQ
Sbjct  1069  ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIRNCDEFQ  1126



>gb|EMT24311.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1009

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            F    T LPKPGGGE+GKFYS+PALNDP+IDKLPY IRILLE+A+RN DNFQ
Sbjct  120  FAKTLTILPKPGGGEYGKFYSIPALNDPKIDKLPYCIRILLESAVRNYDNFQ  171



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +2

Query  482  IFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            I T+L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQ
Sbjct  17   ILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQ  66



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            ++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIRNCD FQ
Sbjct  11   AKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIRNCDEFQ  67



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 58/106 (55%), Gaps = 38/106 (36%)
 Frame = +2

Query  320  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  490
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M           
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM-----------  98

Query  491  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
                                    D+LPYSIRIL+E+AIRNCDNFQ
Sbjct  99   ------------------------DRLPYSIRILIESAIRNCDNFQ  120



>emb|CDY44621.1| BnaC04g06410D [Brassica napus]
Length=99

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            SENPF+ I  +L    GG+FG +YSL ALND RIDKLPYSIRILLE+AIRNCD FQ
Sbjct  10   SENPFRSILKTLD--DGGKFGNYYSLRALNDSRIDKLPYSIRILLESAIRNCDEFQ  63



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +2

Query  512  GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            GEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQ
Sbjct  20   GEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQ  58



>emb|CDX91508.1| BnaC04g06420D [Brassica napus]
Length=82

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            L KP GG+FG +YSL ALND RIDKLPYSIRILLE+AIRNC  FQ
Sbjct  2    LEKPDGGKFGNYYSLRALNDSRIDKLPYSIRILLESAIRNCHEFQ  46



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 5/56 (9%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + NP+K    +L KP  G  GK+YSLPALNDPR+DKLPYSI+ILLE+ IRNCDNFQ
Sbjct  16   AANPYK----NLVKPLEGH-GKYYSLPALNDPRVDKLPYSIKILLESCIRNCDNFQ  66



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 11/58 (19%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI           E+AIRNCD FQ
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRI-----------ESAIRNCDEFQ  47



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 5/56 (9%)
 Frame = +2

Query  461  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            + NP+K    +L KP  G  GK+YSLPALNDPR++KLPYSI+ILLE+ IRNCDNFQ
Sbjct  16   AANPYK----NLVKPLEGH-GKYYSLPALNDPRVEKLPYSIKILLESCIRNCDNFQ  66



>gb|EJY70620.1| Aconitate hydratase 1 family protein [Oxytricha trifallax]
Length=892

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +2

Query  455  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            M   NPF+ +   L   G  +  K+YSLPALNDPR++KLP+S+R+LLE+A+RNCD F
Sbjct  1    MEKANPFQNVLQELQVEG--QSYKYYSLPALNDPRVEKLPFSVRVLLESALRNCDEF  55



>gb|ACG25861.1| hypothetical protein [Zea mays]
Length=55

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +2

Query  467  NPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            N +  I T L +PGGGE F K+Y+L  L+ P ID+  YSIRI LE+AIRNCD F
Sbjct  2    NLYVEITTGLRRPGGGEEFSKYYNLHVLSHPWIDQFSYSIRIYLESAIRNCDGF  55



>ref|XP_004031131.1| hypothetical protein IMG5_146680 [Ichthyophthirius multifiliis]
 gb|EGR29895.1| hypothetical protein IMG5_146680 [Ichthyophthirius multifiliis]
Length=909

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  458  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  625
            + +NPF+  F +L K  G  +  FYSLP LND R++KLPYSIR+LLE+A+RNCD F
Sbjct  14   SQKNPFQKTFKNL-KVDGKSY-NFYSLPDLNDSRVEKLPYSIRVLLESAVRNCDEF  67



>emb|CDW89012.1| aconitate hydratase 1 family protein [Stylonychia lemnae]
Length=921

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +2

Query  422  VLNDFH-RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  598
            +LN  H R  +T   +NP+  + ++L    G +   FY+LPAL D RI +LPYS+R+LLE
Sbjct  17   LLNKTHQRSFSTGPQKNPYASVLSNLTV--GNQKYSFYNLPALQDQRIQRLPYSVRVLLE  74

Query  599  AAIRNCDNF  625
            +A+RNCD F
Sbjct  75   SAVRNCDEF  83



>ref|XP_002111662.1| hypothetical protein TRIADDRAFT_63287 [Trichoplax adhaerens]
 gb|EDV25629.1| hypothetical protein TRIADDRAFT_63287 [Trichoplax adhaerens]
Length=891

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +2

Query  467  NPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQ  628
            NPF  I  +     G E  +FYSLP LND R DKLP+SIR+LLE+A+RNCDNFQ
Sbjct  3    NPFDRILKNTQI--GEENFQFYSLPDLNDGRYDKLPFSIRVLLESAVRNCDNFQ  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250