BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS165H04

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606961.1|  PREDICTED: SUMO-activating enzyme subunit 2        193   7e-54   Nicotiana tomentosiformis
ref|XP_006362029.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    191   2e-53   
ref|XP_009765006.1|  PREDICTED: SUMO-activating enzyme subunit 2        191   2e-53   Nicotiana sylvestris
gb|KJB47536.1|  hypothetical protein B456_008G030900                    186   4e-53   Gossypium raimondii
ref|XP_010251621.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   6e-53   Nelumbo nucifera [Indian lotus]
ref|XP_011088448.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   9e-53   Sesamum indicum [beniseed]
ref|XP_004230873.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    189   2e-52   Solanum lycopersicum
ref|XP_006423381.1|  hypothetical protein CICLE_v100281691mg            177   2e-52   
emb|CDO97017.1|  unnamed protein product                                188   3e-52   Coffea canephora [robusta coffee]
gb|KJB47539.1|  hypothetical protein B456_008G030900                    186   6e-52   Gossypium raimondii
gb|KJB47537.1|  hypothetical protein B456_008G030900                    187   1e-51   Gossypium raimondii
ref|XP_010942467.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    186   1e-51   Elaeis guineensis
gb|KJB32554.1|  hypothetical protein B456_005G246300                    184   3e-51   Gossypium raimondii
ref|XP_010107832.1|  SUMO-activating enzyme subunit 2                   184   4e-51   
gb|KJB32553.1|  hypothetical protein B456_005G246300                    185   6e-51   Gossypium raimondii
ref|XP_007042098.1|  SUMO-activating enzyme 2 isoform 2                 183   8e-51   
ref|XP_007042097.1|  SUMO-activating enzyme 2 isoform 1                 184   1e-50   Theobroma cacao [chocolate]
ref|XP_007042099.1|  SUMO-activating enzyme 2 isoform 3                 183   1e-50   
ref|XP_008797037.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    184   2e-50   Phoenix dactylifera
ref|XP_008777005.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    184   2e-50   
gb|KDO49458.1|  hypothetical protein CISIN_1g006294mg                   178   6e-50   Citrus sinensis [apfelsine]
ref|XP_007199741.1|  hypothetical protein PRUPE_ppa002704mg             182   7e-50   Prunus persica
ref|XP_008236951.1|  PREDICTED: SUMO-activating enzyme subunit 2        182   7e-50   Prunus mume [ume]
ref|XP_004289650.1|  PREDICTED: SUMO-activating enzyme subunit 2        181   1e-49   Fragaria vesca subsp. vesca
ref|XP_010066186.1|  PREDICTED: SUMO-activating enzyme subunit 2        181   1e-49   Eucalyptus grandis [rose gum]
ref|XP_008382303.1|  PREDICTED: SUMO-activating enzyme subunit 2        181   2e-49   Malus domestica [apple tree]
ref|XP_009372987.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    181   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_010429058.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    180   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010472141.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    180   3e-49   
ref|XP_010416892.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    180   3e-49   Camelina sativa [gold-of-pleasure]
ref|NP_179742.2|  SUMO-activating enzyme subunit 2                      180   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189570.1|  SUMO-activating enzyme subunit 2                   180   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357172.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    180   3e-49   Malus domestica [apple tree]
ref|XP_010531451.1|  PREDICTED: SUMO-activating enzyme subunit 2        179   5e-49   Tarenaya hassleriana [spider flower]
ref|NP_973506.1|  SUMO-activating enzyme subunit 2                      179   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49457.1|  hypothetical protein CISIN_1g006294mg                   178   5e-49   Citrus sinensis [apfelsine]
ref|NP_001145407.1|  uncharacterized protein LOC100278764               174   7e-49   
ref|XP_011047900.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    179   7e-49   Populus euphratica
ref|XP_011047909.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    179   7e-49   Populus euphratica
gb|KFK32895.1|  hypothetical protein AALP_AA6G302000                    179   9e-49   Arabis alpina [alpine rockcress]
gb|KDO49456.1|  hypothetical protein CISIN_1g006294mg                   179   9e-49   Citrus sinensis [apfelsine]
ref|XP_006487357.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    179   1e-48   Citrus sinensis [apfelsine]
ref|XP_002878554.1|  sumo-activating enzyme 2                           179   1e-48   
ref|XP_002283529.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    178   1e-48   Vitis vinifera
ref|XP_006293831.1|  hypothetical protein CARUB_v10022825mg             177   2e-48   Capsella rubella
gb|KDP41752.1|  hypothetical protein JCGZ_26770                         177   3e-48   Jatropha curcas
ref|XP_009412808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    177   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037464.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    177   3e-48   Populus euphratica
ref|XP_006838625.1|  hypothetical protein AMTR_s00002p00233990          176   6e-48   Amborella trichopoda
ref|XP_010690827.1|  PREDICTED: SUMO-activating enzyme subunit 2        176   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009399956.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    175   8e-48   
ref|XP_009399955.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    176   1e-47   
ref|XP_010938776.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    175   2e-47   Elaeis guineensis
ref|XP_006404595.1|  hypothetical protein EUTSA_v10000089mg             175   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_002460940.1|  hypothetical protein SORBIDRAFT_02g037850          174   3e-47   Sorghum bicolor [broomcorn]
ref|XP_008460981.1|  PREDICTED: SUMO-activating enzyme subunit 2        174   3e-47   Cucumis melo [Oriental melon]
ref|XP_007133804.1|  hypothetical protein PHAVU_011G210500g             174   4e-47   Phaseolus vulgaris [French bean]
gb|KHN19464.1|  SUMO-activating enzyme subunit 2                        173   7e-47   Glycine soja [wild soybean]
ref|XP_003540521.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    173   7e-47   Glycine max [soybeans]
ref|XP_003541605.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    172   2e-46   Glycine max [soybeans]
emb|CDY13814.1|  BnaA09g43160D                                          171   3e-46   Brassica napus [oilseed rape]
gb|KEH19101.1|  SUMO1 activating enzyme subunit 2                       171   5e-46   Medicago truncatula
ref|XP_004165550.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    171   7e-46   
ref|XP_004150065.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    171   7e-46   Cucumis sativus [cucumbers]
ref|XP_004510996.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    170   8e-46   Cicer arietinum [garbanzo]
ref|XP_002512954.1|  ubiquitin-activating enzyme E1b, putative          170   1e-45   Ricinus communis
ref|XP_004958165.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    170   1e-45   Setaria italica
emb|CDX99589.1|  BnaC04g33460D                                          169   2e-45   
ref|XP_009140282.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    169   2e-45   Brassica rapa
emb|CDY15890.1|  BnaA04g12210D                                          169   2e-45   Brassica napus [oilseed rape]
ref|XP_010236228.1|  PREDICTED: SUMO-activating enzyme subunit 2        167   7e-45   Brachypodium distachyon [annual false brome]
ref|XP_009117402.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    167   7e-45   Brassica rapa
ref|NP_001060130.1|  Os07g0586500                                       164   1e-44   
ref|XP_009347843.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    167   2e-44   Pyrus x bretschneideri [bai li]
emb|CDX82033.1|  BnaC08g35680D                                          167   2e-44   
gb|EYU37827.1|  hypothetical protein MIMGU_mgv1a002832mg                166   2e-44   Erythranthe guttata [common monkey flower]
gb|EEC82353.1|  hypothetical protein OsI_26664                          165   5e-44   Oryza sativa Indica Group [Indian rice]
gb|EMT21367.1|  SUMO-activating enzyme subunit 2                        164   1e-43   
gb|EMS58354.1|  SUMO-activating enzyme subunit 2                        164   2e-43   Triticum urartu
gb|KJB32552.1|  hypothetical protein B456_005G246300                    162   5e-43   Gossypium raimondii
emb|CBI37697.3|  unnamed protein product                                161   1e-42   Vitis vinifera
gb|EEE67493.1|  hypothetical protein OsJ_24922                          159   8e-42   Oryza sativa Japonica Group [Japonica rice]
gb|AAN03851.1|  SUMO activating enzyme 2                                159   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657898.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    155   2e-40   
gb|EPS74543.1|  hypothetical protein M569_00206                         153   9e-40   Genlisea aurea
ref|XP_001762389.1|  predicted protein                                  148   3e-38   
gb|KEQ66215.1|  putative ubiquitin-like activating enzyme               148   5e-38   Aureobasidium melanogenum CBS 110374
ref|XP_002990197.1|  SUMO activating enzyme 2                           148   5e-38   
ref|XP_002992493.1|  SUMO activating enzyme 2                           148   5e-38   
ref|XP_002505850.1|  SUMO1 activating enzyme subunit 2                  145   7e-37   Micromonas commoda
gb|KEQ95428.1|  hypothetical protein AUEXF2481DRAFT_5033                144   1e-36   Aureobasidium subglaciale EXF-2481
ref|XP_001775802.1|  predicted protein                                  144   1e-36   
ref|XP_003063899.1|  SUMO1 activating enzyme subunit 2                  144   2e-36   Micromonas pusilla CCMP1545
gb|KEQ89414.1|  hypothetical protein M438DRAFT_401525                   144   2e-36   Aureobasidium pullulans EXF-150
gb|KEQ72622.1|  ThiF family protein                                     144   2e-36   Aureobasidium namibiae CBS 147.97
gb|KID76746.1|  Molybdenum cofactor biosynthesis, MoeB                  142   2e-35   Metarhizium brunneum ARSEF 3297
gb|KIN01521.1|  hypothetical protein OIDMADRAFT_104066                  141   2e-35   Oidiodendron maius Zn
ref|XP_004991968.1|  hypothetical protein PTSG_06582                    141   2e-35   Salpingoeca rosetta
gb|EXU99576.1|  ubiquitin activating enzyme (E1) subunit UBA2 fam...    142   2e-35   Metarhizium robertsii
gb|KFG79382.1|  putative ubiquitin-activating enzyme UBA2               142   3e-35   Metarhizium anisopliae
gb|KID88908.1|  Molybdenum cofactor biosynthesis, MoeB                  142   3e-35   Metarhizium guizhouense ARSEF 977
ref|XP_007776555.1|  ubiquitin-like 1-activating enzyme E1 B            140   3e-35   Coniosporium apollinis CBS 100218
gb|KIE02655.1|  Molybdenum cofactor biosynthesis, MoeB                  142   3e-35   Metarhizium majus ARSEF 297
ref|XP_007818741.1|  Ubiquitin-activating enzyme, E1, active site...    142   3e-35   Metarhizium robertsii ARSEF 23
gb|KFX51507.1|  Ubiquitin-activating enzyme E1-like                     135   3e-35   Talaromyces marneffei PM1
ref|XP_007809976.1|  putative ubiquitin-activating enzyme UBA2          141   4e-35   Metarhizium acridum CQMa 102
emb|CCU82288.1|  NEDD8-activating enzyme E1 catalytic subunit/ubi...    140   7e-35   Blumeria graminis f. sp. hordei DH14
gb|KFX51510.1|  Ubiquitin-activating enzyme E1-like                     135   7e-35   Talaromyces marneffei PM1
ref|XP_003709447.1|  SUMO-activating enzyme subunit uba-2               140   7e-35   Magnaporthe oryzae 70-15
emb|CDP27100.1|  Putative Ubiquitin-activating enzyme E1-like           139   9e-35   Podospora anserina S mat+
gb|EHK15498.1|  hypothetical protein TRIVIDRAFT_38683                   139   1e-34   Trichoderma virens Gv29-8
gb|ELQ38550.1|  SUMO-activating enzyme subunit uba-2                    140   1e-34   Magnaporthe oryzae Y34
ref|XP_001909380.1|  hypothetical protein                               139   1e-34   Podospora anserina S mat+
ref|XP_006812144.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    130   2e-34   Saccoglossus kowalevskii
gb|AHG26147.1|  ubiquitin-activating enzyme E1-like protein             138   2e-34   Shiraia sp. slf14
gb|KFY09724.1|  hypothetical protein V491_08009                         138   2e-34   Pseudogymnoascus sp. VKM F-3775
gb|KFY98743.1|  hypothetical protein V498_01273                         138   2e-34   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|XP_007584112.1|  putative ubiquitin-like activating enzyme pr...    138   3e-34   
ref|XP_001660971.1|  AAEL010641-PA                                      138   3e-34   
ref|XP_003657600.1|  hypothetical protein THITE_2171547                 138   3e-34   Thielavia terrestris NRRL 8126
ref|XP_002545122.1|  hypothetical protein UREG_04639                    137   3e-34   Uncinocarpus reesii 1704
gb|EKG19357.1|  hypothetical protein MPH_03220                          137   4e-34   Macrophomina phaseolina MS6
dbj|GAM85103.1|  hypothetical protein ANO11243_031060                   137   4e-34   fungal sp. No.11243
ref|XP_009050922.1|  hypothetical protein LOTGIDRAFT_178117             137   4e-34   Lottia gigantea
gb|KIW48196.1|  hypothetical protein PV06_00809                         136   4e-34   Exophiala oligosperma
emb|CAF89656.1|  unnamed protein product                                132   4e-34   Tetraodon nigroviridis
emb|CEJ79950.1|  hypothetical protein VHEMI00161                        138   4e-34   Torrubiella hemipterigena
gb|EPQ63820.1|  hypothetical protein BGT96224_4887                      137   4e-34   Blumeria graminis f. sp. tritici 96224
gb|KFZ11212.1|  hypothetical protein V502_07664                         137   4e-34   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY06738.1|  hypothetical protein V492_07786                         137   4e-34   Pseudogymnoascus sp. VKM F-4246
emb|CEJ79951.1|  hypothetical protein VHEMI00161                        138   4e-34   Torrubiella hemipterigena
gb|KFY85661.1|  hypothetical protein V500_08228                         137   4e-34   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KIV90271.1|  hypothetical protein PV10_07592                         136   4e-34   Exophiala mesophila
gb|KFY38951.1|  hypothetical protein V494_04157                         137   5e-34   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_007741285.1|  ubiquitin-activating enzyme E1 C                   136   5e-34   Cladophialophora psammophila CBS 110553
gb|KIW92031.1|  hypothetical protein Z519_07013                         135   6e-34   Cladophialophora bantiana CBS 173.52
gb|KFX98161.1|  hypothetical protein O988_04493                         137   7e-34   Pseudogymnoascus sp. VKM F-3808
ref|XP_001849594.1|  ubiquitin-activating enzyme E1                     137   7e-34   Culex quinquefasciatus
gb|KFX85719.1|  hypothetical protein V490_09456                         137   8e-34   Pseudogymnoascus sp. VKM F-3557
gb|KFY45166.1|  hypothetical protein V495_03087                         137   8e-34   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_011108689.1|  hypothetical protein H072_2702                     136   9e-34   
emb|CCE26846.1|  related to ubiquitin-activating enzyme homolog UBA2    137   9e-34   Claviceps purpurea 20.1
gb|KFZ12488.1|  hypothetical protein V501_04200                         136   1e-33   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EMR88301.1|  putative family protein                                 137   1e-33   Botrytis cinerea BcDW1
gb|KFY75005.1|  hypothetical protein V499_05024                         136   1e-33   Pseudogymnoascus sp. VKM F-103
emb|CEJ00366.1|  hypothetical protein RMCBS344292_14423                 135   1e-33   Rhizopus microsporus
gb|KFY62206.1|  hypothetical protein V496_04690                         136   1e-33   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_008869322.1|  hypothetical protein H310_06150                    135   1e-33   Aphanomyces invadans
ref|XP_006665443.1|  ubiquitin-like activating enzyme, putative         137   1e-33   Cordyceps militaris CM01
gb|EHK40736.1|  hypothetical protein TRIATDRAFT_148461                  136   1e-33   Trichoderma atroviride IMI 206040
ref|XP_004359730.1|  sumo-activating enzyme subunit 2                   136   1e-33   Cavenderia fasciculata
ref|XP_001596160.1|  hypothetical protein SS1G_02376                    136   1e-33   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001555288.1|  hypothetical protein BC1G_05993                    136   1e-33   
gb|KIX98729.1|  hypothetical protein Z520_05190                         134   2e-33   Fonsecaea multimorphosa CBS 102226
ref|XP_002679801.1|  ubiquitin-like 1 activating enzyme E1B             135   2e-33   Naegleria gruberi strain NEG-M
emb|CEJ03477.1|  hypothetical protein RMCBS344292_17459                 135   2e-33   Rhizopus microsporus
ref|NP_001135121.1|  SUMO-activating enzyme subunit 2                   136   2e-33   Salmo salar
ref|XP_009519056.1|  hypothetical protein PHYSODRAFT_349758             135   2e-33   Phytophthora sojae
gb|KIW20094.1|  hypothetical protein PV08_00669                         134   2e-33   Exophiala spinifera
emb|CEG80759.1|  hypothetical protein RMATCC62417_15055                 135   2e-33   Rhizopus microsporus
ref|XP_005844208.1|  hypothetical protein CHLNCDRAFT_27175              135   2e-33   Chlorella variabilis
gb|KIW57409.1|  hypothetical protein PV05_05960                         134   2e-33   Exophiala xenobiotica
dbj|GAA84113.1|  ubiquitin-like activating enzyme                       135   2e-33   Aspergillus kawachii IFO 4308
ref|XP_007737799.1|  ubiquitin-activating enzyme E1 C                   134   2e-33   Capronia epimyces CBS 606.96
ref|XP_011431808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    135   2e-33   Crassostrea gigas
gb|KFX51509.1|  Ubiquitin-activating enzyme E1-like                     135   3e-33   Talaromyces marneffei PM1
ref|XP_001268153.1|  ubiquitin-like activating enzyme (UbaB), put...    135   3e-33   Aspergillus clavatus NRRL 1
ref|XP_007295294.1|  ThiF family protein                                135   3e-33   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KEZ46093.1|  hypothetical protein SAPIO_CDS0942                      135   3e-33   Scedosporium apiospermum
gb|KDR14472.1|  SUMO-activating enzyme subunit 2                        135   3e-33   Zootermopsis nevadensis
ref|XP_001820796.2|  ubiquitin-activating enzyme E1-like protein        135   3e-33   
gb|KIV85796.1|  hypothetical protein PV11_01454                         134   3e-33   Exophiala sideris
gb|EIT74958.1|  SMT3/SUMO-activating complex, catalytic component...    135   4e-33   Aspergillus oryzae 3.042
ref|XP_002376522.1|  ubiquitin-like activating enzyme (UbaB), put...    135   4e-33   Aspergillus flavus NRRL3357
ref|XP_001211541.1|  conserved hypothetical protein                     134   4e-33   Aspergillus terreus NIH2624
ref|XP_006690724.1|  ubiquitin-activating enzyme-like protein           135   4e-33   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_004069788.1|  PREDICTED: SUMO-activating enzyme subunit 2        135   4e-33   Oryzias latipes [Japanese rice fish]
gb|KEF60034.1|  ubiquitin-activating enzyme E1 C                        133   4e-33   Exophiala aquamarina CBS 119918
gb|ELR05791.1|  hypothetical protein GMDG_01869                         135   4e-33   Pseudogymnoascus destructans 20631-21
emb|CDQ59515.1|  unnamed protein product                                135   4e-33   Oncorhynchus mykiss
ref|XP_006797529.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   4e-33   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002145297.1|  ubiquitin-like activating enzyme (UbaB), put...    134   4e-33   Talaromyces marneffei ATCC 18224
gb|AEE63129.1|  unknown                                                 132   4e-33   Dendroctonus ponderosae
ref|XP_008309250.1|  PREDICTED: SUMO-activating enzyme subunit 2        135   4e-33   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002594236.1|  hypothetical protein BRAFLDRAFT_65085              128   5e-33   Branchiostoma floridae
dbj|GAM34770.1|  SUMO E1-like activator                                 134   5e-33   Talaromyces cellulolyticus
ref|XP_008725192.1|  hypothetical protein G647_02624                    133   5e-33   Cladophialophora carrionii CBS 160.54
ref|XP_007238038.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    135   5e-33   
ref|XP_008087072.1|  Activating enzyme of the ubiquitin-like protein    134   5e-33   Glarea lozoyensis ATCC 20868
gb|KIX01739.1|  hypothetical protein Z518_09465                         133   5e-33   Rhinocladiella mackenziei CBS 650.93
ref|XP_007759649.1|  ubiquitin-activating enzyme E1 C                   133   5e-33   Cladophialophora yegresii CBS 114405
gb|EQL34861.1|  ubiquitin-like 1-activating enzyme E1 B                 134   6e-33   Blastomyces dermatitidis ATCC 26199
gb|EGE81131.1|  ubiquitin-activating enzyme                             134   6e-33   Blastomyces dermatitidis ATCC 18188
ref|XP_660054.1|  hypothetical protein AN2450.2                         134   6e-33   Aspergillus nidulans FGSC A4
gb|EXK45779.1|  ubiquitin-like 1-activating enzyme E1 B                 134   6e-33   Fusarium oxysporum f. sp. melonis 26406
gb|EWZ48440.1|  ubiquitin-like 1-activating enzyme E1 B                 134   6e-33   Fusarium oxysporum Fo47
gb|EEQ91823.1|  ubiquitin-activating enzyme                             134   6e-33   Blastomyces dermatitidis ER-3
ref|XP_002621726.1|  ubiquitin-like activating enzyme UbaB              134   6e-33   Blastomyces gilchristii SLH14081
gb|EXL53769.1|  ubiquitin-like 1-activating enzyme E1 B                 134   6e-33   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|KIW06569.1|  hypothetical protein PV09_02998                         134   6e-33   Verruconis gallopava
ref|XP_750939.1|  ubiquitin-like activating enzyme (UbaB)               134   6e-33   Aspergillus fumigatus Af293
ref|XP_008601913.1|  ThiF family protein                                135   7e-33   Beauveria bassiana ARSEF 2860
ref|XP_003439482.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   7e-33   Oreochromis niloticus
ref|XP_005751567.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   8e-33   Pundamilia nyererei
ref|XP_007793896.1|  putative family protein                            134   8e-33   
gb|KFX51511.1|  Ubiquitin-activating enzyme E1-like                     135   8e-33   Talaromyces marneffei PM1
gb|KIW65692.1|  hypothetical protein PV04_07925                         132   8e-33   Phialophora americana
ref|XP_003666760.1|  hypothetical protein MYCTH_2311735                 134   8e-33   Thermothelomyces thermophila ATCC 42464
gb|KFA63748.1|  hypothetical protein S40285_01953                       134   8e-33   Stachybotrys chlorohalonata IBT 40285
gb|KIW83513.1|  hypothetical protein Z517_02758                         132   8e-33   Fonsecaea pedrosoi CBS 271.37
ref|XP_004564679.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   8e-33   Maylandia zebra
ref|XP_006965352.1|  predicted protein                                  134   8e-33   Trichoderma reesei QM6a
ref|XP_008410714.1|  PREDICTED: SUMO-activating enzyme subunit 2        134   8e-33   Poecilia reticulata
ref|XP_007553256.1|  PREDICTED: SUMO-activating enzyme subunit 2        134   8e-33   Poecilia formosa
ref|XP_005751568.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   8e-33   
ref|XP_005449438.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   9e-33   
gb|EWZ02354.1|  ubiquitin-like 1-activating enzyme E1 B                 134   9e-33   Fusarium oxysporum FOSC 3-a
ref|XP_008284749.1|  PREDICTED: SUMO-activating enzyme subunit 2        134   9e-33   Stegastes partitus
ref|XP_009844967.1|  hypothetical protein H257_17773                    133   1e-32   Aphanomyces astaci
gb|EXK45780.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. melonis 26406
gb|EWZ48441.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum Fo47
gb|EXL53770.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EXK45778.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. melonis 26406
gb|EXM33949.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_008712970.1|  hypothetical protein HMPREF1541_10077              134   1e-32   Cyphellophora europaea CBS 101466
ref|XP_007724302.1|  ubiquitin-activating enzyme E1 C                   132   1e-32   Capronia coronata CBS 617.96
gb|EWZ48439.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum Fo47
gb|EXA42005.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. pisi HDV247
gb|EXL53768.1|  ubiquitin-like 1-activating enzyme E1 B                 133   1e-32   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_002487254.1|  ubiquitin-like activating enzyme (UbaB), put...    133   1e-32   Talaromyces stipitatus ATCC 10500
ref|XP_001394085.1|  ubiquitin-activating enzyme E1-like protein        133   1e-32   Aspergillus niger CBS 513.88
emb|CBJ28586.1|  conserved unknown protein                              129   1e-32   Ectocarpus siliculosus
ref|XP_003069148.1|  ThiF family protein                                133   1e-32   Coccidioides posadasii C735 delta SOWgp
ref|XP_001240084.1|  hypothetical protein CIMG_09705                    133   1e-32   Coccidioides immitis RS
ref|XP_010882326.1|  PREDICTED: SUMO-activating enzyme subunit 2        133   1e-32   Esox lucius
ref|XP_003698305.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    134   2e-32   Apis florea [dwarf honeybee]
ref|XP_001638517.1|  predicted protein                                  133   2e-32   Nematostella vectensis
gb|EXM33950.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum f. sp. vasinfectum 25433
gb|KFH63366.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Mortierella verticillata NRRL 6337
gb|EWZ02355.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum FOSC 3-a
gb|EWZ02353.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum FOSC 3-a
ref|XP_005814976.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    133   2e-32   Xiphophorus maculatus
gb|KHJ31919.1|  putative family protein                                 133   2e-32   Erysiphe necator
gb|EXM07019.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EFA83622.1|  sumo-activating enzyme subunit 2                        133   2e-32   Heterostelium album PN500
gb|EXM33948.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXM07021.1|  ubiquitin-like 1-activating enzyme E1 B                 132   2e-32   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|KIW23223.1|  hypothetical protein PV07_11441                         131   2e-32   Cladophialophora immunda
gb|EXA42004.1|  ubiquitin-like 1-activating enzyme E1 B                 133   2e-32   Fusarium oxysporum f. sp. pisi HDV247
gb|ENN71609.1|  hypothetical protein YQE_11708                          132   2e-32   Dendroctonus ponderosae
gb|KEY64505.1|  hypothetical protein S7711_07252                        133   2e-32   Stachybotrys chartarum IBT 7711
gb|EXA42006.1|  ubiquitin-like 1-activating enzyme E1 B                 132   2e-32   Fusarium oxysporum f. sp. pisi HDV247
gb|EZG00032.1|  ubiquitin-activating enzyme E1-like protein             127   2e-32   Trichophyton rubrum MR1459
ref|XP_001258177.1|  ubiquitin-like activating enzyme (UbaB), put...    132   2e-32   Aspergillus fischeri NRRL 181
ref|XP_008892081.1|  hypothetical protein PPTG_02637                    132   2e-32   Phytophthora parasitica INRA-310
gb|ETI49760.1|  hypothetical protein F443_06536                         132   2e-32   Phytophthora parasitica P1569
gb|AAF31704.1|AF218864_1  Smt3 activating enzyme 2                      133   2e-32   Drosophila melanogaster
ref|XP_001971368.1|  GG14919                                            133   2e-32   Drosophila erecta
gb|ESZ89787.1|  hypothetical protein SBOR_9825                          133   2e-32   Sclerotinia borealis F-4128
gb|KFA81890.1|  hypothetical protein S40288_01743                       133   2e-32   Stachybotrys chartarum IBT 40288
gb|KFA47747.1|  hypothetical protein S40293_07149                       133   2e-32   Stachybotrys chartarum IBT 40293
ref|XP_006641254.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    133   2e-32   
gb|ETP47472.1|  hypothetical protein F442_06579                         132   2e-32   Phytophthora parasitica P10297
gb|EXM07020.1|  ubiquitin-like 1-activating enzyme E1 B                 132   2e-32   Fusarium oxysporum f. sp. cubense tropical race 4 54006
ref|XP_002094123.1|  GE20372                                            133   3e-32   Drosophila yakuba
dbj|BAE58794.1|  unnamed protein product                                132   3e-32   Aspergillus oryzae RIB40
ref|XP_007906080.1|  PREDICTED: SUMO-activating enzyme subunit 2        132   3e-32   Callorhinchus milii [Australian ghost shark]
gb|EER43692.1|  ubiquitin-activating enzyme                             132   3e-32   Histoplasma capsulatum H143
gb|ERZ96130.1|  hypothetical protein GLOINDRAFT_340840                  132   3e-32   
gb|AAI52219.1|  Uba2 protein                                            132   3e-32   Danio rerio [leopard danio]
ref|XP_009296133.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    132   3e-32   Danio rerio [leopard danio]
ref|NP_998528.1|  SUMO-activating enzyme subunit 2                      132   3e-32   Danio rerio [leopard danio]
ref|NP_524756.2|  Smt3 activating enzyme 2                              133   3e-32   Drosophila melanogaster
gb|KFY23096.1|  hypothetical protein V493_06095                         132   3e-32   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
sp|Q7SXG4.2|SAE2_DANRE  RecName: Full=SUMO-activating enzyme subu...    132   3e-32   Danio rerio [leopard danio]
ref|XP_009296132.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    132   3e-32   Danio rerio [leopard danio]
gb|EEH05567.1|  ubiquitin-activating enzyme                             132   3e-32   Histoplasma capsulatum G186AR
gb|KGQ07453.1|  Ubiquitin-activating enzyme E1-like protein             133   3e-32   Beauveria bassiana D1-5
gb|EYE96412.1|  ubiquitin-like activating enzyme                        132   3e-32   Aspergillus ruber CBS 135680
gb|AAF25197.1|AF193553_1  ubiquitin-like protein activating enzyme      133   3e-32   
gb|KDO17056.1|  hypothetical protein SPRG_17525                         130   3e-32   
gb|KDB18330.1|  putative ubiquitin-activating enzyme UBA2               133   3e-32   
ref|XP_001957576.1|  GF10481                                            133   4e-32   
ref|XP_314735.3|  AGAP008637-PA                                         132   4e-32   
ref|XP_003052062.1|  predicted protein                                  132   4e-32   
ref|XP_009154156.1|  ubiquitin-activating enzyme E1 C                   130   4e-32   
gb|KHE82261.1|  hypothetical protein GE21DRAFT_1318969                  132   4e-32   
gb|EYB33068.1|  hypothetical protein FG05_06030                         132   4e-32   
emb|CEF87872.1|  unnamed protein product                                132   4e-32   
gb|EEH22393.2|  hypothetical protein PABG_04604                         132   4e-32   
gb|EGC50026.1|  ubiquitin-activating enzyme                             132   4e-32   
ref|XP_011393552.1|  ubiquitin-activating enzyme E1 3                   132   4e-32   
ref|XP_008797038.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    131   4e-32   
emb|CCI48953.1|  unnamed protein product                                131   5e-32   
ref|XP_009852618.1|  hypothetical protein NEUTE1DRAFT_123449            132   5e-32   
ref|XP_002999118.1|  ubiquitin-activating enzyme (E1), putative         132   5e-32   
ref|XP_009010030.1|  hypothetical protein HELRODRAFT_71557              131   5e-32   
ref|XP_002024697.1|  GL22481                                            132   5e-32   
gb|EXK45777.1|  ubiquitin-like 1-activating enzyme E1 B                 132   5e-32   
gb|EWZ48438.1|  ubiquitin-like 1-activating enzyme E1 B                 132   5e-32   
gb|KFB46233.1|  AGAP008637-PA-like protein                              132   5e-32   
gb|EXL53767.1|  ubiquitin-like 1-activating enzyme E1 B                 132   6e-32   
ref|XP_010760227.1|  hypothetical protein PADG_05005                    131   6e-32   
emb|CCF32438.1|  ThiF family protein                                    132   7e-32   
ref|XP_001354264.1|  GA20416                                            132   7e-32   
ref|XP_003344688.1|  hypothetical protein SMAC_07257                    132   7e-32   
gb|EWZ02352.1|  ubiquitin-like 1-activating enzyme E1 B                 132   7e-32   
gb|ENH68682.1|  Ubiquitin-activating enzyme E1-like protein             132   7e-32   
ref|XP_001604879.2|  PREDICTED: SUMO-activating enzyme subunit 2        132   7e-32   
ref|XP_007595322.1|  ThiF family protein                                132   7e-32   
gb|EXM33947.1|  ubiquitin-like 1-activating enzyme E1 B                 132   8e-32   
ref|XP_007733501.1|  ubiquitin-like 1-activating enzyme E1 B            131   8e-32   
gb|EGU88031.1|  hypothetical protein FOXB_01514                         132   8e-32   
gb|EMT68231.1|  Ubiquitin-activating enzyme E1-like protein             132   8e-32   
ref|XP_011253684.1|  PREDICTED: SUMO-activating enzyme subunit 2        131   9e-32   
ref|XP_002401331.1|  ubiquitin-activating enzyme E1b, putative          130   9e-32   
ref|XP_009254336.1|  hypothetical protein FPSE_02942                    131   9e-32   
gb|EFQ31190.1|  ThiF family protein                                     132   1e-31   
ref|XP_002008124.1|  GI11997                                            132   1e-31   
gb|ENH81397.1|  ubiquitin-like activating enzyme                        132   1e-31   
ref|XP_002029665.1|  GM24970                                            132   1e-31   
ref|XP_002084058.1|  GD13019                                            131   1e-31   
ref|XP_001983944.1|  GH15287                                            131   1e-31   
ref|XP_969731.1|  PREDICTED: SUMO-activating enzyme subunit 2           130   1e-31   
ref|XP_002793028.1|  ubiquitin-activating enzyme                        130   1e-31   
ref|XP_003481872.2|  PREDICTED: SUMO-activating enzyme subunit 2-...    128   1e-31   
ref|XP_007539546.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   1e-31   
ref|XP_001225714.1|  hypothetical protein CHGG_08058                    130   1e-31   
ref|XP_003796130.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   1e-31   
ref|NP_595945.1|  SUMO E1-like activator enzyme Fub2 (predicted)        130   1e-31   
dbj|GAA97515.1|  hypothetical protein E5Q_04193                         130   1e-31   
ref|XP_007702777.1|  hypothetical protein COCSADRAFT_123063             130   1e-31   
ref|XP_011499019.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    131   1e-31   
dbj|GAM22192.1|  hypothetical protein SAMD00019534_053670               130   1e-31   
ref|XP_003757217.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   1e-31   
ref|XP_010346346.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   1e-31   
ref|NP_001094049.1|  SUMO-activating enzyme subunit 2                   130   1e-31   
dbj|BAE37349.1|  unnamed protein product                                130   1e-31   
gb|KDO27496.1|  hypothetical protein SPRG_07085                         130   1e-31   
ref|NP_057891.1|  SUMO-activating enzyme subunit 2                      130   2e-31   
ref|XP_004450344.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   2e-31   
dbj|BAE30671.1|  unnamed protein product                                130   2e-31   
ref|XP_007683286.1|  hypothetical protein COCMIDRAFT_32498              130   2e-31   
gb|KIL91419.1|  ubiquitin-like 1-activating enzyme e1 b                 130   2e-31   
ref|XP_004523822.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    131   2e-31   
ref|XP_010750151.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   2e-31   
ref|XP_008572925.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   2e-31   
emb|CDQ73597.1|  unnamed protein product                                130   2e-31   
ref|XP_004439757.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   2e-31   
ref|XP_005530190.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   2e-31   
gb|AFP23391.1|  SUMO-activating enzyme subunit 2                        130   2e-31   
pdb|3KYD|B  Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermed...    129   2e-31   
ref|XP_003175970.1|  SUMO-activating enzyme subunit uba-2               130   2e-31   
gb|KIW21474.1|  hypothetical protein PV08_02054                         130   2e-31   
ref|NP_001025742.1|  SUMO-activating enzyme subunit 2                   129   2e-31   
ref|NP_001083988.1|  ubiquitin-like modifier activating enzyme 2        130   2e-31   
gb|KFM64473.1|  SUMO-activating enzyme subunit 2                        130   2e-31   
sp|Q7ZY60.2|SAE2B_XENLA  RecName: Full=SUMO-activating enzyme sub...    130   2e-31   
ref|XP_008720513.1|  hypothetical protein HMPREF1541_07969              128   2e-31   
gb|KIW36807.1|  hypothetical protein PV06_10929                         130   2e-31   
ref|XP_009153072.1|  ubiquitin-like 1-activating enzyme E1 B            130   2e-31   
ref|XP_007994449.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    130   2e-31   
emb|CAB98247.1|  related to ubiquitin-activating enzyme homolog UBA2    130   2e-31   
ref|XP_005258460.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   2e-31   
ref|XP_005588845.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   2e-31   
ref|XP_001797609.1|  hypothetical protein SNOG_07265                    129   2e-31   
ref|XP_007994451.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   3e-31   
gb|KFH43379.1|  Ubiquitin-activating enzyme E1-like protein             130   3e-31   
ref|XP_003416367.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   3e-31   
emb|CCT67045.1|  related to ubiquitin-activating enzyme homolog UBA2    130   3e-31   
gb|EUN25064.1|  hypothetical protein COCVIDRAFT_104517                  130   3e-31   
ref|XP_004636900.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   3e-31   
gb|EPS32945.1|  hypothetical protein PDE_07906                          130   3e-31   
ref|XP_007708023.1|  hypothetical protein COCCADRAFT_1533               130   3e-31   
gb|EZF27677.1|  hypothetical protein H100_00355                         128   3e-31   
ref|XP_006985054.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    130   3e-31   
gb|EKV15800.1|  Ubiquitin-like activating enzyme (UbaB), putative       129   3e-31   
ref|XP_008255503.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   3e-31   
ref|XP_006985055.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   3e-31   
ref|XP_003011004.1|  hypothetical protein ARB_02736                     129   3e-31   
ref|XP_004060519.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   3e-31   
ref|XP_005176919.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   3e-31   
ref|XP_011195668.1|  PREDICTED: SUMO-activating enzyme subunit 2        130   3e-31   
ref|XP_004715881.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   3e-31   
ref|XP_005400360.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
ref|XP_008030482.1|  hypothetical protein SETTUDRAFT_165650             129   4e-31   
ref|XP_005588844.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   4e-31   
ref|XP_009192384.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
gb|EFX06220.1|  ubiquitin-like activating enzyme                        130   4e-31   
ref|XP_010357930.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
pdb|1Y8Q|B  Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp C...    129   4e-31   
ref|NP_005490.1|  SUMO-activating enzyme subunit 2                      129   4e-31   
ref|NP_001076850.1|  SUMO-activating enzyme subunit 2                   129   4e-31   
gb|KGO39327.1|  Molybdenum cofactor biosynthesis, MoeB                  129   4e-31   
ref|XP_001091974.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    129   4e-31   
ref|XP_005152234.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   4e-31   
ref|XP_008165241.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    129   4e-31   
ref|XP_005152235.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   4e-31   
ref|XP_010765042.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
ref|XP_005330675.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
ref|XP_003280049.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    129   4e-31   
emb|CAB66839.1|  hypothetical protein                                   129   4e-31   
dbj|BAG37902.1|  unnamed protein product                                129   4e-31   
ref|XP_001417248.1|  predicted protein                                  128   4e-31   
ref|XP_004600771.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   4e-31   
gb|EGD95638.1|  ubiquitin-activating enzyme E1                          129   4e-31   
emb|CDM31363.1|  Ubiquitin-activating enzyme E1-like                    129   4e-31   
ref|XP_006010426.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   5e-31   
gb|EWG43007.1|  ubiquitin-like 1-activating enzyme E1 B                 129   5e-31   
gb|EGE08007.1|  SUMO-activating enzyme subunit uba-2                    129   5e-31   
gb|AAD23914.1|AF079566_1  ubiquitin-like protein activating enzyme      129   5e-31   
gb|EZF30669.1|  hypothetical protein H101_05698                         129   5e-31   
dbj|BAG51158.1|  unnamed protein product                                129   5e-31   
gb|ETN64121.1|  ubiquitin-activating enzyme E1                          129   5e-31   
ref|XP_006010427.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   5e-31   
ref|XP_008255502.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   5e-31   
ref|XP_005498006.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-li...    127   5e-31   
ref|XP_007914799.1|  putative family protein                            129   5e-31   
ref|XP_005368497.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   5e-31   
ref|XP_008837662.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   5e-31   
ref|XP_004902220.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   5e-31   
ref|XP_002762047.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   5e-31   
ref|XP_003025232.1|  hypothetical protein TRV_00598                     129   5e-31   
ref|XP_003977790.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    129   5e-31   
ref|XP_006926858.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   5e-31   
ref|XP_007126498.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   5e-31   
ref|XP_010987427.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_006217089.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_004284202.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_008065601.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_002847388.1|  ubiquitin-activating enzyme                        129   6e-31   
ref|XP_004765242.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_011288288.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_004810606.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_004450343.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   6e-31   
ref|XP_004690601.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
pdb|3KYC|B  Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic       129   6e-31   
ref|XP_533699.3|  PREDICTED: SUMO-activating enzyme subunit 2 iso...    129   6e-31   
ref|XP_007471025.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_002569011.1|  Pc21g20210                                         129   6e-31   
ref|XP_001220315.1|  hypothetical protein CHGG_01094                    127   6e-31   
ref|XP_002046921.1|  GJ12222                                            129   6e-31   
ref|XP_007165150.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   6e-31   
ref|XP_004413809.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   6e-31   
ref|XP_392715.4|  PREDICTED: SUMO-activating enzyme subunit 2 iso...    129   6e-31   
ref|XP_003977791.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    129   6e-31   
ref|XP_003706783.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   7e-31   
gb|EMD91706.1|  hypothetical protein COCHEDRAFT_1175946                 129   7e-31   
ref|XP_006564548.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    129   7e-31   
ref|XP_006613941.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    129   7e-31   
ref|XP_011310203.1|  PREDICTED: SUMO-activating enzyme subunit 2        129   8e-31   
gb|KEF53060.1|  ubiquitin-like 1-activating enzyme E1 B                 129   8e-31   
ref|XP_007272627.1|  ubiquitin-like activating enzyme                   129   8e-31   
ref|XP_006887910.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    128   8e-31   
ref|XP_001362253.2|  PREDICTED: SUMO-activating enzyme subunit 2        129   8e-31   
gb|AGC75067.1|  SUMO-activating enzyme subunit 2                        129   9e-31   
ref|XP_010829530.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    129   9e-31   
ref|XP_003836277.1|  similar to ubiquitin-activating enzyme             128   9e-31   
ref|XP_004371657.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   9e-31   
ref|XP_003467243.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
gb|EWM25223.1|  sumo-activating enzyme subunit 2                        129   1e-30   
ref|XP_008730096.1|  hypothetical protein G647_07560                    128   1e-30   
ref|XP_006867382.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
ref|XP_002171880.1|  SUMO E1-like activator enzyme Fub2                 128   1e-30   
ref|XP_008613648.1|  hypothetical protein SDRG_09489                    127   1e-30   
ref|XP_007956141.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
ref|XP_011054419.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
ref|XP_007721724.1|  ubiquitin-like 1-activating enzyme E1 B            128   1e-30   
ref|XP_003229749.2|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
ref|XP_011337948.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   1e-30   
gb|EWG43008.1|  ubiquitin-like 1-activating enzyme E1 B                 127   1e-30   
ref|XP_003231193.1|  SUMO activating enzyme subunit 2                   128   1e-30   
gb|EZF27675.1|  hypothetical protein H100_00355                         128   1e-30   
ref|XP_002112065.1|  hypothetical protein TRIADDRAFT_24020              127   1e-30   
gb|KIY01361.1|  hypothetical protein Z520_02913                         128   1e-30   
gb|KIV87473.1|  hypothetical protein PV11_03016                         127   2e-30   
ref|XP_007872179.1|  hypothetical protein PNEG_00306                    127   2e-30   
ref|XP_002065725.1|  GK19989                                            128   2e-30   
ref|XP_007804226.1|  hypothetical protein EPUS_00379                    126   2e-30   
ref|XP_001539458.1|  conserved hypothetical protein                     127   2e-30   
gb|KIW64195.1|  hypothetical protein PV04_09148                         127   2e-30   
emb|CDW59968.1|  ubiquitin activating enzyme E1                         126   2e-30   
ref|WP_028833217.1|  hypothetical protein                               126   2e-30   
ref|XP_011117640.1|  hypothetical protein AOL_s00006g29                 127   2e-30   
ref|XP_011198105.1|  PREDICTED: SUMO-activating enzyme subunit 2        128   2e-30   
gb|KIW82338.1|  hypothetical protein Z517_05365                         127   2e-30   
ref|XP_011154187.1|  PREDICTED: SUMO-activating enzyme subunit 2        127   2e-30   
gb|EFN88226.1|  SUMO-activating enzyme subunit 2                        127   2e-30   
ref|XP_006096030.1|  PREDICTED: SUMO-activating enzyme subunit 2        127   2e-30   
ref|XP_002426836.1|  ubiquitin-activating enzyme E1b, putative          127   2e-30   
gb|KIR87042.1|  ubiquitin-activating enzyme E1 C                        125   2e-30   
gb|KIW60414.1|  hypothetical protein PV05_00630                         127   3e-30   
ref|XP_007760767.1|  ubiquitin-like 1-activating enzyme E1 B            127   3e-30   
gb|EFW17221.1|  NEDD8 activating enzyme                                 125   3e-30   
gb|KIR48160.1|  ubiquitin-activating enzyme E1 C                        125   3e-30   
ref|XP_002835647.1|  hypothetical protein                               127   3e-30   
ref|XP_003071635.1|  ThiF family protein                                125   3e-30   
emb|CCA14752.1|  ubiquitinactivating enzyme (E1) putative               126   3e-30   
ref|XP_003192779.1|  NEDD8 activating enzyme                            125   3e-30   
ref|XP_007512390.1|  predicted protein                                  127   3e-30   



>ref|XP_009606961.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana tomentosiformis]
Length=652

 Score =   193 bits (490),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAREAVLKFRP I+I PYHANVKDP+F VDFF+
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIRITPYHANVKDPDFNVDFFK  102



>ref|XP_006362029.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Solanum tuberosum]
Length=652

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAREAVLKFRP IKI PYHAN KDP F VDFF+
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIKITPYHANAKDPEFNVDFFK  102



>ref|XP_009765006.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana sylvestris]
Length=651

 Score =   191 bits (486),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ++AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLAAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAREAVLKFRP I+I PYHANVKDP+F VDFF+
Sbjct  61   KHVGQSKAKVAREAVLKFRPHIRITPYHANVKDPDFNVDFFK  102



>gb|KJB47536.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47540.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=410

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+++
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKE  103



>ref|XP_010251621.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nelumbo nucifera]
Length=647

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQLLAIKKAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVL+FRP I I PYHANVKDP F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLRFRPHISITPYHANVKDPEFNVDFFK  102



>ref|XP_011088448.1| PREDICTED: SUMO-activating enzyme subunit 2 [Sesamum indicum]
Length=648

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASE+Q+SAIK AKVLMVGAGGIGCELLK LALSGF+D+HIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEQQLSAIKGAKVLMVGAGGIGCELLKTLALSGFKDVHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPNISITPYHANVKDPEFNVDFFK  102



>ref|XP_004230873.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Solanum 
lycopersicum]
Length=650

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEE +SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEHLSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAR+AVL+FRP IKI PYHANVKDP F VDFF+
Sbjct  61   KHVGQSKAKVARDAVLRFRPHIKITPYHANVKDPEFNVDFFK  102



>ref|XP_006423381.1| hypothetical protein CICLE_v100281691mg, partial [Citrus clementina]
 gb|ESR36621.1| hypothetical protein CICLE_v100281691mg, partial [Citrus clementina]
Length=176

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFK  102



>emb|CDO97017.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+E+Q+SAIK +KVLMVGAGGIGCELLK LALS FQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MATEQQLSAIKGSKVLMVGAGGIGCELLKTLALSEFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP+F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPNISITPYHANVKDPDFNVDFFK  102



>gb|KJB47539.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47541.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=539

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+++
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKE  103



>gb|KJB47537.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=651

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASEEQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEEQISAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDF+++
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFYKE  103



>ref|XP_010942467.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Elaeis guineensis]
Length=644

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASWSQLEAIKTAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVLKFRP I I P+HANVKDP F VDFF+D
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPHHANVKDPEFNVDFFKD  103



>gb|KJB32554.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=523

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA++EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MAAQEQLSAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDFF++
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFFKE  103



>ref|XP_010107832.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
 gb|EXC17232.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
Length=601

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASE   SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASENHFSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVK P+F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKGPDFDVDFFK  102



>gb|KJB32553.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=648

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA++EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MAAQEQLSAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+FRP I I PYHANVK+  F VDFF++
Sbjct  61   SHVGQSKAKVARDAVLRFRPNISITPYHANVKESRFNVDFFKE  103



>ref|XP_007042098.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
 gb|EOX97929.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
Length=525

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFF++
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKE  103



>ref|XP_007042097.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
 gb|EOX97928.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
Length=649

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFF++
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKE  103



>ref|XP_007042099.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
 gb|EOX97930.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
Length=578

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS+EQ+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQEQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAR+AVL+ RP I I PYHANVK+  F VDFF++
Sbjct  61   SHVGQSKAKVARDAVLRVRPNISITPYHANVKESRFNVDFFKE  103



>ref|XP_008797037.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775121.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=645

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKDPEFNVEFFK  102



>ref|XP_008777005.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=655

 Score =   184 bits (466),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAR+AVLKFRP I I PYHANVKDP F V+FF+
Sbjct  61   CHVGQSKAKVARDAVLKFRPHINITPYHANVKDPEFNVEFFK  102



>gb|KDO49458.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=410

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFK  102



>ref|XP_007199741.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
 gb|EMJ00940.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
Length=642

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + + A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLKHLPAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVLKFRP I I PYHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLKFRPHISITPYHANVKDSDFNVDFFK  102



>ref|XP_008236951.1| PREDICTED: SUMO-activating enzyme subunit 2 [Prunus mume]
Length=642

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + + A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLKHLPAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVLKFRP I I PYHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLKFRPHISITPYHANVKDSDFNVDFFK  102



>ref|XP_004289650.1| PREDICTED: SUMO-activating enzyme subunit 2 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+++   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MATQKHSPAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVKDP+F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITSYHANVKDPDFNVDFFK  102



>ref|XP_010066186.1| PREDICTED: SUMO-activating enzyme subunit 2 [Eucalyptus grandis]
Length=650

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M S   +SAIK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSPPPLSAIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAREAVL+FRP I I PYHANVKDP+F VDFF+
Sbjct  61   KHVGQSKAKVAREAVLRFRPNISITPYHANVKDPDFNVDFFK  102



>ref|XP_008382303.1| PREDICTED: SUMO-activating enzyme subunit 2 [Malus domestica]
Length=644

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFF++
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFKN  103



>ref|XP_009372987.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Pyrus x bretschneideri]
Length=643

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFK  102



>ref|XP_010429058.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=625

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFK  102



>ref|XP_010472141.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=628

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFK  102



>ref|XP_010416892.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=624

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDVDFFK  102



>ref|NP_179742.2| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 dbj|BAC42380.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|ACI31306.1| At2g21470 [Arabidopsis thaliana]
 gb|AEC07181.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=625

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFK  102



>ref|NP_001189570.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 gb|AEC07183.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=628

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFK  102



>ref|XP_008357172.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Malus domestica]
Length=644

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + ++A+K AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFK  102



>ref|XP_010531451.1| PREDICTED: SUMO-activating enzyme subunit 2 [Tarenaya hassleriana]
Length=647

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            +SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQS
Sbjct  11   LSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  70

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            KAKVAR+AVL+FRP I I PYHANVKDP F VDFF+
Sbjct  71   KAKVARDAVLRFRPHINITPYHANVKDPEFDVDFFK  106



>ref|NP_973506.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 sp|Q9SJT1.1|SAE2_ARATH RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Protein 
EMBRYO DEFECTIVE 2764; AltName: Full=Ubiquitin-like 
1-activating enzyme E1B [Arabidopsis thaliana]
 gb|AAD23691.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|AEC07182.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=700

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFK  102



>gb|KDO49457.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=563

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFK  102



>ref|NP_001145407.1| uncharacterized protein LOC100278764 [Zea mays]
 gb|ACG47331.1| hypothetical protein [Zea mays]
Length=370

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            +AS E+  A+KAAKVLMVGAGGIGCELLK LALSGF DIHIID+DTIEVSNLNRQFLFRQ
Sbjct  4    VASSEE--AVKAAKVLMVGAGGIGCELLKTLALSGFSDIHIIDLDTIEVSNLNRQFLFRQ  61

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKD +F VDFF+
Sbjct  62   SHVGQSKAKVARDAVLKFRPNINITPYHANVKDSHFNVDFFK  103



>ref|XP_011047900.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Populus 
euphratica]
Length=657

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS +   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFK  102



>ref|XP_011047909.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Populus 
euphratica]
Length=652

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS +   AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFK  102



>gb|KFK32895.1| hypothetical protein AALP_AA6G302000 [Arabis alpina]
Length=624

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA++EQ SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQEQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F  DFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINISSYHANVKNPEFDADFFK  102



>gb|KDO49456.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=652

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFK  102



>ref|XP_006487357.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Citrus sinensis]
Length=651

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M SE Q+ AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MVSERQLEAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP + I  +HANVKDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPQMSITAHHANVKDPKFNVEFFK  102



>ref|XP_002878554.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54813.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
Length=678

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+++Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MATQQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFK  102



>ref|XP_002283529.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Vitis 
vinifera]
Length=634

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS ++  AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASHQRSPAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVKDP+F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITSYHANVKDPDFNVDFFK  102



>ref|XP_006293831.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
 gb|EOA26729.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
Length=624

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MA+ +Q SAIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MAALQQQSAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPNINIRSYHANVKNPEFDVDFFK  102



>gb|KDP41752.1| hypothetical protein JCGZ_26770 [Jatropha curcas]
Length=628

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS +  SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I PYHANVKD  F VDF +
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITPYHANVKDTFFNVDFLK  102



>ref|XP_009412808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412809.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412810.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQD+HIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MGSDLKEEAIKRAKVLMVGAGGIGCELLKTLALSGFQDVHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKF P I I PYHANVKDP F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFMPQINITPYHANVKDPGFNVDFFK  102



>ref|XP_011037464.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Populus 
euphratica]
Length=648

 Score =   177 bits (449),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS +   AIK AKVLMVGAGGIGCELLK LALS FQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASLQHSQAIKGAKVLMVGAGGIGCELLKTLALSDFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I PYHAN KD NF VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHISITPYHANAKDSNFNVDFFK  102



>ref|XP_006838625.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
 gb|ERN01194.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
Length=652

 Score =   176 bits (447),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MASE+++ AIK AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASEQELQAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             HVGQSKAKVAREAVLKFRP I I  +HANVK+  F VDFF+
Sbjct  61   CHVGQSKAKVAREAVLKFRPNINITAHHANVKNSEFNVDFFK  102



>ref|XP_010690827.1| PREDICTED: SUMO-activating enzyme subunit 2 [Beta vulgaris subsp. 
vulgaris]
Length=643

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS+ Q++AIK AK+LMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASQHQLNAIKGAKILMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVK  +F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPHISITAYHANVKSSDFKVDFFK  102



>ref|XP_009399956.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSDSKTEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+ VL+F P I I PYHANVKDP F VDFF+
Sbjct  61   SHVGQSKAKVARDVVLRFMPRICITPYHANVKDPEFNVDFFK  102



>ref|XP_009399955.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   176 bits (445),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M S+ +  AIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MDSDSKTEAIKRAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+ VL+F P I I PYHANVKDP F VDFF+
Sbjct  61   SHVGQSKAKVARDVVLRFMPRICITPYHANVKDPEFNVDFFK  102



>ref|XP_010938776.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Elaeis 
guineensis]
Length=648

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS  Q+ AIK AKVLMVGAGGIGCELLK LALSGF+DI+IIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASGSQLEAIKRAKVLMVGAGGIGCELLKTLALSGFRDIYIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I P HAN+KDP F V+FF+
Sbjct  61   SHVGQSKAKVARDAVLKFRPHINITPCHANIKDPEFDVEFFK  102



>ref|XP_006404595.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
 gb|ESQ46048.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
Length=626

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M ++ Q SA+KAAKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MDTQHQQSALKAAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRR  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+FRP I I  YHANVK+P F  DFF+
Sbjct  61   SHVGQSKAKVARDAVLRFRPHINIRSYHANVKNPEFDADFFK  102



>ref|XP_002460940.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
 gb|EER97461.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
Length=641

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK LALSGF DIHIID+DTIEVSNLNRQFLFRQSHVGQSKAK
Sbjct  14   VKAAKVLMVGAGGIGCELLKTLALSGFSDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAK  73

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I PYHANVKD NF VDFF+
Sbjct  74   VARDAVLKFRPNINITPYHANVKDSNFNVDFFK  106



>ref|XP_008460981.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cucumis melo]
Length=641

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q+SAIK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSAIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDFF+
Sbjct  61   SHVGLSKAKVARDAVLRFRPHVSITSYHANVKNQEFNVDFFK  102



>ref|XP_007133804.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
 gb|ESW05798.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
Length=642

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            + +K AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQSHVGQSK
Sbjct  9    AVVKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  68

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVLKFRP I I PYHANVKDP F VDFF+
Sbjct  69   AKVARDAVLKFRPHIDITPYHANVKDPEFNVDFFK  103



>gb|KHN19464.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=636

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSK
Sbjct  7    SVIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSK  66

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVLKFRP I I PYHANVKDP F VDFF+
Sbjct  67   AKVARDAVLKFRPHINITPYHANVKDPEFNVDFFK  101



>ref|XP_003540521.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
Length=636

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSK
Sbjct  7    SVIKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSK  66

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVLKFRP I I PYHANVKDP F VDFF+
Sbjct  67   AKVARDAVLKFRPHINITPYHANVKDPEFNVDFFK  101



>ref|XP_003541605.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
 gb|KHN37632.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=638

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ HVGQSKAK
Sbjct  11   IKDAKVLMVGAGGIGCELLKTLALSGFPDIHIIDMDTIEVSNLNRQFLFRQFHVGQSKAK  70

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I PYHANVKDP F VDFF+
Sbjct  71   VARDAVLKFRPHINITPYHANVKDPEFNVDFFK  103



>emb|CDY13814.1| BnaA09g43160D [Brassica napus]
Length=630

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S+I+ AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  11   SSIQGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  70

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVLKFRP I I  YHANVK+P F VDFF+
Sbjct  71   AKVARDAVLKFRPHINIRSYHANVKNPEFDVDFFK  105



>gb|KEH19101.1| SUMO1 activating enzyme subunit 2 [Medicago truncatula]
Length=635

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S IK AKVLMVGAGGIGCELLK LALSGF +IHIIDMDTIEVSNLNRQFLFRQSHVGQSK
Sbjct  4    SIIKDAKVLMVGAGGIGCELLKTLALSGFSEIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  63

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVLKFRP I I  YHANVKDP+F VDFF+
Sbjct  64   AKVARDAVLKFRPKINITSYHANVKDPDFNVDFFK  98



>ref|XP_004165550.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Cucumis sativus]
Length=641

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q+S IK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSVIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDF +
Sbjct  61   SHVGLSKAKVARDAVLRFRPQVSITSYHANVKNQEFNVDFLK  102



>ref|XP_004150065.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cucumis sativus]
 gb|KGN61828.1| hypothetical protein Csa_2G249830 [Cucumis sativus]
Length=641

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS++Q+S IK AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MASQQQLSVIKGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRK  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVG SKAKVAR+AVL+FRP + I  YHANVK+  F VDF +
Sbjct  61   SHVGLSKAKVARDAVLRFRPQVSITSYHANVKNQEFNVDFLK  102



>ref|XP_004510996.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cicer arietinum]
Length=628

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS    S IK AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASSSS-SPIKDAKVLMVGAGGIGCELLKTLALSGFSDIHIIDMDTIEVSNLNRQFLFRQ  59

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVLKFRP I I  YHANVK P+F VDFF+
Sbjct  60   SHVGQSKAKVARDAVLKFRPHINITSYHANVKGPDFNVDFFK  101



>ref|XP_002512954.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
 gb|EEF49457.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
Length=644

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            M+S    SA+K AKVLMVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+
Sbjct  1    MSSLLHSSAVKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRK  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAR+AVL+F+P I+I  YHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVARDAVLRFKPHIRITSYHANVKDSDFNVDFFK  102



>ref|XP_004958165.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Setaria italica]
Length=638

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK LALSGF D+HIID+DTIEVSNLNRQFLFRQSHVGQSKAK
Sbjct  11   VKAAKVLMVGAGGIGCELLKTLALSGFSDVHIIDLDTIEVSNLNRQFLFRQSHVGQSKAK  70

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I PYHANVKD  F V+FF+
Sbjct  71   VARDAVLKFRPNINITPYHANVKDSTFNVEFFK  103



>emb|CDX99589.1| BnaC04g33460D [Brassica napus]
Length=629

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  10   SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  69

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  70   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFK  104



>ref|XP_009140282.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=627

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  8    SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  67

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  68   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFK  102



>emb|CDY15890.1| BnaA04g12210D [Brassica napus]
Length=627

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            SAI+ AKVLMVGAGGIGCELLK LALSGF DIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  8    SAIQGAKVLMVGAGGIGCELLKTLALSGFHDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  67

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            AKVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  68   AKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFK  102



>ref|XP_010236228.1| PREDICTED: SUMO-activating enzyme subunit 2 [Brachypodium distachyon]
Length=623

 Score =   167 bits (424),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS     A+KAAKVLMVGAGGIGCELLK LAL+GF DIH+ID+DTIEVSNLNRQFLFR+
Sbjct  1    MASAASEEAVKAAKVLMVGAGGIGCELLKTLALTGFSDIHLIDLDTIEVSNLNRQFLFRK  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKA VAR+AVLKFRP I I  YHANVKD  F VDFF+
Sbjct  61   SHVGQSKAHVARDAVLKFRPKINISSYHANVKDAQFNVDFFK  102



>ref|XP_009117402.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=630

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S I+ AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSK
Sbjct  11   SFIQGAKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSK  70

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +KVAR+AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  71   SKVARDAVLRFRPHINIRSYHANVKNPEFDVDFFK  105



>ref|NP_001060130.1| Os07g0586500 [Oryza sativa Japonica Group]
 dbj|BAF22044.1| Os07g0586500 [Oryza sativa Japonica Group]
 dbj|BAH00126.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I  YHANVKD  F V+FF+
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFK  107



>ref|XP_009347843.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=644

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  261  MASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            MAS + ++A+  AKVLMVGAGGIG E    LALSGFQDIHIIDMDTIEVSNLNRQFLFRQ
Sbjct  1    MASRKHLAAVMGAKVLMVGAGGIGSEPFTTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  60

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SHVGQSKAKVAREAVLKFRP I I  YHANVKD +F VDFF+
Sbjct  61   SHVGQSKAKVAREAVLKFRPEISITSYHANVKDSDFNVDFFK  102



>emb|CDX82033.1| BnaC08g35680D [Brassica napus]
Length=628

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  297  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  476
            AKVLMVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFR+SHVGQSKAKVAR
Sbjct  14   AKVLMVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKVAR  73

Query  477  EAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +AVL+FRP I I  YHANVK+P F VDFF+
Sbjct  74   DAVLRFRPQINIRSYHANVKNPEFDVDFFK  103



>gb|EYU37827.1| hypothetical protein MIMGU_mgv1a002832mg [Erythranthe guttata]
Length=633

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFKDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            KFRP I I PYHANVKDP+F VDFF+
Sbjct  61   KFRPHISITPYHANVKDPDFNVDFFK  86



>gb|EEC82353.1| hypothetical protein OsI_26664 [Oryza sativa Indica Group]
Length=634

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I  YHANVKD  F V+FF+
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFK  107



>gb|EMT21367.1| SUMO-activating enzyme subunit 2 [Aegilops tauschii]
Length=629

 Score =   164 bits (415),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK LALSGF DIH+ID+DTIEVSNLNRQFLFR+SHVGQSKA 
Sbjct  14   VKAAKVLMVGAGGIGCELLKTLALSGFSDIHVIDLDTIEVSNLNRQFLFRKSHVGQSKAH  73

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+A+LKFRP I IE +HANVKD  F VDFF+
Sbjct  74   VARDAILKFRPNINIESHHANVKDAQFNVDFFK  106



>gb|EMS58354.1| SUMO-activating enzyme subunit 2 [Triticum urartu]
Length=639

 Score =   164 bits (414),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 4/111 (4%)
 Frame = +3

Query  234  VSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSN  413
            +SLF  +  +    Q    +AAKVLMVGAGGIGCELLK LALSGF DIH+ID+DTIEVSN
Sbjct  5    LSLFTRTSAVTKPRQ----EAAKVLMVGAGGIGCELLKTLALSGFSDIHVIDLDTIEVSN  60

Query  414  LNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            LNRQFLFR+SHVGQSKA VAR+A+LKFRP I IE +HANVKD  F VDFF+
Sbjct  61   LNRQFLFRKSHVGQSKAHVARDAILKFRPNINIESHHANVKDAQFNVDFFK  111



>gb|KJB32552.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=632

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK LALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFRD  569
            +FRP I I PYHANVK+  F VDFF++
Sbjct  61   RFRPNISITPYHANVKESRFNVDFFKE  87



>emb|CBI37697.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            +FRP I I  YHANVKDP+F VDFF+
Sbjct  61   RFRPHISITSYHANVKDPDFNVDFFK  86



>gb|EEE67493.1| hypothetical protein OsJ_24922 [Oryza sativa Japonica Group]
Length=634

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +KAAKVLMVGAGGIGCELLK L +SGF+DI IID+DTIEVSNLNRQFLFRQSHVGQSKA 
Sbjct  15   VKAAKVLMVGAGGIGCELLKTLGVSGFRDIQIIDLDTIEVSNLNRQFLFRQSHVGQSKAH  74

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VAR+AVLKFRP I I  YHANVKD  F V+FF+
Sbjct  75   VARDAVLKFRPNINITSYHANVKDAQFNVEFFK  107



>gb|AAN03851.1| SUMO activating enzyme 2 [Arabidopsis thaliana]
Length=599

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK LALSGF+DIHIIDMDTIEVSNLNRQFLFR+SHVGQSKAKVAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKVARDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            +FRP I I  YHANVK+P F VDFF+
Sbjct  61   RFRPNINIRSYHANVKNPEFDVDFFK  86



>ref|XP_006657898.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Oryza brachyantha]
Length=613

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK LALSGF+DIHIID+DTIEVSNLNRQFLFRQSHVGQSKA VAR+AVL
Sbjct  1    MVGAGGIGCELLKTLALSGFRDIHIIDLDTIEVSNLNRQFLFRQSHVGQSKAHVARDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            KFRP I I  YHANVKD  F VDFF+
Sbjct  61   KFRPNINITSYHANVKDAQFNVDFFK  86



>gb|EPS74543.1| hypothetical protein M569_00206 [Genlisea aurea]
Length=600

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK L LSGF+DIHIIDMDTIEVSNLNRQFLFRQSHVG+SKAKVA +AVL
Sbjct  1    MVGAGGIGCELLKTLVLSGFKDIHIIDMDTIEVSNLNRQFLFRQSHVGKSKAKVACDAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            +FRP + I PYHANVKD  F VDFFR
Sbjct  61   RFRPHVSIVPYHANVKDSQFNVDFFR  86



>ref|XP_001762389.1| predicted protein [Physcomitrella patens]
 gb|EDQ72856.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  309  MVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVL  488
            MVGAGGIGCELLK L L+GF+ IH+IDMDTIEVSNLNRQFLFR+SHVGQSKAKVAREAVL
Sbjct  1    MVGAGGIGCELLKTLVLTGFKHIHLIDMDTIEVSNLNRQFLFRKSHVGQSKAKVAREAVL  60

Query  489  KFRPGIKIEPYHANVKDPNFGVDFFR  566
            KFRPG++I  +HANVK+  F +DFF+
Sbjct  61   KFRPGVEIVAHHANVKNQEFDIDFFK  86



>gb|KEQ66215.1| putative ubiquitin-like activating enzyme [Aureobasidium melanogenum 
CBS 110374]
Length=622

 Score =   148 bits (374),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  276  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  455
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFTNIKNARILVVGAGGIGCELLKNLVCTGFGEIHLVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  456  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SKA VAREA  KF P +KIE YHAN+KDP F VD+FRD
Sbjct  74   SKALVAREAASKFNPNVKIEAYHANIKDPQFNVDWFRD  111



>ref|XP_002990197.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ08757.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  291  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  470
            + ++VLMVGAGGIGCELLK L L+GF +I IIDMDTIEVSNLNRQFLFR+ HVGQSKAKV
Sbjct  7    QKSRVLMVGAGGIGCELLKTLVLTGFHNIDIIDMDTIEVSNLNRQFLFRKRHVGQSKAKV  66

Query  471  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSMLF*MGXD  596
            AREAVLKFRP   +  YHANVKD  F VDF++   +   G D
Sbjct  67   AREAVLKFRPDANVTSYHANVKDEQFNVDFYQQFQVVLNGLD  108



>ref|XP_002992493.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ06431.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  291  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  470
            + ++VLMVGAGGIGCELLK L L+GF +I IIDMDTIEVSNLNRQFLFR+ HVGQSKAKV
Sbjct  7    QKSRVLMVGAGGIGCELLKTLVLTGFHNIDIIDMDTIEVSNLNRQFLFRKRHVGQSKAKV  66

Query  471  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSMLF*MGXD  596
            AREAVLKFRP   +  YHANVKD  F VDF++   +   G D
Sbjct  67   AREAVLKFRPDANVTSYHANVKDEQFNVDFYQQFQVVLNGLD  108



>ref|XP_002505850.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
 gb|ACO67108.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
Length=644

 Score =   145 bits (366),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  291  KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKV  470
            K++KVLMVGAGGIGCELLK L LSGF+DI +ID+DTI+VSNLNRQFLFR+ HVG SKAKV
Sbjct  12   KSSKVLMVGAGGIGCELLKTLVLSGFEDIEMIDLDTIDVSNLNRQFLFRKRHVGMSKAKV  71

Query  471  AREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            ARE VLKFRP  +I  +H NVKD +F VDF R
Sbjct  72   ARETVLKFRPDARIVAHHGNVKDSSFDVDFVR  103



>gb|KEQ95428.1| hypothetical protein AUEXF2481DRAFT_5033 [Aureobasidium subglaciale 
EXF-2481]
Length=623

 Score =   144 bits (364),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  276  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  455
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKQARILVVGAGGIGCELLKNLVCTGFGEIHVVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  456  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SKA VAREA  KF P +KIE +HAN+KDP F VD+FR+
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFRE  111



>ref|XP_001775802.1| predicted protein [Physcomitrella patens]
 gb|EDQ59341.1| predicted protein, partial [Physcomitrella patens]
Length=618

 Score =   144 bits (363),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 14/103 (14%)
 Frame = +3

Query  300  KVLMVGAGGIGCELLKNLALSGFQDIHI--------------IDMDTIEVSNLNRQFLFR  437
            KVLMVGAGGIGCELLK L L+GF+ IH+              IDMDTIEVSNLNRQFLFR
Sbjct  1    KVLMVGAGGIGCELLKTLVLTGFKHIHLVNFWSCTCGSPLPQIDMDTIEVSNLNRQFLFR  60

Query  438  QSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +SHVGQSKA+VAREAVLKFRPG++I  +HANVK+  F +DFF+
Sbjct  61   KSHVGQSKARVAREAVLKFRPGVEIVAHHANVKNQEFDIDFFK  103



>ref|XP_003063899.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
 gb|EEH52272.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
Length=623

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/102 (69%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +3

Query  264  ASEEQMSAI---KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLF  434
            A+ E+M+ +   +A+KVLMVGAGGIGCELLK LALSGF D+ +ID+DTI+VSNLNRQFLF
Sbjct  9    ATVEKMTDLDIARASKVLMVGAGGIGCELLKTLALSGFADVELIDLDTIDVSNLNRQFLF  68

Query  435  RQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDF  560
            R+ HVG SKAKVARE+VL FRP  KI  +H NVKD  F VDF
Sbjct  69   RRRHVGMSKAKVARESVLAFRPDAKITAHHGNVKDAAFDVDF  110



>gb|KEQ89414.1| hypothetical protein M438DRAFT_401525 [Aureobasidium pullulans 
EXF-150]
Length=621

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/97 (65%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  276  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  455
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKNARILVVGAGGIGCELLKNLVCTGFGEIHVVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  456  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            SKA VAREA  KF P +KIE +HAN+KDP F VD+FR
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFR  110



>gb|KEQ72622.1| ThiF family protein [Aureobasidium pullulans var. namibiae CBS 
147.97]
Length=623

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  276  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  455
            Q + IK A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR +H+ +
Sbjct  14   QFANIKNARILVVGAGGIGCELLKNLVCTGFGEIHLVDLDTIDLSNLNRQFLFRHAHIKK  73

Query  456  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            SKA VAREA  KF P +KIE +HAN+KDP F VD+FR+
Sbjct  74   SKALVAREAASKFNPNVKIEAHHANIKDPQFNVDWFRE  111



>gb|KID76746.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
brunneum ARSEF 3297]
Length=736

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFNVSWFR  197



>gb|KIN01521.1| hypothetical protein OIDMADRAFT_104066 [Oidiodendron maius Zn]
Length=645

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            + +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  17   TMVKEARILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  76

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            A VA++A  KF P +K+E +HAN+KDP F V++FR  +M+F
Sbjct  77   ALVAKDAAHKFNPRLKLEAHHANIKDPQFNVNWFRGFTMVF  117



>ref|XP_004991968.1| hypothetical protein PTSG_06582 [Salpingoeca rosetta]
 gb|EGD75511.1| hypothetical protein PTSG_06582 [Salpingoeca rosetta]
Length=629

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK  K+L+VGAGGIGCELLKN+AL+GFQDIH+ID+DTIE++NLNRQFLF+Q HVGQSKAK
Sbjct  20   IKQCKLLVVGAGGIGCELLKNVALAGFQDIHVIDLDTIELTNLNRQFLFQQQHVGQSKAK  79

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VARE+VL+F P + I  +HAN+ +  F + FF
Sbjct  80   VARESVLRFNPSLSITAHHANIFEDKFSLGFF  111



>gb|EXU99576.1| ubiquitin activating enzyme (E1) subunit UBA2 family protein 
[Metarhizium robertsii]
Length=705

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFR  197



>gb|KFG79382.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium anisopliae]
 gb|KID71909.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
anisopliae ARSEF 549]
Length=736

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFR  197



>gb|KID88908.1| Molybdenum cofactor biosynthesis, MoeB [Metarhizium guizhouense 
ARSEF 977]
Length=736

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFR  197



>ref|XP_007776555.1| ubiquitin-like 1-activating enzyme E1 B [Coniosporium apollinis 
CBS 100218]
 gb|EON61238.1| ubiquitin-like 1-activating enzyme E1 B [Coniosporium apollinis 
CBS 100218]
Length=624

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S IK +++LMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  16   SRIKQSRILMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  75

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+E+  KF P +KIE +HAN+KDP F VD+F+
Sbjct  76   ALVAKESAGKFNPNVKIEAHHANIKDPQFNVDWFK  110



>gb|KIE02655.1| Molybdenum cofactor biosynthesis, MoeB, partial [Metarhizium 
majus ARSEF 297]
Length=738

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFR  197



>ref|XP_007818741.1| Ubiquitin-activating enzyme, E1, active site protein [Metarhizium 
robertsii ARSEF 23]
 gb|EFZ01323.1| Ubiquitin-activating enzyme, E1, active site protein [Metarhizium 
robertsii ARSEF 23]
Length=736

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  210  TTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIID  389
            TT H    ++    +H        S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D
Sbjct  79   TTQHRPRVMARDRYNHQSLGASLNSSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVD  138

Query  390  MDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +DTI++SNLNRQFLFRQ H+ +SKA VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  139  LDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPNVKIVAHHANIKDGNFTVSWFR  197



>gb|KFX51507.1| Ubiquitin-activating enzyme E1-like, partial [Talaromyces marneffei 
PM1]
Length=223

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KFRP  K+E YHAN+KD  F +D+F
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWF  118



>ref|XP_007809976.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium acridum 
CQMa 102]
 gb|EFY90390.1| putative ubiquitin-activating enzyme UBA2 [Metarhizium acridum 
CQMa 102]
Length=738

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S++K A+VLMVGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  106  SSVKQARVLMVGAGGIGCELLKNLALTGFSEIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  165

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+E   KF P +KI  +HAN+KD NF V +FR
Sbjct  166  ALVAKEVAEKFNPTVKIVAHHANIKDGNFTVSWFR  200



>emb|CCU82288.1| NEDD8-activating enzyme E1 catalytic subunit/ubiquitin-like activating 
enzyme [Blumeria graminis f. sp. hordei DH14]
Length=634

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S+IKAA+VL+VGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SSIKAARVLLVGAGGIGCELLKNLALAGFGEIHIVDLDTIDISNLNRQFLFRHEHIKKSK  76

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +K+E Y AN+ D  F +D+F+
Sbjct  77   ALVAKEAACQFNPNVKLEAYMANIHDSKFDIDWFK  111



>gb|KFX51510.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=264

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KFRP  K+E YHAN+KD  F +D+F
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWF  118



>ref|XP_003709447.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae 70-15]
 gb|EHA56835.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae 70-15]
Length=684

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  273  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  452
            E  + +K A+VLMVGAGGIGCELLKNLAL+GF +IH +D+DTI++SNLNRQFLFR  H+ 
Sbjct  61   ETNARVKQARVLMVGAGGIGCELLKNLALAGFGEIHAVDLDTIDLSNLNRQFLFRHEHIK  120

Query  453  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +SKAKVA+EA  KF P +KIE + AN+K P F V++FR
Sbjct  121  KSKAKVAKEAAQKFNPNVKIEAHEANIKSPQFNVEWFR  158



>emb|CDP27100.1| Putative Ubiquitin-activating enzyme E1-like [Podospora anserina 
S mat+]
Length=625

 Score =   139 bits (350),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++  K ++VLMVGAGGIGCELLKNL L+GF + HI+D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTEAKKSRVLMVGAGGIGCELLKNLVLTGFGETHIVDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA EA  KF P +KI PYHAN+KDP F +++F
Sbjct  73   KALVATEAAQKFNPNVKIVPYHANIKDPQFNIEWF  107



>gb|EHK15498.1| hypothetical protein TRIVIDRAFT_38683 [Trichoderma virens Gv29-8]
Length=672

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  66   SSVKHARVLMVGAGGIGCELLKNLVLNGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  125

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            + VA+EA  +F P +KI  +HAN+KDP F V +FRD
Sbjct  126  SLVAKEAAQRFNPNVKIVAHHANIKDPEFSVPWFRD  161



>gb|ELQ38550.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae Y34]
 gb|ELQ69255.1| SUMO-activating enzyme subunit uba-2 [Magnaporthe oryzae P131]
Length=728

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  273  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  452
            E  + +K A+VLMVGAGGIGCELLKNLAL+GF +IH +D+DTI++SNLNRQFLFR  H+ 
Sbjct  61   ETNARVKQARVLMVGAGGIGCELLKNLALAGFGEIHAVDLDTIDLSNLNRQFLFRHEHIK  120

Query  453  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +SKAKVA+EA  KF P +KIE + AN+K P F V++FR
Sbjct  121  KSKAKVAKEAAQKFNPNVKIEAHEANIKSPQFNVEWFR  158



>ref|XP_001909380.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70512.1| unnamed protein product [Podospora anserina S mat+]
Length=677

 Score =   139 bits (351),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++  K ++VLMVGAGGIGCELLKNL L+GF + HI+D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTEAKKSRVLMVGAGGIGCELLKNLVLTGFGETHIVDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA EA  KF P +KI PYHAN+KDP F +++F
Sbjct  73   KALVATEAAQKFNPNVKIVPYHANIKDPQFNIEWF  107



>ref|XP_006812144.1| PREDICTED: SUMO-activating enzyme subunit 2-A-like, partial [Saccoglossus 
kowalevskii]
Length=121

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +   K+L+VGAGGIGCEL+KNL L+GFQ IH+ID+DTI+VSNLNRQFLF++ HVG+SKA+
Sbjct  17   VSCGKILVVGAGGIGCELIKNLVLTGFQSIHVIDLDTIDVSNLNRQFLFQKKHVGKSKAQ  76

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+++ L+F P + I  YH ++  P +G++FF+
Sbjct  77   VAKDSALRFNPDVDIIAYHDSIMKPEYGMNFFK  109



>gb|AHG26147.1| ubiquitin-activating enzyme E1-like protein [Shiraia sp. slf14]
Length=624

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKDARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRNEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+  KF P +KIE YH N+KDP F + +F+
Sbjct  79   VAKESAGKFNPNVKIEAYHDNIKDPRFNIAWFK  111



>gb|KFY09724.1| hypothetical protein V491_08009 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=635

 Score =   138 bits (348),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            VA+E   KF P +K+E YHAN+KD  F +D+F+  +M+F
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFKSFTMVF  117



>gb|KFY98743.1| hypothetical protein V498_01273 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=636

 Score =   138 bits (348),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL LSG+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLSGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFK  111



>ref|XP_007584112.1| putative ubiquitin-like activating enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD48423.1| putative ubiquitin-like activating enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=619

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKESRVLMVGAGGIGCELLKNLVLTGFGNIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+  KF P + IE +HAN+KDP F VD+F+
Sbjct  79   VAKESAGKFNPHVNIEAHHANIKDPEFNVDWFK  111



>ref|XP_001660971.1| AAEL010641-PA [Aedes aegypti]
 gb|EAT37350.1| AAEL010641-PA [Aedes aegypti]
Length=642

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  273  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  452
            E    I  +K+L+VGAGGIGCE+LKNL LSGFQDI IID+DTI+VSNLNRQFLF + HVG
Sbjct  12   ELQEKISNSKILVVGAGGIGCEILKNLVLSGFQDIEIIDLDTIDVSNLNRQFLFHKEHVG  71

Query  453  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +SKA VARE+ L F P +KI+ YH ++   N+GV+FF+
Sbjct  72   KSKANVARESALSFNPNVKIKAYHDSITTSNYGVNFFQ  109



>ref|XP_003657600.1| hypothetical protein THITE_2171547 [Thielavia terrestris NRRL 
8126]
 gb|AEO71264.1| hypothetical protein THITE_2171547 [Thielavia terrestris NRRL 
8126]
Length=659

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            + +K ++VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  43   AQVKQSRVLMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRQEHIKKSK  102

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            A VA+E   KF P +KI  YHAN+KDP F +++F
Sbjct  103  ALVAKEVAQKFNPAVKIVAYHANIKDPRFSIEWF  136



>ref|XP_002545122.1| hypothetical protein UREG_04639 [Uncinocarpus reesii 1704]
 gb|EEP79793.1| hypothetical protein UREG_04639 [Uncinocarpus reesii 1704]
Length=627

 Score =   137 bits (346),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  264  ASEEQMSAI-KAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQ  440
            AS +Q +AI   ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR 
Sbjct  29   ASWKQNTAIVSTSRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRH  88

Query  441  SHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
             H+ +SKA VA+EA  KFRP  K+E YHAN+KD  F V++F
Sbjct  89   EHIKKSKALVAKEAATKFRPQAKLEAYHANIKDNQFNVEWF  129



>gb|EKG19357.1| hypothetical protein MPH_03220 [Macrophomina phaseolina MS6]
Length=620

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   IKQSRVLMVGAGGIGCELLKNLVLTGFGNIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+  +F P + IE +HAN+KDP F VD+F+
Sbjct  79   VAKESAGRFNPHVNIEAHHANIKDPQFNVDWFK  111



>dbj|GAM85103.1| hypothetical protein ANO11243_031060 [fungal sp. No.11243]
Length=609

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ A++L+VGAGGIGCELLKNL  +GF +IH++D+DTI++SNLNRQFLFR SH+ +SKA 
Sbjct  18   IRQARILVVGAGGIGCELLKNLVTTGFHEIHVVDLDTIDLSNLNRQFLFRHSHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +KIE YHAN+KDP F + +F+
Sbjct  78   VAKETAGKFNPEVKIEAYHANIKDPQFNIQWFK  110



>ref|XP_009050922.1| hypothetical protein LOTGIDRAFT_178117 [Lottia gigantea]
 gb|ESO98215.1| hypothetical protein LOTGIDRAFT_178117 [Lottia gigantea]
Length=587

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +   KVL+VGAGGIGCELLKNL L+GF DI +ID+DTI+VSNLNRQFLFR+ HVG+SK++
Sbjct  13   VSNCKVLVVGAGGIGCELLKNLVLTGFSDIQVIDLDTIDVSNLNRQFLFRKEHVGKSKSQ  72

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+ LKF P + I  YH +V +P++G DFF+
Sbjct  73   VAKESALKFNPNVNIVAYHDSVMNPDYGADFFK  105



>gb|KIW48196.1| hypothetical protein PV06_00809 [Exophiala oligosperma]
Length=436

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  +E +SA++ ++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDNLLST--TSPYAGEEFVPGDETISALETSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAASFVERRVPGVKITPYNGKIQD  132



>emb|CAF89656.1| unnamed protein product [Tetraodon nigroviridis]
Length=213

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E + ++   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELVDSLATCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G SKA+VA+E+ L+F P   I  YH +V +P++ V+FFR  +L
Sbjct  70   GLSKAQVAKESALQFCPAANITAYHDSVMNPDYNVEFFRKFVL  112



>emb|CEJ79950.1| hypothetical protein VHEMI00161 [Torrubiella hemipterigena]
Length=700

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +A+K A+VLMVGAGGIGCELLKNL LSGF DIHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  94   TAVKKARVLMVGAGGIGCELLKNLVLSGFGDIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  153

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA L F P + I  +HAN+KD  F V +FR
Sbjct  154  ALVAKEAALIFNPQVNITAHHANIKDSEFTVSWFR  188



>gb|EPQ63820.1| hypothetical protein BGT96224_4887 [Blumeria graminis f. sp. 
tritici 96224]
Length=634

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            + IKAA+VL+VGAGGIGCELLKNLAL+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   TLIKAARVLLVGAGGIGCELLKNLALAGFGEIHIVDLDTIDISNLNRQFLFRHEHIKKSK  76

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +K+E Y AN+ D  F +D+F+
Sbjct  77   ALVAKEAACQFNPNVKLEAYMANIHDSKFDIDWFK  111



>gb|KFZ11212.1| hypothetical protein V502_07664 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=635

 Score =   137 bits (346),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SDVKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  76

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+E   +F P +K+E YHAN+KD  F +D+F+
Sbjct  77   ALVAKEVAQRFNPAVKLESYHANIKDAQFNIDWFK  111



>gb|KFY06738.1| hypothetical protein V492_07786 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=634

 Score =   137 bits (346),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFK  111



>emb|CEJ79951.1| hypothetical protein VHEMI00161 [Torrubiella hemipterigena]
Length=718

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +A+K A+VLMVGAGGIGCELLKNL LSGF DIHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  94   TAVKKARVLMVGAGGIGCELLKNLVLSGFGDIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  153

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA L F P + I  +HAN+KD  F V +FR
Sbjct  154  ALVAKEAALIFNPQVNITAHHANIKDSEFTVSWFR  188



>gb|KFY85661.1| hypothetical protein V500_08228 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=635

 Score =   137 bits (346),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  17   SDVKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  76

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+E   +F P +K+E YHAN+KD  F +D+F+
Sbjct  77   ALVAKEVAQRFNPAVKLESYHANIKDAQFNIDWFK  111



>gb|KIV90271.1| hypothetical protein PV10_07592 [Exophiala mesophila]
Length=435

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S F     +  EE + A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDKILST--TSPFAGEEFVPGEETIDALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V    PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAAAFVENRVPGVKITPYNGKIQD  132



>gb|KFY38951.1| hypothetical protein V494_04157 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=634

 Score =   137 bits (346),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPAVKLESYHANIKDAQFNIDWFK  111



>ref|XP_007741285.1| ubiquitin-activating enzyme E1 C [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ74185.1| ubiquitin-activating enzyme E1 C [Cladophialophora psammophila 
CBS 110553]
Length=436

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 95/143 (66%), Gaps = 13/143 (9%)
 Frame = +3

Query  117  LSSNSNSNFPAKPRLDSPFCLSM*YTTWCYRTTSHSTLSVSLFISSHLMASEEQMSAIKA  296
            +SS   +  PA PR             W Y   + ST   S +     +  EE ++A+++
Sbjct  5    ISSLLTNGTPAPPR-----------DRWTYLDRALST--TSPYAGEEFVPGEETVNALES  51

Query  297  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  476
            ++VL++GAGG+GCE+LKNLALSGF+DIH+IDMDTI+VSNLNRQFLFR S VG+SKA+VA 
Sbjct  52   SRVLVIGAGGLGCEILKNLALSGFKDIHVIDMDTIDVSNLNRQFLFRHSDVGKSKAEVAA  111

Query  477  EAVLKFRPGIKIEPYHANVKDPN  545
              V K  PG+KI PY+  ++D +
Sbjct  112  AFVEKRVPGVKITPYNGKIQDKD  134



>gb|KIW92031.1| hypothetical protein Z519_07013 [Cladophialophora bantiana CBS 
173.52]
Length=436

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y   + ST   S +     +  EE ++A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WIYLDRTLST--TSPYAGEEFVPGEETINALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFR S VG+SKA+VA   V K  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRHSDVGKSKAEVAAAFVEKRVPGVKITPYNGKIQD  132



>gb|KFX98161.1| hypothetical protein O988_04493 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=635

 Score =   137 bits (344),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFK  111



>ref|XP_001849594.1| ubiquitin-activating enzyme E1 [Culex quinquefasciatus]
 gb|EDS30540.1| ubiquitin-activating enzyme E1 [Culex quinquefasciatus]
Length=644

 Score =   137 bits (344),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I  +K+L+VGAGGIGCE+LKNL LSGFQDI IID+DTI+VSNLNRQFLF + HVG+SKA 
Sbjct  17   ISNSKILVVGAGGIGCEILKNLVLSGFQDIEIIDLDTIDVSNLNRQFLFHKEHVGKSKAN  76

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            VARE+ L F P +KI+ YH ++   N+GV FF+   L
Sbjct  77   VARESALSFNPNVKIKAYHDSITTTNYGVSFFQQFQL  113



>gb|KFX85719.1| hypothetical protein V490_09456 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=635

 Score =   137 bits (344),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFK  111



>gb|KFY45166.1| hypothetical protein V495_03087 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY60889.1| hypothetical protein V497_03283 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=635

 Score =   137 bits (344),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPTVKLESYHANIKDAQFNIDWFK  111



>ref|XP_011108689.1| hypothetical protein H072_2702 [Dactylellina haptotyla CBS 200.50]
 gb|EPS43290.1| hypothetical protein H072_2702 [Dactylellina haptotyla CBS 200.50]
Length=611

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK +K+LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLF++ H+ +SKA 
Sbjct  23   IKQSKILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFQRQHIKKSKAL  82

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            VA+E   KF P +K+  YHAN+K+P F V++F+  S++F
Sbjct  83   VAKETASKFNPNVKLTAYHANIKEPTFNVEWFKTFSLVF  121



>emb|CCE26846.1| related to ubiquitin-activating enzyme homolog UBA2 [Claviceps 
purpurea 20.1]
Length=712

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            SA+K A+VLMVGAGGIGCELLKNL L+GF ++HI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  109  SAVKQARVLMVGAGGIGCELLKNLVLTGFGEVHIVDLDTIDLSNLNRQFLFRQEHIKKSK  168

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  KF P +KI  +HAN+KD  F V +F+
Sbjct  169  ALVAKEAASKFNPHVKIVAHHANIKDDEFTVSWFK  203



>gb|KFZ12488.1| hypothetical protein V501_04200 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=635

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   +F P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQRFNPAVKLESYHANIKDAQFNIDWFK  111



>gb|EMR88301.1| putative family protein [Botrytis cinerea BcDW1]
Length=661

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            VA++A  KF P +K+E +HAN+KD  F VD+F+  +M+F
Sbjct  78   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVF  116



>gb|KFY75005.1| hypothetical protein V499_05024 [Pseudogymnoascus pannorum VKM 
F-103]
Length=635

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   +F P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQRFNPAVKLESYHANIKDAQFNIDWFK  111



>emb|CEJ00366.1| hypothetical protein RMCBS344292_14423 [Rhizopus microsporus]
Length=589

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVSNSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             ++KA VA+E+ LKF P +KI    AN+KDP F V +F+
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFK  112



>gb|KFY62206.1| hypothetical protein V496_04690 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=631

 Score =   136 bits (342),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCEL+KNL LSG+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELVKNLLLSGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P +K+E YHAN+KD  F +D+F+
Sbjct  79   VAKEVAQKFNPKVKLESYHANIKDAQFNIDWFK  111



>ref|XP_008869322.1| hypothetical protein H310_06150 [Aphanomyces invadans]
 gb|ETW02717.1| hypothetical protein H310_06150 [Aphanomyces invadans]
Length=569

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ AK+L+VGAGGIGCELLKNL LSGF DI ++D+DTI+VSNLNRQFLFR  HVGQSKA+
Sbjct  16   IEEAKILVVGAGGIGCELLKNLVLSGFGDITVVDLDTIDVSNLNRQFLFRSHHVGQSKAE  75

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E  L+F P +KI  YH N+K   + +++F+
Sbjct  76   VAKEVALQFNPRVKITAYHENIKSSRYSIEYFK  108



>ref|XP_006665443.1| ubiquitin-like activating enzyme, putative [Cordyceps militaris 
CM01]
 gb|EGX95566.1| ubiquitin-like activating enzyme, putative [Cordyceps militaris 
CM01]
Length=700

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S +K ++VLMVGAGGIGCELLKNL L GF  IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  97   SKVKQSRVLMVGAGGIGCELLKNLVLMGFGQIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  156

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            A VA+EA  +F P +KI  +HAN+KD  F V +FRD
Sbjct  157  ALVAKEAAERFNPNVKISAHHANIKDEEFTVAWFRD  192



>gb|EHK40736.1| hypothetical protein TRIATDRAFT_148461 [Trichoderma atroviride 
IMI 206040]
Length=673

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  65   SSVKHARVLMVGAGGIGCELLKNLVLNGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  124

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            A VA+EA  +F P +K+  +HAN+KD  F V +FRD
Sbjct  125  ALVAKEAAQRFNPNVKLVAHHANIKDSEFSVPWFRD  160



>ref|XP_004359730.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
 gb|EGG21879.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
Length=639

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            ++ AKVL+VGAGGIGCELLKNL LSGF+DIHIID+DTI++SNLNRQFLFR+ H+G SKAK
Sbjct  38   VQKAKVLVVGAGGIGCELLKNLVLSGFKDIHIIDLDTIDLSNLNRQFLFRKHHIGMSKAK  97

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +AREAVLK+ P + IE +  ++K+  +G  +F+
Sbjct  98   IAREAVLKYNPDVNIEAHEGDIKNQQYGHQYFQ  130



>ref|XP_001596160.1| hypothetical protein SS1G_02376 [Sclerotinia sclerotiorum 1980]
 gb|EDN99522.1| hypothetical protein SS1G_02376 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=670

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  22   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  81

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            VA++A  KF P +K+E +HAN+KD  F VD+F+  +M+F
Sbjct  82   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVF  120



>ref|XP_001555288.1| hypothetical protein BC1G_05993 [Botrytis cinerea B05.10]
Length=661

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/99 (62%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKEARILMVGAGGIGCELLKNLVLAGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD-SMLF  581
            VA++A  KF P +K+E +HAN+KD  F VD+F+  +M+F
Sbjct  78   VAKDAAHKFNPKVKLEAHHANIKDSQFNVDWFKGFTMVF  116



>gb|KIX98729.1| hypothetical protein Z520_05190 [Fonsecaea multimorphosa CBS 
102226]
Length=436

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDRILST--TSPYAGEEFVPGEETINALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFR S VG+SKA+VA   V K  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRHSDVGKSKAEVAARFVEKRVPGVKITPYNGKIQD  132



>ref|XP_002679801.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
 gb|EFC47057.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
Length=632

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  258  LMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFR  437
            L+  E  +  I+ +K+L+VGAGGIGCELLKNL LSGF++I IID+DTI++SNLNRQFLFR
Sbjct  14   LIYGEGLIEFIRTSKILVVGAGGIGCELLKNLVLSGFENIEIIDLDTIDISNLNRQFLFR  73

Query  438  QSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            Q HVG+SK+K+A+E  L F P   I  +H N+K  ++G+DFF+
Sbjct  74   QKHVGESKSKIAKETALTFNPACNIIAHHGNIKHSDYGLDFFK  116



>emb|CEJ03477.1| hypothetical protein RMCBS344292_17459 [Rhizopus microsporus]
Length=589

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVANSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             ++KA VA+E+ LKF P +KI    AN+KDP F V +F+
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFK  112



>ref|NP_001135121.1| SUMO-activating enzyme subunit 2 [Salmo salar]
 gb|ACI33764.1| SUMO-activating enzyme subunit 2 [Salmo salar]
 gb|ACI34122.1| SUMO-activating enzyme subunit 2 [Salmo salar]
Length=644

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++ A +VL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLSACRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+VL+F P   I  YH ++ +P++ V+FFR+ ML
Sbjct  70   GKSKAQVAKESVLQFCPTANITAYHDSIMNPDYNVEFFRNFML  112



>ref|XP_009519056.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
 gb|EGZ23768.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
Length=626

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            E+    +++AK+L+VGAGGIGCELLKNL LSGF DIH+ID+DTI+VSNLNRQFLFR  HV
Sbjct  11   EDLRGKVQSAKILVVGAGGIGCELLKNLVLSGFVDIHLIDLDTIDVSNLNRQFLFRSQHV  70

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            GQSKA VARE  ++F P  +I  +H N+K   F +D+F+
Sbjct  71   GQSKALVAREIAMEFNPKAQITAHHGNIKSSQFDIDYFQ  109



>gb|KIW20094.1| hypothetical protein PV08_00669 [Exophiala spinifera]
Length=436

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +   E ++A++ ++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDNVLST--TSPYAGEEFVPGNETVNALETSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAASFVERRVPGVKITPYNGKIQD  132



>emb|CEG80759.1| hypothetical protein RMATCC62417_15055 [Rhizopus microsporus]
Length=589

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            EE  + +  ++VL+VGAGGIGCELLKNL LSGF+DI +ID+DTI++SNLNRQFLF++ HV
Sbjct  14   EELYNKVANSRVLLVGAGGIGCELLKNLVLSGFRDIEVIDLDTIDISNLNRQFLFQRQHV  73

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
             ++KA VA+E+ LKF P +KI    AN+KDP F V +F+
Sbjct  74   KKAKAHVAKESALKFNPSVKINSTQANIKDPQFNVQWFK  112



>ref|XP_005844208.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
 gb|EFN52106.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
Length=638

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  264  ASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQS  443
             S E   A++ A+VL VGAGGIGCELLK L  SGF+ I +IDMDTIE+SNLNRQFLFR+ 
Sbjct  13   GSRELKRAVREARVLTVGAGGIGCELLKTLVTSGFRHIEVIDMDTIEMSNLNRQFLFRKR  72

Query  444  HVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            HVG SK+ VA EA    RPGI I  +  NVK+P FGVDFFR
Sbjct  73   HVGMSKSVVAAEAAKHMRPGIDITAWLGNVKEPRFGVDFFR  113



>gb|KIW57409.1| hypothetical protein PV05_05960 [Exophiala xenobiotica]
 gb|KIW57410.1| hypothetical protein, variant [Exophiala xenobiotica]
Length=436

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  +E ++A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDNVLST--TSPYAGEEFVPGDETINALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVD  557
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D +   D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAASFVERRVPGVKITPYNGKIQDKD--ED  136

Query  558  FFRDSMLF*MGXD  596
            ++    L   G D
Sbjct  137  YYMQFKLVICGLD  149



>dbj|GAA84113.1| ubiquitin-like activating enzyme [Aspergillus kawachii IFO 4308]
Length=616

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKPKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+PG K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAHKFQPGAKLEAYHANIKDDQFNVDWF  109



>ref|XP_007737799.1| ubiquitin-activating enzyme E1 C [Capronia epimyces CBS 606.96]
 gb|EXJ78354.1| ubiquitin-activating enzyme E1 C [Capronia epimyces CBS 606.96]
Length=436

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE + A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDRVLST--TSPYAGEEFVPGEETIDALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFR+S VG+SKA+VA   V +  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRESDVGKSKAEVAAAFVEQRVPGVKITPYNGKIQD  132



>ref|XP_011431808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Crassostrea 
gigas]
 gb|EKC24155.1| SUMO-activating enzyme subunit 2 [Crassostrea gigas]
Length=615

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  294  AAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVA  473
            + K+L+VGAGGIGCELLKNL L+GF DI +ID+DTI+VSNLNRQFLFR+ HVG+SKA+VA
Sbjct  18   SCKLLVVGAGGIGCELLKNLVLTGFHDIVVIDLDTIDVSNLNRQFLFRKEHVGKSKAQVA  77

Query  474  REAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +E+ L F P  KI  YH ++  P++GVDFF+
Sbjct  78   KESALNFNPNAKITAYHDSIMSPDYGVDFFK  108



>gb|KFX51509.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=604

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KFRP  K+E YHAN+KD  F +D+F
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWF  118



>ref|XP_001268153.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW06727.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
clavatus NRRL 1]
Length=616

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VL+VGAGGIGCELLK+L LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   IKESRVLLVGAGGIGCELLKDLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVARKFQPSAKLEAYHANIKDSQFNVDWF  109



>ref|XP_007295294.1| ThiF family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD14684.1| ThiF family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=633

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            + +K AK+LMVGAGGIGCELLKNL LSGF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  21   TMVKEAKILMVGAGGIGCELLKNLVLSGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  80

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA++A  KF P +K+E + AN+KD  F VD+F+
Sbjct  81   ALVAKDAAHKFNPSVKLEAHFANIKDAQFNVDWFK  115



>gb|KEZ46093.1| hypothetical protein SAPIO_CDS0942 [Scedosporium apiospermum]
Length=627

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +  +K+LMVGAGGIGCELLKNL LSGF+D+HI+D+DTI++SNLNRQFLFR  H+ +SK+ 
Sbjct  21   LNQSKILMVGAGGIGCELLKNLVLSGFRDVHIVDLDTIDLSNLNRQFLFRHEHIKKSKSL  80

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   KF P  +I  YHAN+KD  FGV++FR
Sbjct  81   VAKEVAQKFNPDAQIIAYHANIKDSQFGVEWFR  113



>gb|KDR14472.1| SUMO-activating enzyme subunit 2 [Zootermopsis nevadensis]
Length=617

 Score =   135 bits (339),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            E   SA++ AKVL+VGAGGIGCELLKNL LSGF+DI IID+DTI+VSNLNRQFLF + HV
Sbjct  11   ENLKSAVETAKVLVVGAGGIGCELLKNLVLSGFKDIEIIDLDTIDVSNLNRQFLFHKQHV  70

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            G+SKA VARE+ L F P   I+ YH ++    +GV FF+
Sbjct  71   GKSKAAVARESALTFNPNACIKAYHDSITSSEYGVSFFK  109



>ref|XP_001820796.2| ubiquitin-activating enzyme E1-like protein [Aspergillus oryzae 
RIB40]
Length=614

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWF  109



>gb|KIV85796.1| hypothetical protein PV11_01454 [Exophiala sideris]
Length=435

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WSYLDNVLST--TSPYAGEEFVPGEETINALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+ A   V +  PG KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAECAAAFVERRVPGFKITPYNGKIQD  132



>gb|EIT74958.1| SMT3/SUMO-activating complex, catalytic component UBA2 [Aspergillus 
oryzae 3.042]
 gb|KDE81437.1| SMT3/SUMO-activating complex, catalytic component UBA2 [Aspergillus 
oryzae 100-8]
Length=614

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWF  109



>ref|XP_002376522.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
flavus NRRL3357]
 gb|EED53276.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
flavus NRRL3357]
Length=624

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   LKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWF  109



>ref|XP_001211541.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU37325.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=582

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLK+L LSGF +IHIID+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   IRESRVLLVGAGGIGCELLKDLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+PG K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAHKFQPGAKLEAYHANIKDSQFNVDWF  109



>ref|XP_006690724.1| ubiquitin-activating enzyme-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS23482.1| ubiquitin-activating enzyme-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=662

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K +KVL+VGAGGIGCELLKNL L+GF ++H++D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  38   VKQSKVLLVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRQEHIKKSKAL  97

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF P +KI  +HAN+KD  FG+D+F
Sbjct  98   VAKEVADKFNPAVKIVAHHANIKDAQFGIDWF  129



>ref|XP_004069788.1| PREDICTED: SUMO-activating enzyme subunit 2 [Oryzias latipes]
Length=644

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLYTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+VL+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAKESVLQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>gb|KEF60034.1| ubiquitin-activating enzyme E1 C [Exophiala aquamarina CBS 119918]
Length=435

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  +E ++A++ + VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDKVLST--TSPYAGEEFVPGQETINALETSTVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQ+ VG+SKA+VA   V K  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQADVGKSKAEVAAAFVEKRVPGVKITPYNGKIQD  132



>gb|ELR05791.1| hypothetical protein GMDG_01869 [Pseudogymnoascus destructans 
20631-21]
Length=635

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+G+ +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  19   VKQARILMVGAGGIGCELLKNLLLTGYGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E   +F P +K+E YH N+KD  F +D+F+
Sbjct  79   VAKEVAQRFNPAVKLESYHTNIKDAQFNIDWFK  111



>emb|CDQ59515.1| unnamed protein product [Oncorhynchus mykiss]
Length=644

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++ A +VL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLSACRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+VL+F P   I  YH ++ +P + V+FFR+ ML
Sbjct  70   GKSKAQVAKESVLQFCPTANITAYHDSIMNPEYNVEFFRNFML  112



>ref|XP_006797529.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Neolamprologus 
brichardi]
Length=493

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P + V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPEYNVEFFRKFML  112



>ref|XP_002145297.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA28782.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
marneffei ATCC 18224]
Length=622

 Score =   134 bits (338),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KFRP  K+E YHAN+KD  F +D+F
Sbjct  87   VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWF  118



>gb|AEE63129.1| unknown [Dendroctonus ponderosae]
Length=360

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I  +KVL+VGAGGIGCE+LKNLALSGF+DI IID+DTI+VSNLNRQFLFR+ HVG+ KA 
Sbjct  20   IPKSKVLLVGAGGIGCEVLKNLALSGFRDIEIIDLDTIDVSNLNRQFLFRKEHVGKPKAV  79

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VARE++L   P +KI+ YH ++   ++G++FF+
Sbjct  80   VARESILAHNPNVKIKAYHDSILSSDYGLNFFK  112



>ref|XP_008309250.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cynoglossus semilaevis]
Length=649

 Score =   135 bits (339),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/110 (56%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  255  HLMAS--EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQF  428
            HL+ S  +E + ++   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQF
Sbjct  3    HLVGSLRKELVDSLSTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQF  62

Query  429  LFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            LF++ HVG+SKA+VA+++ L+F P   I  YH +V +P++ V+FFR  ML
Sbjct  63   LFQKKHVGKSKAQVAKDSALQFCPTANITAYHDSVMNPDYNVEFFRKFML  112



>ref|XP_002594236.1| hypothetical protein BRAFLDRAFT_65085 [Branchiostoma floridae]
 gb|EEN50247.1| hypothetical protein BRAFLDRAFT_65085 [Branchiostoma floridae]
Length=189

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            ++ +KVL+VGAGGIGCELLKNL L+ F+ I +ID+DTI+VSNLNRQFLF++ HVG+SKA+
Sbjct  16   VENSKVLVVGAGGIGCELLKNLVLTNFKYIEVIDLDTIDVSNLNRQFLFQKQHVGKSKAQ  75

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+ L+F P   I  YH ++ +P++GV+FF+
Sbjct  76   VAKESALRFNPDCNIIAYHDSITNPDYGVNFFK  108



>dbj|GAM34770.1| SUMO E1-like activator [Talaromyces cellulolyticus]
Length=615

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  27   IRESRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  86

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA++   KFRP  K+E YHAN+KD  F VD+F
Sbjct  87   VAKDVAQKFRPDSKLEAYHANIKDAQFNVDWF  118



>ref|XP_008725192.1| hypothetical protein G647_02624 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI25847.1| hypothetical protein G647_02624 [Cladophialophora carrionii CBS 
160.54]
Length=436

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE + A+++++VL++GAGG+GCE+LKNLA+SGF+DI
Sbjct  21   WTYLDGILST--TSPYAGEEFVPGEETIDALESSRVLVIGAGGLGCEILKNLAMSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVD  557
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D +   D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAAAFVERRVPGVKITPYNGKIQDKD--ED  136

Query  558  FFRDSMLF*MGXD  596
            ++    L   G D
Sbjct  137  YYMQFKLVICGLD  149



>ref|XP_007238038.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Astyanax mexicanus]
Length=642

 Score =   135 bits (339),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  267  SEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSH  446
            S+E   ++ + K+L+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ H
Sbjct  9    SKELADSVSSCKILVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKH  68

Query  447  VGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            VG+SKA+VA+E+VL+F P   I  YH ++ +P++ V+FFR   L
Sbjct  69   VGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRSFQL  112



>ref|XP_008087072.1| Activating enzyme of the ubiquitin-like protein [Glarea lozoyensis 
ATCC 20868]
 gb|EPE25753.1| Activating enzyme of the ubiquitin-like protein [Glarea lozoyensis 
ATCC 20868]
Length=597

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++LMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  2    VKEARILMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSKAL  61

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+EA   F P +K+E +HAN+KD  F V +F+
Sbjct  62   VAKEAAHVFNPNVKLEAHHANIKDAQFNVAWFK  94



>gb|KIX01739.1| hypothetical protein Z518_09465 [Rhinocladiella mackenziei CBS 
650.93]
Length=436

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++A+++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WKYLDNVLST--TSPYAGEEFVPGEETINALESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVD  557
            H+IDMDTI+VSNLNRQFLFRQ+ VG+SKA+VA   V +  PG+KI PY+  ++D +   D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQADVGKSKAEVAAAFVERRVPGVKITPYNGKIQDKD--ED  136

Query  558  FFRDSMLF*MGXD  596
            ++    L   G D
Sbjct  137  YYMQFKLVICGLD  149



>ref|XP_007759649.1| ubiquitin-activating enzyme E1 C [Cladophialophora yegresii CBS 
114405]
 gb|EXJ57115.1| ubiquitin-activating enzyme E1 C [Cladophialophora yegresii CBS 
114405]
Length=436

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE + A+++++VL++GAGG+GCE+LKNLA+SGF+DI
Sbjct  21   WTYLDRILST--TSPYAGEEFVPGEETIDALESSRVLVIGAGGLGCEILKNLAMSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVD  557
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D +   D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAAAFVERRVPGVKITPYNGKIQDKD--ED  136

Query  558  FFRDSMLF*MGXD  596
            ++    L   G D
Sbjct  137  YYMQFKLVICGLD  149



>gb|EQL34861.1| ubiquitin-like 1-activating enzyme E1 B [Blastomyces dermatitidis 
ATCC 26199]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA+E   KFR    +  YHAN+KDP F ++FF
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFF  107



>gb|EGE81131.1| ubiquitin-activating enzyme [Blastomyces dermatitidis ATCC 18188]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA+E   KFR    +  YHAN+KDP F ++FF
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFF  107



>ref|XP_660054.1| hypothetical protein AN2450.2 [Aspergillus nidulans FGSC A4]
 gb|EAA64156.1| hypothetical protein AN2450.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF86880.1| TPA: ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue; 
AFUA_6G10510) [Aspergillus nidulans FGSC A4]
Length=610

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  276  QMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQ  455
            Q + I+ ++VL+VGAGGIGCELLKNL L+GF +IH+ID+DTI++SNLNRQFLFR  H+ +
Sbjct  14   QANRIRESRVLLVGAGGIGCELLKNLLLTGFGEIHVIDLDTIDLSNLNRQFLFRHEHIKK  73

Query  456  SKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
             KA VA+E   KF+P  +IE YHAN+KD  F VD+F
Sbjct  74   PKAIVAKEVAQKFQPSARIEAYHANIKDSKFDVDWF  109



>gb|EXK45779.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EWZ48440.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93506.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EEQ91823.1| ubiquitin-activating enzyme [Blastomyces dermatitidis ER-3]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA+E   KFR    +  YHAN+KDP F ++FF
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFF  107



>ref|XP_002621726.1| ubiquitin-like activating enzyme UbaB [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ73730.1| ubiquitin-like activating enzyme UbaB [Blastomyces dermatitidis 
SLH14081]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++ IK ++V +VGAGGIGCELLKNL L+GF +IHIID+DTI++SNLNRQFLFRQ H+ +S
Sbjct  13   LTKIKKSRVFLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRQEHIKKS  72

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA+E   KFR    +  YHAN+KDP F ++FF
Sbjct  73   KALVAKEVASKFRRDASLHAYHANIKDPQFNIEFF  107



>gb|EXL53769.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=619

 Score =   134 bits (337),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|KIW06569.1| hypothetical protein PV09_02998 [Verruconis gallopava]
Length=621

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A+VLMVGAGGIGCELLKNL L+GF ++H++D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  18   VKQARVLMVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRHEHIKKSKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA+E+  +F P + IE YHAN+KD  F +D+++
Sbjct  78   VAKESAGRFNPAVTIEAYHANIKDAQFNIDWYK  110



>ref|XP_750939.1| ubiquitin-like activating enzyme (UbaB) [Aspergillus fumigatus 
Af293]
 gb|EAL88901.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
fumigatus Af293]
 gb|EDP49626.1| ubiquitin-like activating enzyme (UbaB), putative [Aspergillus 
fumigatus A1163]
Length=644

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKPKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAHKFQPNAKLEAYHANIKDSQFNVDWF  109



>ref|XP_008601913.1| ThiF family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP62510.1| ThiF family protein [Beauveria bassiana ARSEF 2860]
Length=810

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S +K ++VLMVGAGGIGCELLKNL L GF +IHI+D+DTI++SNLNRQFLFRQ H+ +SK
Sbjct  204  SKVKQSRVLMVGAGGIGCELLKNLVLMGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSK  263

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P ++I  YHAN+KD  F V +FR
Sbjct  264  ALVAKEAAERFNPNVRIVAYHANIKDDQFTVAWFR  298



>ref|XP_003439482.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Oreochromis 
niloticus]
Length=645

 Score =   134 bits (337),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   K+L+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKILVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>ref|XP_005751567.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005935093.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Haplochromis 
burtoni]
Length=646

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P + V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPEYNVEFFRKFML  112



>ref|XP_007793896.1| putative family protein [Eutypa lata UCREL1]
 gb|EMR67006.1| putative family protein [Eutypa lata UCREL1]
Length=615

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            +++ + A+VLMVGAGGIGCELLKNL L+G+ ++HI+D+DTI++SNLNRQFLFR  H+ +S
Sbjct  2    LTSARQARVLMVGAGGIGCELLKNLVLTGYHEVHIVDLDTIDLSNLNRQFLFRHEHIKKS  61

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            KA VA+EA  KF P ++I  +HAN+KD  F V++FR
Sbjct  62   KALVAKEAAQKFNPNVEIVAHHANIKDAQFNVEWFR  97



>gb|KFX51511.1| Ubiquitin-activating enzyme E1-like [Talaromyces marneffei PM1]
Length=701

 Score =   135 bits (339),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SKA 
Sbjct  124  IRNSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSKAL  183

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KFRP  K+E YHAN+KD  F +D+F
Sbjct  184  VAKEVAQKFRPDSKLEAYHANIKDAQFNIDWF  215



>gb|KIW65692.1| hypothetical protein PV04_07925 [Capronia semiimmersa]
Length=436

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++A++ ++VL++GAGG+GCE+LKNLA+SGF+D+
Sbjct  21   WTYLDRILST--TSPYAGEEFVPGEETINALETSRVLVIGAGGLGCEILKNLAMSGFKDL  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVD  557
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG+KI PY+  ++D +   D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAAAFVERRVPGVKITPYNGKIQDKD--ED  136

Query  558  FFRDSMLF*MGXD  596
            ++    L   G D
Sbjct  137  YYMQFKLVICGLD  149



>ref|XP_003666760.1| hypothetical protein MYCTH_2311735 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61515.1| hypothetical protein MYCTH_2311735 [Myceliophthora thermophila 
ATCC 42464]
Length=624

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            ++  K ++VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFRQ H+ +S
Sbjct  9    LTQTKQSRVLMVGAGGIGCELLKNLVLTGFGEIHVVDLDTIDLSNLNRQFLFRQEHIKKS  68

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            KA VA+E   KF P +KI  +HAN+KD  F +D+F
Sbjct  69   KALVAKEVAEKFNPAVKIVAHHANIKDAQFSIDWF  103



>gb|KFA63748.1| hypothetical protein S40285_01953 [Stachybotrys chlorohalonata 
IBT 40285]
Length=671

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S++K A+VLMVGAGGIGCELLKNL L+GF +IH++D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  66   SSVKQARVLMVGAGGIGCELLKNLVLAGFGEIHVVDLDTIDLSNLNRQFLFRHEHIKKSK  125

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            A VA++A  +F P +KI  +HAN+KD  F V +FR+
Sbjct  126  ALVAKDAAQRFNPNVKIVSHHANIKDTEFNVPWFRE  161



>gb|KIW83513.1| hypothetical protein Z517_02758 [Fonsecaea pedrosoi CBS 271.37]
Length=436

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++ +++++VL++GAGG+GCE+LKNLALSGF+DI
Sbjct  21   WTYLDRLLST--TSPYAGDEFVPGEETINTLESSRVLVIGAGGLGCEILKNLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+ KA+VA   V K  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKFKAEVAAAFVEKRVPGVKITPYNGKIQD  132



>ref|XP_004564679.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Maylandia zebra]
Length=646

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P + V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPEYNVEFFRKFML  112



>ref|XP_006965352.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR48605.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS01528.1| hypothetical protein M419DRAFT_81048 [Trichoderma reesei RUT 
C-30]
Length=668

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            S +K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  61   SLVKHARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  120

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRD  569
            + VA+EA  +F P +KI  +HAN+KD  F V +FRD
Sbjct  121  SLVAKEAAQRFNPNVKIVAHHANIKDLEFSVPWFRD  156



>ref|XP_008410714.1| PREDICTED: SUMO-activating enzyme subunit 2 [Poecilia reticulata]
Length=646

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++ + KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLSSCKVLVVGAGGIGCELLKNLVLTGFKNIDVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>ref|XP_007553256.1| PREDICTED: SUMO-activating enzyme subunit 2 [Poecilia formosa]
Length=646

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++ + KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLSSCKVLVVGAGGIGCELLKNLVLTGFKNIDVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>ref|XP_005751568.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005935094.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Haplochromis 
burtoni]
Length=648

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P + V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPEYNVEFFRKFML  112



>ref|XP_005449438.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Oreochromis 
niloticus]
Length=647

 Score =   134 bits (337),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   +I   K+L+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSISTCKILVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAKESALQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>gb|EWZ02354.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum FOSC 
3-a]
Length=619

 Score =   134 bits (336),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>ref|XP_008284749.1| PREDICTED: SUMO-activating enzyme subunit 2 [Stegastes partitus]
Length=650

 Score =   134 bits (337),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  273  EQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVG  452
            E   ++   KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HVG
Sbjct  11   ELAESLSTCKVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVG  70

Query  453  QSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            +SKA+VA+E+ L+F P   I  YH +V +P++ V+FFR  ML
Sbjct  71   KSKAQVAKESALQFCPSANITAYHDSVMNPDYNVEFFRKFML  112



>ref|XP_009844967.1| hypothetical protein H257_17773 [Aphanomyces astaci]
 gb|ETV65479.1| hypothetical protein H257_17773 [Aphanomyces astaci]
Length=572

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  285  AIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKA  464
             I+ AK+L+VGAGGIGCELLKNL LSGF+DI ++D+DTI+VSNLNRQFLFR  HVG SKA
Sbjct  15   TIQEAKILVVGAGGIGCELLKNLVLSGFEDITVVDLDTIDVSNLNRQFLFRSQHVGHSKA  74

Query  465  KVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            +VA+   L+F P +KI  YH N+K   + +++F+
Sbjct  75   EVAKAVALQFNPRVKITAYHENIKSSRYSIEYFK  108



>gb|EXK45780.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=609

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EWZ48441.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93507.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=609

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EXL53770.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=609

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EXK45778.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. melonis 26406]
Length=620

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EXM33949.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. vasinfectum 25433]
Length=619

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>ref|XP_008712970.1| hypothetical protein HMPREF1541_10077 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45200.1| hypothetical protein HMPREF1541_10077 [Cyphellophora europaea 
CBS 101466]
Length=637

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  297  AKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAR  476
            +KVL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFLFR  H+ +SKA VA+
Sbjct  21   SKVLLVGAGGIGCELLKNLVLTGFGEVHIIDLDTIDLSNLNRQFLFRHEHIKKSKALVAK  80

Query  477  EAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            EA  KF P IK+E YHAN+KD  F + +F
Sbjct  81   EAAQKFNPNIKLEAYHANIKDSQFNIAWF  109



>ref|XP_007724302.1| ubiquitin-activating enzyme E1 C [Capronia coronata CBS 617.96]
 gb|EXJ88296.1| ubiquitin-activating enzyme E1 C [Capronia coronata CBS 617.96]
Length=436

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  EE ++A++ ++VL++GAGG+GCE+LK+LALSGF+DI
Sbjct  21   WGYLDKVLST--TSPYAGEEFVPGEETINALETSRVLVIGAGGLGCEILKDLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFR+S VG+SKA+VA   V +  PG+KI PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRESDVGKSKAEVAAAFVERRVPGVKITPYNGKIQD  132



>gb|EWZ48439.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum Fo47]
 gb|EWZ93505.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. lycopersici MN25]
Length=620

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>gb|EXA42005.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. pisi HDV247]
 gb|EXK96984.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. raphani 54005]
 gb|EXL79440.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. conglutinans race 2 54008]
Length=619

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDGFTVAWFQ  171



>gb|EXL53768.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=620

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVTWFQ  171



>ref|XP_002487254.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
stipitatus ATCC 10500]
 gb|EED13143.1| ubiquitin-like activating enzyme (UbaB), putative [Talaromyces 
stipitatus ATCC 10500]
Length=623

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  252  SHLMASEEQMSA-IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQF  428
            ++L  S   +SA I+ ++VL+VGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQF
Sbjct  14   AYLKHSLGTLSARIRKSRVLLVGAGGIGCELLKNLLLTGFGEIHIVDLDTIDLSNLNRQF  73

Query  429  LFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            LFR  H+ +SKA VA+E   KFRP  K+E YHAN+KD  F  D+F
Sbjct  74   LFRHEHIKKSKALVAKEVAHKFRPDSKLEAYHANIKDSQFNTDWF  118



>ref|XP_001394085.1| ubiquitin-activating enzyme E1-like protein [Aspergillus niger 
CBS 513.88]
 emb|CAK40551.1| unnamed protein product [Aspergillus niger]
 gb|EHA19336.1| hypothetical protein ASPNIDRAFT_178271 [Aspergillus niger ATCC 
1015]
Length=615

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            IK ++VL+VGAGGIGCELLKNL LSGF +IHIID+DTI++SNLNRQFLFR  H+ + KA 
Sbjct  18   IKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKPKAL  77

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            VA+E   KF+P  K+E YHAN+KD  F VD+F
Sbjct  78   VAKEVAHKFQPSAKLEAYHANIKDDQFNVDWF  109



>emb|CBJ28586.1| conserved unknown protein [Ectocarpus siliculosus]
Length=293

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +3

Query  252  SHLMAS--EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQ  425
            SHL AS   E    ++ AK+L+VGAGGIGCELLKNL  +GFQDI ++D+DTI+ SNLNRQ
Sbjct  5    SHLRASMGTELFDKVQKAKLLVVGAGGIGCELLKNLVQTGFQDIEVVDLDTIDKSNLNRQ  64

Query  426  FLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            FLFR  HV +SK+ +AREAVLKF P  +I  +H NVK+  FG+ F R
Sbjct  65   FLFRPHHVDKSKSLMAREAVLKFNPEARIVAHHGNVKEAKFGMAFIR  111



>ref|XP_003069148.1| ThiF family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER27003.1| ThiF family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EFW21119.1| NEDD8-activating enzyme E1 catalytic subunit [Coccidioides posadasii 
str. Silveira]
Length=619

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  255  HLMASEEQMSA-IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFL  431
            HL  S   +S+ I+ ++VL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFL
Sbjct  14   HLRQSLGTLSSNIRKSRVLLVGAGGIGCELLKNLLLTGFGEVHIIDLDTIDLSNLNRQFL  73

Query  432  FRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            FR  H+ + KA VA+E   KFRP  K+E YHAN+KD  F V++F
Sbjct  74   FRHEHIKKPKALVAKEVASKFRPQAKLEAYHANIKDSRFNVEWF  117



>ref|XP_001240084.1| hypothetical protein CIMG_09705 [Coccidioides immitis RS]
 gb|EAS28501.3| ubiquitin-activating enzyme E1-like protein [Coccidioides immitis 
RS]
Length=619

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  255  HLMASEEQMSA-IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFL  431
            HL  S   +S+ I+ ++VL+VGAGGIGCELLKNL L+GF ++HIID+DTI++SNLNRQFL
Sbjct  14   HLRQSLGTLSSNIRKSRVLLVGAGGIGCELLKNLLLTGFGEVHIIDLDTIDLSNLNRQFL  73

Query  432  FRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFF  563
            FR  H+ + KA VA+E   KFRP  K+E YHAN+KD  F V++F
Sbjct  74   FRHEHIKKPKALVAKEVASKFRPQAKLEAYHANIKDSRFNVEWF  117



>ref|XP_010882326.1| PREDICTED: SUMO-activating enzyme subunit 2 [Esox lucius]
Length=642

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++    VL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSVSDCNVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+VL+F P   I+ YH ++ +P++ V+FFR+ ML
Sbjct  70   GKSKAQVAKESVLQFCPTANIKAYHDSIMNPDYNVEFFRNFML  112



>ref|XP_003698305.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Apis florea]
Length=666

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +3

Query  267  SEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSH  446
            +E   +AI  +KVL+VGAGGIGCE+LKNL ++GF +I IID+DTI+VSNLNRQFLF++ H
Sbjct  10   TENLQNAILQSKVLIVGAGGIGCEILKNLVMTGFTNIEIIDLDTIDVSNLNRQFLFQKKH  69

Query  447  VGQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            VG+SKA VARE  L F P  KI  YH ++  P++GV FF+   L
Sbjct  70   VGKSKADVARETALTFNPDAKITHYHDSITTPDYGVSFFKKXTL  113



>ref|XP_001638517.1| predicted protein [Nematostella vectensis]
 gb|EDO46454.1| predicted protein [Nematostella vectensis]
Length=624

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +  +K+L+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF + HVG+SKAK
Sbjct  21   VNNSKILVVGAGGIGCELLKNLVLTGFKNIDLIDLDTIDVSNLNRQFLFHKQHVGKSKAK  80

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VARE+ L+F P  KI   H N+  P +G+D+F+
Sbjct  81   VARESALRFNPDAKIVAIHDNITSPEYGIDYFK  113



>gb|EXM33950.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. vasinfectum 25433]
Length=609

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>gb|KFH63366.1| ubiquitin-like 1-activating enzyme E1 B [Mortierella verticillata 
NRRL 6337]
Length=632

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  279  MSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQS  458
            +S I  AKVLMVGAGGIGCELLKNL +SGF++I IID+DTI++SNLNRQFLF++ H+ +S
Sbjct  17   VSTIADAKVLMVGAGGIGCELLKNLVMSGFKNIEIIDLDTIDLSNLNRQFLFQKQHIKKS  76

Query  459  KAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            KAKVARE+ L F P + I   H N+K+  F VD+F+
Sbjct  77   KAKVARESALAFNPNVNIHARHQNIKEQEFSVDWFK  112



>gb|EWZ02355.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum FOSC 
3-a]
Length=609

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>gb|EWZ02353.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum FOSC 
3-a]
Length=620

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>ref|XP_005814976.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Xiphophorus 
maculatus]
Length=650

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  270  EEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHV  449
            +E   ++ + KVL+VGAGGIGCELLKNL L+GF++I +ID+DTI+VSNLNRQFLF++ HV
Sbjct  10   KELADSLSSCKVLVVGAGGIGCELLKNLVLTGFKNIDVIDLDTIDVSNLNRQFLFQKKHV  69

Query  450  GQSKAKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFRDSML  578
            G+SKA+VA+E+ L+F P   I  YH ++ +P++ V+FFR  ML
Sbjct  70   GKSKAQVAQESALQFCPSANITAYHDSIMNPDYNVEFFRKFML  112



>gb|KHJ31919.1| putative family protein [Erysiphe necator]
Length=631

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            +K A++L+VGAGGIGCELLKNL LSGF +IHI+D+DTI++SNLNRQFLFRQ H+ +SKA 
Sbjct  19   VKEARILVVGAGGIGCELLKNLVLSGFGEIHIVDLDTIDLSNLNRQFLFRQEHIKKSKAL  78

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VA++A  KF P +K+E Y AN+ +P F +++FR
Sbjct  79   VAKDAAQKFNPNVKLEAYMANITEPLFNIEWFR  111



>gb|EXM07019.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. cubense tropical race 4 54006]
Length=616

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  73   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  132

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  133  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  167



>gb|EFA83622.1| sumo-activating enzyme subunit 2 [Polysphondylium pallidum PN500]
Length=627

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 3/96 (3%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I++AKVL+VGAGGIGCELLKNL LSGF+DIHIID+DTI++SNLNRQFLFR+ H+G SKAK
Sbjct  21   IRSAKVLVVGAGGIGCELLKNLVLSGFRDIHIIDLDTIDLSNLNRQFLFRKHHIGMSKAK  80

Query  468  VAREAVLKF---RPGIKIEPYHANVKDPNFGVDFFR  566
            +ARE+VLK+      IKI  +HA++K   FG ++F+
Sbjct  81   IARESVLKYCNNSDDIKIVAHHADIKTHEFGPNYFK  116



>gb|EXM33948.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. vasinfectum 25433]
Length=620

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  171



>gb|EXM07021.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. cubense tropical race 4 54006]
Length=605

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  73   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  132

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  133  ALVAKEAAERFNPNVKIVAHHANIKDDEFTVAWFQ  167



>gb|KIW23223.1| hypothetical protein PV07_11441 [Cladophialophora immunda]
Length=436

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  WCYRTTSHSTLSVSLFISSHLMASEEQMSAIKAAKVLMVGAGGIGCELLKNLALSGFQDI  377
            W Y     ST   S +     +  E+ ++A+++++VL++GAGG+GCE+LK+LALSGF+DI
Sbjct  21   WTYLDRILST--TSPYAGEEFVPGEDTINALESSRVLVIGAGGLGCEILKDLALSGFKDI  78

Query  378  HIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVAREAVLKFRPGIKIEPYHANVKD  539
            H+IDMDTI+VSNLNRQFLFRQS VG+SKA+VA   V +  PG++I PY+  ++D
Sbjct  79   HVIDMDTIDVSNLNRQFLFRQSDVGKSKAEVAAAFVERRVPGVRITPYNGKIQD  132



>gb|EXA42004.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. pisi HDV247]
 gb|EXK96983.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. raphani 54005]
 gb|EXL79439.1| ubiquitin-like 1-activating enzyme E1 B [Fusarium oxysporum f. 
sp. conglutinans race 2 54008]
Length=620

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  282  SAIKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSK  461
            +++K A+VLMVGAGGIGCELLKNL L+GF +IHI+D+DTI++SNLNRQFLFR  H+ +SK
Sbjct  77   TSVKQARVLMVGAGGIGCELLKNLVLTGFGEIHIVDLDTIDLSNLNRQFLFRHEHIKKSK  136

Query  462  AKVAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            A VA+EA  +F P +KI  +HAN+KD  F V +F+
Sbjct  137  ALVAKEAAERFNPNVKIVAHHANIKDDGFTVAWFQ  171



>gb|ENN71609.1| hypothetical protein YQE_11708, partial [Dendroctonus ponderosae]
 gb|ERL90612.1| hypothetical protein D910_07959 [Dendroctonus ponderosae]
Length=608

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  288  IKAAKVLMVGAGGIGCELLKNLALSGFQDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAK  467
            I  +KVL+VGAGGIGCE+LKNLALSGF+DI IID+DTI+VSNLNRQFLFR+ HVG+ KA 
Sbjct  20   IPKSKVLLVGAGGIGCEVLKNLALSGFRDIEIIDLDTIDVSNLNRQFLFRKEHVGKPKAV  79

Query  468  VAREAVLKFRPGIKIEPYHANVKDPNFGVDFFR  566
            VARE++L   P +KI+ YH ++   ++G++FF+
Sbjct  80   VARESILAHNPNVKIKAYHDSILSSDYGLNFFK  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090