BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS165C07

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02615.1|  unnamed protein product                              78.2    3e-14   Coffea canephora [robusta coffee]
gb|KHG04092.1|  ADIPOR-like receptor protein                          77.4    8e-14   Gossypium arboreum [tree cotton]
ref|XP_004167676.1|  PREDICTED: adiponectin receptor protein 2-li...  76.6    1e-13   
ref|XP_008440411.1|  PREDICTED: adiponectin receptor protein 2-li...  76.6    1e-13   Cucumis melo [Oriental melon]
ref|XP_004141855.1|  PREDICTED: adiponectin receptor protein 2-li...  76.6    1e-13   Cucumis sativus [cucumbers]
ref|XP_009797606.1|  PREDICTED: heptahelical transmembrane protei...  75.1    1e-13   Nicotiana sylvestris
emb|CBI25834.3|  unnamed protein product                              75.1    4e-13   Vitis vinifera
ref|XP_010646812.1|  PREDICTED: heptahelical transmembrane protei...  74.7    5e-13   Vitis vinifera
gb|KJB18049.1|  hypothetical protein B456_003G031300                  74.7    6e-13   Gossypium raimondii
ref|XP_009618874.1|  PREDICTED: heptahelical transmembrane protei...  74.3    7e-13   Nicotiana tomentosiformis
ref|XP_006363814.1|  PREDICTED: ADIPOR-like receptor IZH1-like        74.3    7e-13   Solanum tuberosum [potatoes]
ref|XP_009797605.1|  PREDICTED: heptahelical transmembrane protei...  74.3    8e-13   Nicotiana sylvestris
ref|XP_009797604.1|  PREDICTED: heptahelical transmembrane protei...  74.3    9e-13   Nicotiana sylvestris
gb|KJB43936.1|  hypothetical protein B456_007G224700                  72.8    9e-13   Gossypium raimondii
ref|XP_004231936.1|  PREDICTED: heptahelical transmembrane protei...  73.9    1e-12   Solanum lycopersicum
gb|EYU44509.1|  hypothetical protein MIMGU_mgv1a007578mg              73.2    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_009354632.1|  PREDICTED: heptahelical transmembrane protei...  72.8    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_010274409.1|  PREDICTED: heptahelical transmembrane protei...  72.4    4e-12   Nelumbo nucifera [Indian lotus]
gb|KJB43938.1|  hypothetical protein B456_007G224700                  72.4    4e-12   Gossypium raimondii
gb|KDP32090.1|  hypothetical protein JCGZ_12551                       71.6    6e-12   Jatropha curcas
ref|XP_006857128.1|  hypothetical protein AMTR_s00065p00145160        71.6    7e-12   Amborella trichopoda
ref|XP_009624872.1|  PREDICTED: heptahelical transmembrane protei...  71.6    7e-12   Nicotiana tomentosiformis
ref|XP_007156701.1|  hypothetical protein PHAVU_002G010000g           71.2    9e-12   Phaseolus vulgaris [French bean]
ref|XP_010531306.1|  PREDICTED: heptahelical transmembrane protein 4  71.2    9e-12   Tarenaya hassleriana [spider flower]
ref|XP_010999933.1|  PREDICTED: heptahelical transmembrane protei...  71.2    1e-11   Populus euphratica
ref|XP_011007839.1|  PREDICTED: heptahelical transmembrane protei...  71.2    1e-11   Populus euphratica
ref|XP_007156702.1|  hypothetical protein PHAVU_002G010000g           71.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_002525289.1|  conserved hypothetical protein                   70.9    1e-11   
ref|XP_006590276.1|  PREDICTED: uncharacterized protein LOC100776...  70.5    1e-11   Glycine max [soybeans]
ref|NP_001241554.1|  uncharacterized protein LOC100776175             70.9    1e-11   Glycine max [soybeans]
ref|XP_006466458.1|  PREDICTED: ADIPOR-like receptor IZH1-like is...  70.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_009395019.1|  PREDICTED: heptahelical transmembrane protei...  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO78928.1|  hypothetical protein CISIN_1g015195mg                 70.9    2e-11   Citrus sinensis [apfelsine]
ref|XP_009362593.1|  PREDICTED: heptahelical transmembrane protei...  70.5    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_009362592.1|  PREDICTED: heptahelical transmembrane protei...  70.5    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_008341411.1|  PREDICTED: adiponectin receptor protein 2-like   70.5    2e-11   
ref|XP_003611557.1|  Adiponectin receptor protein                     70.1    2e-11   
gb|AFK46125.1|  unknown                                               69.7    3e-11   Medicago truncatula
gb|AES94516.2|  heptahelical protein                                  69.7    3e-11   Medicago truncatula
ref|XP_004288264.1|  PREDICTED: heptahelical transmembrane protei...  70.1    3e-11   Fragaria vesca subsp. vesca
gb|ABR16950.1|  unknown                                               70.1    3e-11   Picea sitchensis
ref|XP_009758488.1|  PREDICTED: heptahelical transmembrane protei...  69.7    3e-11   Nicotiana sylvestris
ref|XP_006350623.1|  PREDICTED: adiponectin receptor protein 1-like   69.7    3e-11   Solanum tuberosum [potatoes]
ref|XP_009758486.1|  PREDICTED: heptahelical transmembrane protei...  69.7    3e-11   Nicotiana sylvestris
ref|XP_002320004.2|  hypothetical protein POPTR_0014s00900g           68.9    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008237729.1|  PREDICTED: adiponectin receptor protein-like...  68.6    9e-11   Prunus mume [ume]
ref|XP_010028082.1|  PREDICTED: heptahelical transmembrane protei...  68.6    9e-11   Eucalyptus grandis [rose gum]
ref|XP_007205266.1|  hypothetical protein PRUPE_ppa006424mg           68.6    9e-11   Prunus persica
ref|XP_008237736.1|  PREDICTED: adiponectin receptor protein-like...  68.6    9e-11   Prunus mume [ume]
gb|KHG23872.1|  ADIPOR-like receptor protein                          68.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_008353207.1|  PREDICTED: adiponectin receptor protein-like     68.2    1e-10   
gb|ABM68566.1|  hemolysin III-related family protein                  68.2    1e-10   Lilium longiflorum [Easter lily]
gb|EPS69882.1|  hypothetical protein M569_04878                       67.8    1e-10   Genlisea aurea
ref|XP_010273060.1|  PREDICTED: heptahelical transmembrane protei...  68.2    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008340762.1|  PREDICTED: adiponectin receptor protein-like     67.8    1e-10   
gb|KJB40281.1|  hypothetical protein B456_007G056700                  67.4    2e-10   Gossypium raimondii
ref|XP_006426099.1|  hypothetical protein CICLE_v10025731mg           67.4    2e-10   Citrus clementina [clementine]
gb|KJB40282.1|  hypothetical protein B456_007G056700                  67.4    2e-10   Gossypium raimondii
ref|XP_009133930.1|  PREDICTED: adiponectin receptor protein-like...  66.6    3e-10   Brassica rapa
gb|KHN36309.1|  ADIPOR-like receptor CG5315-like protein              66.6    4e-10   Glycine soja [wild soybean]
ref|XP_009371039.1|  PREDICTED: heptahelical transmembrane protei...  66.6    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_008373649.1|  PREDICTED: adiponectin receptor protein-like     66.6    4e-10   
ref|XP_006572848.1|  PREDICTED: uncharacterized protein LOC100778...  66.2    4e-10   Glycine max [soybeans]
ref|NP_001242849.1|  uncharacterized protein LOC100778227             66.6    4e-10   Glycine max [soybeans]
ref|XP_008790240.1|  PREDICTED: adiponectin receptor protein-like     66.6    4e-10   Phoenix dactylifera
ref|XP_011031308.1|  PREDICTED: heptahelical transmembrane protei...  66.2    5e-10   Populus euphratica
ref|XP_010106925.1|  Adiponectin receptor protein 2                   66.2    5e-10   Morus notabilis
ref|XP_004300330.1|  PREDICTED: heptahelical transmembrane protei...  66.2    5e-10   Fragaria vesca subsp. vesca
ref|XP_009419320.1|  PREDICTED: heptahelical transmembrane protei...  65.9    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209192.1|  hypothetical protein PRUPE_ppa006423mg           65.9    8e-10   Prunus persica
ref|XP_004511819.1|  PREDICTED: adiponectin receptor protein 1-li...  65.5    9e-10   Cicer arietinum [garbanzo]
ref|XP_010446637.1|  PREDICTED: heptahelical transmembrane protein 4  65.5    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004511821.1|  PREDICTED: adiponectin receptor protein 1-li...  65.5    1e-09   Cicer arietinum [garbanzo]
ref|XP_002868976.1|  hypothetical protein ARALYDRAFT_490848           65.5    1e-09   
ref|XP_010437193.1|  PREDICTED: heptahelical transmembrane protein 4  65.5    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006283903.1|  hypothetical protein CARUB_v10005020mg           65.1    1e-09   Capsella rubella
ref|XP_010679658.1|  PREDICTED: heptahelical transmembrane protei...  65.5    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008238506.1|  PREDICTED: ADIPOR-like receptor IZH1             65.1    1e-09   Prunus mume [ume]
ref|XP_006411861.1|  hypothetical protein EUTSA_v10025437mg           64.7    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_004234646.1|  PREDICTED: heptahelical transmembrane protei...  64.3    2e-09   Solanum lycopersicum
dbj|BAD43945.1|  putative protein                                     64.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195545.1|  heptahelical protein 5                              64.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310891.1|  hypothetical protein POPTR_0007s14850g           64.3    2e-09   
ref|XP_010432040.1|  PREDICTED: heptahelical transmembrane protei...  64.3    3e-09   Camelina sativa [gold-of-pleasure]
ref|NP_195483.1|  heptahelical transmembrane protein HHP4             63.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285384.1|  PREDICTED: heptahelical transmembrane protei...  63.9    3e-09   Vitis vinifera
ref|XP_010664499.1|  PREDICTED: heptahelical transmembrane protei...  63.9    3e-09   Vitis vinifera
ref|XP_008340785.1|  PREDICTED: adiponectin receptor protein 1-like   63.5    5e-09   
gb|KDP41605.1|  hypothetical protein JCGZ_16012                       63.5    5e-09   Jatropha curcas
ref|XP_010687835.1|  PREDICTED: heptahelical transmembrane protei...  62.8    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010936139.1|  PREDICTED: heptahelical transmembrane protei...  62.8    9e-09   
emb|CDX69320.1|  BnaC01g01330D                                        62.4    9e-09   
ref|XP_007136770.1|  hypothetical protein PHAVU_009G072600g           62.4    1e-08   Phaseolus vulgaris [French bean]
ref|XP_003523624.1|  PREDICTED: adiponectin receptor protein 1-like   61.2    2e-08   
ref|XP_011099397.1|  PREDICTED: heptahelical transmembrane protei...  61.2    3e-08   Sesamum indicum [beniseed]
emb|CDY29576.1|  BnaA03g54210D                                        60.8    4e-08   Brassica napus [oilseed rape]
ref|XP_009138520.1|  PREDICTED: adiponectin receptor protein 1-li...  60.8    4e-08   Brassica rapa
emb|CDX72648.1|  BnaC07g46700D                                        60.8    4e-08   
ref|XP_002510080.1|  conserved hypothetical protein                   59.7    8e-08   Ricinus communis
ref|XP_006581272.1|  PREDICTED: adiponectin receptor protein 2-li...  58.5    2e-07   Glycine max [soybeans]
ref|XP_004501515.1|  PREDICTED: ADIPOR-like receptor CG5315-like      52.4    3e-05   Cicer arietinum [garbanzo]
ref|XP_001778966.1|  predicted protein                                51.2    6e-05   
ref|XP_001757760.1|  predicted protein                                50.8    7e-05   
ref|XP_007047564.1|  Heptahelical protein 4 isoform 1                 50.4    1e-04   
gb|KJB84319.1|  hypothetical protein B456_N018100                     45.8    6e-04   Gossypium raimondii



>emb|CDP02615.1| unnamed protein product [Coffea canephora]
Length=414

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  235  MEKDQGNIXX--MGGXCXSNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFI  408
            M KDQ +     +GG    ND +    S+ GKGKRLWKKVKYQLVEYHSLPGYLKDNE+I
Sbjct  1    MGKDQRDFAETKVGGGSRDNDQRVYNCSKEGKGKRLWKKVKYQLVEYHSLPGYLKDNEYI  60

Query  409  LGH  417
            LGH
Sbjct  61   LGH  63



>gb|KHG04092.1| ADIPOR-like receptor protein [Gossypium arboreum]
Length=428

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  26   SKEGKGKRLWKKVKYQLVEYHSLPGYLRDNEYILGH  61



>ref|XP_004167676.1| PREDICTED: adiponectin receptor protein 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167677.1| PREDICTED: adiponectin receptor protein 2-like isoform 2 [Cucumis 
sativus]
Length=414

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  SNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +N+G +   S+ GKGKRLWKKVKYQLVEYH+LP YL+DNEFILGH
Sbjct  19   TNEGHHKYSSKEGKGKRLWKKVKYQLVEYHALPAYLRDNEFILGH  63



>ref|XP_008440411.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440412.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440413.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
 ref|XP_008440414.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Cucumis 
melo]
Length=414

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  SNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +N+G +   S+ GKGKRLWKKVKYQLVEYH+LP YL+DNEFILGH
Sbjct  19   TNEGHHKYSSKEGKGKRLWKKVKYQLVEYHALPAYLRDNEFILGH  63



>ref|XP_004141855.1| PREDICTED: adiponectin receptor protein 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004141856.1| PREDICTED: adiponectin receptor protein 2-like isoform 2 [Cucumis 
sativus]
 gb|KGN48622.1| hypothetical protein Csa_6G495760 [Cucumis sativus]
Length=414

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  SNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +N+G +   S+ GKGKRLWKKVKYQLVEYH+LP YL+DNEFILGH
Sbjct  19   TNEGHHKYSSKEGKGKRLWKKVKYQLVEYHALPAYLRDNEFILGH  63



>ref|XP_009797606.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X3 [Nicotiana sylvestris]
Length=287

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  286  NDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            N      +S+ GK KRLWKKVKYQLVEYHSLPGYLKDNEFILGH
Sbjct  25   NQPLCASNSKEGKPKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  68



>emb|CBI25834.3| unnamed protein product [Vitis vinifera]
Length=390

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+GGKGKRLWKKVKYQLVEYHSLP YL+DNEFILGH
Sbjct  3    SSKGGKGKRLWKKVKYQLVEYHSLPAYLRDNEFILGH  39



>ref|XP_010646812.1| PREDICTED: heptahelical transmembrane protein 4-like [Vitis vinifera]
Length=412

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+GGKGKRLWKKVKYQLVEYHSLP YL+DNEFILGH
Sbjct  25   SSKGGKGKRLWKKVKYQLVEYHSLPAYLRDNEFILGH  61



>gb|KJB18049.1| hypothetical protein B456_003G031300 [Gossypium raimondii]
Length=386

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  295  KYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            K   +S+GGKGKRLWKKVKYQLVEYHSLPGYL+DNE+I+GH
Sbjct  8    KTMENSKGGKGKRLWKKVKYQLVEYHSLPGYLRDNEYIVGH  48



>ref|XP_009618874.1| PREDICTED: heptahelical transmembrane protein 4-like [Nicotiana 
tomentosiformis]
Length=401

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  286  NDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            N      +S+ GK KRLWKKVKYQLVEYHSLPGYLKDNEFILGH
Sbjct  25   NQPLCASNSKEGKPKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  68



>ref|XP_006363814.1| PREDICTED: ADIPOR-like receptor IZH1-like [Solanum tuberosum]
Length=397

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  SNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            + D +    S+ GKGKRLWKKVKYQLVEYHSLPGYLKDNE+ILGH
Sbjct  11   NEDNQLLSPSKEGKGKRLWKKVKYQLVEYHSLPGYLKDNEYILGH  55



>ref|XP_009797605.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Nicotiana sylvestris]
Length=397

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  286  NDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            N      +S+ GK KRLWKKVKYQLVEYHSLPGYLKDNEFILGH
Sbjct  25   NQPLCASNSKEGKPKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  68



>ref|XP_009797604.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
Length=401

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  286  NDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            N      +S+ GK KRLWKKVKYQLVEYHSLPGYLKDNEFILGH
Sbjct  25   NQPLCASNSKEGKPKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  68



>gb|KJB43936.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
 gb|KJB43937.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
Length=301

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  26   SKEGKGKRLWKKVKYQLVEYHSLPGYLRDNEYILGH  61



>ref|XP_004231936.1| PREDICTED: heptahelical transmembrane protein 4-like [Solanum 
lycopersicum]
Length=400

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  286  NDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             D +    S+ GKGKRLWKKVKYQLVEYHSLPGYLKDNE+ILGH
Sbjct  15   EDNELLSPSKEGKGKRLWKKVKYQLVEYHSLPGYLKDNEYILGH  58



>gb|EYU44509.1| hypothetical protein MIMGU_mgv1a007578mg [Erythranthe guttata]
Length=403

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  235  MEKDQGNIXXMGGXCXSNDGKYGR-DSRG-GKGKRLWKKVKYQLVEYHSLPGYLKDNEFI  408
            M++++GN   +     SN+ +    DS G GKGKRLWKKVKYQLVEYHSLP YLKDNE+I
Sbjct  1    MDRNEGNSDVVKSTGGSNENETLLCDSPGDGKGKRLWKKVKYQLVEYHSLPAYLKDNEYI  60

Query  409  LGH  417
            LGH
Sbjct  61   LGH  63



>ref|XP_009354632.1| PREDICTED: heptahelical transmembrane protein 4-like [Pyrus x 
bretschneideri]
Length=412

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  301  GRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
               S+ GKGKRLWKKVKYQLVEYHSLP YL+DNEFILGH
Sbjct  23   ASSSKEGKGKRLWKKVKYQLVEYHSLPNYLRDNEFILGH  61



>ref|XP_010274409.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
 ref|XP_010274410.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
Length=413

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            + GKGKRLWKKVKYQLVEYHSLPGYL+DNEFILGH
Sbjct  33   KEGKGKRLWKKVKYQLVEYHSLPGYLRDNEFILGH  67



>gb|KJB43938.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
 gb|KJB43939.1| hypothetical protein B456_007G224700 [Gossypium raimondii]
Length=402

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  26   SKEGKGKRLWKKVKYQLVEYHSLPGYLRDNEYILGH  61



>gb|KDP32090.1| hypothetical protein JCGZ_12551 [Jatropha curcas]
Length=406

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKVKYQLVEYHSLPGYL+DNE+I+GH
Sbjct  26   SKEGKGKRLWKKVKYQLVEYHSLPGYLRDNEYIIGH  61



>ref|XP_006857128.1| hypothetical protein AMTR_s00065p00145160 [Amborella trichopoda]
 gb|ERN18595.1| hypothetical protein AMTR_s00065p00145160 [Amborella trichopoda]
Length=404

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  277  CXSNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            C     +    S  GKGKRLWK+VKYQLVEYHSLPGYL+DNE+I+GH
Sbjct  8    CGVVSSEINSQSTEGKGKRLWKRVKYQLVEYHSLPGYLRDNEYIIGH  54



>ref|XP_009624872.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=400

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKVKYQLVEYHSLP YLKDNE+ILGH
Sbjct  23   SKEGKGKRLWKKVKYQLVEYHSLPAYLKDNEYILGH  58



>ref|XP_007156701.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
 gb|ESW28695.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
Length=373

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R GKG+RLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  18   REGKGRRLWKKVKYQLVEYHSLPGYLRDNEYILGH  52



>ref|XP_010531306.1| PREDICTED: heptahelical transmembrane protein 4 [Tarenaya hassleriana]
 ref|XP_010531307.1| PREDICTED: heptahelical transmembrane protein 4 [Tarenaya hassleriana]
Length=404

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
              + GKGKRLWKKVKYQLVEYHSLPGYL+DNEFI+GH
Sbjct  25   QPKEGKGKRLWKKVKYQLVEYHSLPGYLRDNEFIVGH  61



>ref|XP_010999933.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
 ref|XP_010999934.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=409

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SR GKGKRLWKKVKYQLVEY+SLP YL+DNEFILGH
Sbjct  26   SREGKGKRLWKKVKYQLVEYNSLPAYLRDNEFILGH  61



>ref|XP_011007839.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=409

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SR GKGKRLWKKVKYQLVEY+SLP YL+DNEFILGH
Sbjct  26   SREGKGKRLWKKVKYQLVEYNSLPAYLRDNEFILGH  61



>ref|XP_007156702.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
 gb|ESW28696.1| hypothetical protein PHAVU_002G010000g [Phaseolus vulgaris]
Length=387

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R GKG+RLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  18   REGKGRRLWKKVKYQLVEYHSLPGYLRDNEYILGH  52



>ref|XP_002525289.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37117.1| conserved hypothetical protein [Ricinus communis]
Length=399

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKGKRLW KVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  26   SSKVGKGKRLWNKVKYQLVEYHSLPGYLRDNEYILGH  62



>ref|XP_006590276.1| PREDICTED: uncharacterized protein LOC100776175 isoform X2 [Glycine 
max]
 ref|XP_006590277.1| PREDICTED: uncharacterized protein LOC100776175 isoform X3 [Glycine 
max]
Length=360

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            GKGKRLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  13   GKGKRLWKKVKYQLVEYHSLPGYLRDNEYILGH  45



>ref|NP_001241554.1| uncharacterized protein LOC100776175 [Glycine max]
 ref|XP_006590275.1| PREDICTED: uncharacterized protein LOC100776175 isoform X1 [Glycine 
max]
 gb|ACU18265.1| unknown [Glycine max]
 gb|KHN13008.1| ADIPOR-like receptor CG5315-like protein [Glycine soja]
Length=374

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  316  GGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             GKGKRLWKKVKYQLVEYHSLPGYL+DNE+ILGH
Sbjct  12   SGKGKRLWKKVKYQLVEYHSLPGYLRDNEYILGH  45



>ref|XP_006466458.1| PREDICTED: ADIPOR-like receptor IZH1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466459.1| PREDICTED: ADIPOR-like receptor IZH1-like isoform X2 [Citrus 
sinensis]
Length=411

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  265  MGGXCXSNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            M G   + +      S+ GKG+RLWK+VKYQLVEYH+LPGYL+DNEFI+GH
Sbjct  11   MNGASEAMENHGVASSQEGKGRRLWKRVKYQLVEYHALPGYLRDNEFIIGH  61



>ref|XP_009395019.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Musa 
acuminata subsp. malaccensis]
Length=401

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R GKG+RLWKKVKYQLVEYHSLPGYLKDNE+ILG+
Sbjct  18   RSGKGRRLWKKVKYQLVEYHSLPGYLKDNEYILGY  52



>gb|KDO78928.1| hypothetical protein CISIN_1g015195mg [Citrus sinensis]
Length=411

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKG+RLWK+VKYQLVEYH+LPGYL+DNEFI+GH
Sbjct  25   SSKEGKGRRLWKRVKYQLVEYHALPGYLRDNEFIIGH  61



>ref|XP_009362593.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Pyrus x bretschneideri]
Length=412

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  301  GRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
               S+ GKGKRLW+KVKYQLVEYH+LP YL+DNEFILGH
Sbjct  23   ASSSKEGKGKRLWEKVKYQLVEYHTLPNYLRDNEFILGH  61



>ref|XP_009362592.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Pyrus x bretschneideri]
Length=413

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  301  GRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
               S+ GKGKRLW+KVKYQLVEYH+LP YL+DNEFILGH
Sbjct  23   ASSSKEGKGKRLWEKVKYQLVEYHTLPNYLRDNEFILGH  61



>ref|XP_008341411.1| PREDICTED: adiponectin receptor protein 2-like [Malus domestica]
Length=412

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  301  GRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
               S+ GKGKRLWKKVKYQL EYHSLP YL+DNEFILGH
Sbjct  23   ASSSKEGKGKRLWKKVKYQLXEYHSLPNYLRDNEFILGH  61



>ref|XP_003611557.1| Adiponectin receptor protein [Medicago truncatula]
 gb|AES94515.1| heptahelical protein [Medicago truncatula]
Length=379

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  283  SNDGKYGRDS---RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SND   G +    R GKGKRLWKKVKYQLVEYHSLP +L+DNE+ILGH
Sbjct  6    SNDDLLGGEECCEREGKGKRLWKKVKYQLVEYHSLPAFLRDNEYILGH  53



>gb|AFK46125.1| unknown [Medicago truncatula]
Length=379

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  283  SNDGKYGRDS---RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SND   G +    R GKGKRLWKKVKYQLVEYHSLP +L+DNE+ILGH
Sbjct  6    SNDDLLGGEECCEREGKGKRLWKKVKYQLVEYHSLPAFLRDNEYILGH  53



>gb|AES94516.2| heptahelical protein [Medicago truncatula]
Length=375

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  283  SNDGKYGRDS---RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SND   G +    R GKGKRLWKKVKYQLVEYHSLP +L+DNE+ILGH
Sbjct  6    SNDDLLGGEECCEREGKGKRLWKKVKYQLVEYHSLPAFLRDNEYILGH  53



>ref|XP_004288264.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=409

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  283  SNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            + D      S+ GKGKRLWKKVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  17   AMDNNQACASKEGKGKRLWKKVKYQLVEYHSLPHYLRDNEYIIGH  61



>gb|ABR16950.1| unknown [Picea sitchensis]
Length=432

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = +1

Query  208  SLLFSSGDRM---EKDQGNIXXMGGXCXSNDGKYGRD-SRGGKGKRLWKKVKYQLVEYHS  375
            +L FS  DRM   E D GN+         N   Y  D +  GK K LWKKVKYQLVEYH+
Sbjct  10   NLKFS--DRMGSSEADSGNLKFSDVSVSRNSEGYDGDIASPGKAKELWKKVKYQLVEYHA  67

Query  376  LPGYLKDNEFILGH  417
            LP YL+DNE+ILG+
Sbjct  68   LPEYLRDNEYILGY  81



>ref|XP_009758488.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X2 [Nicotiana sylvestris]
Length=399

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKV YQLVEYHSLP YLKDNE+ILGH
Sbjct  23   SKEGKGKRLWKKVNYQLVEYHSLPAYLKDNEYILGH  58



>ref|XP_006350623.1| PREDICTED: adiponectin receptor protein 1-like [Solanum tuberosum]
Length=400

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +S+  K KRLWKKVKYQLVEYHSLPGYLKDNEFILGH
Sbjct  32   NSKEEKRKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  68



>ref|XP_009758486.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009758487.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Nicotiana sylvestris]
Length=400

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+ GKGKRLWKKV YQLVEYHSLP YLKDNE+ILGH
Sbjct  23   SKEGKGKRLWKKVNYQLVEYHSLPAYLKDNEYILGH  58



>ref|XP_002320004.2| hypothetical protein POPTR_0014s00900g [Populus trichocarpa]
 gb|EEE98319.2| hypothetical protein POPTR_0014s00900g [Populus trichocarpa]
Length=409

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S  GKGKRLWKKVKYQLVEY+SLP YL+DNEFILGH
Sbjct  26   SMEGKGKRLWKKVKYQLVEYNSLPAYLRDNEFILGH  61



>ref|XP_008237729.1| PREDICTED: adiponectin receptor protein-like isoform X1 [Prunus 
mume]
Length=412

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
              + GKGKRLWKKVKYQLVEYH+LP YL+DNE+ILGH
Sbjct  25   SPKEGKGKRLWKKVKYQLVEYHTLPNYLRDNEYILGH  61



>ref|XP_010028082.1| PREDICTED: heptahelical transmembrane protein 4-like [Eucalyptus 
grandis]
 gb|KCW54741.1| hypothetical protein EUGRSUZ_I00694 [Eucalyptus grandis]
Length=409

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            GKGKRLWKKVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  28   GKGKRLWKKVKYQLVEYHSLPAYLRDNEYIVGH  60



>ref|XP_007205266.1| hypothetical protein PRUPE_ppa006424mg [Prunus persica]
 gb|EMJ06465.1| hypothetical protein PRUPE_ppa006424mg [Prunus persica]
Length=412

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
              + GKGKRLWKKVKYQLVEYH+LP YL+DNE+ILGH
Sbjct  25   SPKEGKGKRLWKKVKYQLVEYHTLPNYLRDNEYILGH  61



>ref|XP_008237736.1| PREDICTED: adiponectin receptor protein-like isoform X2 [Prunus 
mume]
Length=408

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
              + GKGKRLWKKVKYQLVEYH+LP YL+DNE+ILGH
Sbjct  25   SPKEGKGKRLWKKVKYQLVEYHTLPNYLRDNEYILGH  61



>gb|KHG23872.1| ADIPOR-like receptor protein [Gossypium arboreum]
Length=399

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            G GKRLWKKVKYQLVEYHSLPG+L+DNE+ILGH
Sbjct  28   GTGKRLWKKVKYQLVEYHSLPGFLRDNEYILGH  60



>ref|XP_008353207.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+  KGKRLWKKVKYQL+EYHSLP +L+DNEFILGH
Sbjct  27   SKEAKGKRLWKKVKYQLIEYHSLPYFLRDNEFILGH  62



>gb|ABM68566.1| hemolysin III-related family protein [Lilium longiflorum]
Length=400

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            + GKG+RLWKKVKYQLVEYHSLPGY+KDNE+ILG+
Sbjct  20   KEGKGRRLWKKVKYQLVEYHSLPGYMKDNEYILGY  54



>gb|EPS69882.1| hypothetical protein M569_04878, partial [Genlisea aurea]
Length=386

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R GKG+RLW KV+YQLVEYHSLPG+LKDNE+I+GH
Sbjct  13   RKGKGRRLWNKVRYQLVEYHSLPGFLKDNEYIIGH  47



>ref|XP_010273060.1| PREDICTED: heptahelical transmembrane protein 4-like [Nelumbo 
nucifera]
Length=413

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+GGK  R WKKVKYQLVEYHSLP YL+DNEFILGH
Sbjct  31   SKGGKRTRFWKKVKYQLVEYHSLPEYLRDNEFILGH  66



>ref|XP_008340762.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+  KGKRLWKKVKYQL+EYHSLP +L+DNEFILGH
Sbjct  27   SKEAKGKRLWKKVKYQLIEYHSLPYFLRDNEFILGH  62



>gb|KJB40281.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
 gb|KJB40283.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
 gb|KJB40284.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
Length=399

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            G+GKRLW+KVKYQLVEYHSLPG+L+DNE+ILGH
Sbjct  28   GRGKRLWEKVKYQLVEYHSLPGFLRDNEYILGH  60



>ref|XP_006426099.1| hypothetical protein CICLE_v10025731mg [Citrus clementina]
 gb|ESR39339.1| hypothetical protein CICLE_v10025731mg [Citrus clementina]
Length=411

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKG+RLWK+VK QLVEYH+LPGYL+DNEFI+GH
Sbjct  25   SSKEGKGRRLWKRVKCQLVEYHALPGYLRDNEFIIGH  61



>gb|KJB40282.1| hypothetical protein B456_007G056700 [Gossypium raimondii]
Length=396

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            G+GKRLW+KVKYQLVEYHSLPG+L+DNE+ILGH
Sbjct  25   GRGKRLWEKVKYQLVEYHSLPGFLRDNEYILGH  57



>ref|XP_009133930.1| PREDICTED: adiponectin receptor protein-like isoform X1 [Brassica 
rapa]
 emb|CDX75670.1| BnaA01g00320D [Brassica napus]
Length=374

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  304  RDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R     KGKRLW+KVKYQLVEYH+LP YL+DNE+ILGH
Sbjct  10   RLQPNAKGKRLWQKVKYQLVEYHALPAYLRDNEYILGH  47



>gb|KHN36309.1| ADIPOR-like receptor CG5315-like protein [Glycine soja]
Length=380

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KG+RLWKKVKYQLVEYHSLPGYL+DNE+IL H
Sbjct  14   KGRRLWKKVKYQLVEYHSLPGYLRDNEYILAH  45



>ref|XP_009371039.1| PREDICTED: heptahelical transmembrane protein 4-like [Pyrus x 
bretschneideri]
Length=397

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             KGKRLWKKV+YQL+EYHSLPG+L+DNEFILG+
Sbjct  30   AKGKRLWKKVRYQLIEYHSLPGFLRDNEFILGY  62



>ref|XP_008373649.1| PREDICTED: adiponectin receptor protein-like [Malus domestica]
Length=397

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             KGKRLWKKV+YQL+EYHSLPG+L+DNEFILG+
Sbjct  30   AKGKRLWKKVRYQLIEYHSLPGFLRDNEFILGY  62



>ref|XP_006572848.1| PREDICTED: uncharacterized protein LOC100778227 isoform X1 [Glycine 
max]
Length=366

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KG+RLWKKVKYQLVEYHSLPGYL+DNE+IL H
Sbjct  14   KGRRLWKKVKYQLVEYHSLPGYLRDNEYILAH  45



>ref|NP_001242849.1| uncharacterized protein LOC100778227 [Glycine max]
 gb|ACU22878.1| unknown [Glycine max]
Length=380

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KG+RLWKKVKYQLVEYHSLPGYL+DNE+IL H
Sbjct  14   KGRRLWKKVKYQLVEYHSLPGYLRDNEYILAH  45



>ref|XP_008790240.1| PREDICTED: adiponectin receptor protein-like [Phoenix dactylifera]
Length=414

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            GKG+RLWK+VKYQLVEYH+LPGYLKDNE+IL H
Sbjct  35   GKGRRLWKRVKYQLVEYHTLPGYLKDNEYILRH  67



>ref|XP_011031308.1| PREDICTED: heptahelical transmembrane protein 4-like [Populus 
euphratica]
Length=407

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SR GKGKRL  KV+YQLVEYHSLPGYL+DNEFI+GH
Sbjct  26   SREGKGKRLCNKVQYQLVEYHSLPGYLRDNEFIVGH  61



>ref|XP_010106925.1| Adiponectin receptor protein 2 [Morus notabilis]
 gb|EXC12641.1| Adiponectin receptor protein 2 [Morus notabilis]
Length=402

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +S   KGK LWKKV YQLVEYHSLPGYL+DNE+ILGH
Sbjct  19   ESNRAKGKSLWKKVTYQLVEYHSLPGYLRDNEYILGH  55



>ref|XP_004300330.1| PREDICTED: heptahelical transmembrane protein 4-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            GKGKRLWKKVKYQL+EYHSLP +L+DNEFILG+
Sbjct  24   GKGKRLWKKVKYQLIEYHSLPMFLRDNEFILGY  56



>ref|XP_009419320.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Musa 
acuminata subsp. malaccensis]
Length=403

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +1

Query  301  GRDSRG--GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            G   RG  GKG+ LW+KVKYQLVEYHSLPGYLKDNE+ILG+
Sbjct  12   GSIPRGKEGKGRPLWRKVKYQLVEYHSLPGYLKDNEYILGY  52



>ref|XP_007209192.1| hypothetical protein PRUPE_ppa006423mg [Prunus persica]
 gb|EMJ10391.1| hypothetical protein PRUPE_ppa006423mg [Prunus persica]
Length=412

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKG RLWKKVKYQL+EYH+LP +L+DNEFILG+
Sbjct  26   SSKEGKGTRLWKKVKYQLIEYHALPSFLRDNEFILGY  62



>ref|XP_004511819.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511820.1| PREDICTED: adiponectin receptor protein 1-like isoform X2 [Cicer 
arietinum]
Length=391

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            + GKG RLWKKVKYQLVEYHSLP +L+DNE+I+GH
Sbjct  22   KEGKGTRLWKKVKYQLVEYHSLPAFLRDNEYIIGH  56



>ref|XP_010446637.1| PREDICTED: heptahelical transmembrane protein 4 [Camelina sativa]
Length=387

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  29   KGKRLWQKVKYQLVEYHSLPAYLRDNEYIIGH  60



>ref|XP_004511821.1| PREDICTED: adiponectin receptor protein 1-like isoform X3 [Cicer 
arietinum]
Length=377

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  319  GKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            GKG RLWKKVKYQLVEYHSLP +L+DNE+I+GH
Sbjct  24   GKGTRLWKKVKYQLVEYHSLPAFLRDNEYIIGH  56



>ref|XP_002868976.1| hypothetical protein ARALYDRAFT_490848 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45235.1| hypothetical protein ARALYDRAFT_490848 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  28   KGKRLWQKVKYQLVEYHSLPAYLRDNEYIIGH  59



>ref|XP_010437193.1| PREDICTED: heptahelical transmembrane protein 4 [Camelina sativa]
Length=389

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  29   KGKRLWQKVKYQLVEYHSLPAYLRDNEYIIGH  60



>ref|XP_006283903.1| hypothetical protein CARUB_v10005020mg [Capsella rubella]
 gb|EOA16801.1| hypothetical protein CARUB_v10005020mg [Capsella rubella]
Length=387

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  29   KGKRLWQKVKYQLVEYHSLPAYLRDNEYIIGH  60



>ref|XP_010679658.1| PREDICTED: heptahelical transmembrane protein 4-like [Beta vulgaris 
subsp. vulgaris]
Length=398

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            ++ GKGKRLWKKVKYQLVEYHSLPGYL+DNE+I  H
Sbjct  13   NKQGKGKRLWKKVKYQLVEYHSLPGYLRDNEYIKDH  48



>ref|XP_008238506.1| PREDICTED: ADIPOR-like receptor IZH1 [Prunus mume]
 ref|XP_008238507.1| PREDICTED: ADIPOR-like receptor IZH1 [Prunus mume]
Length=412

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKG R+WKKVKYQL+EYH+LP +L+DNEFILG+
Sbjct  26   SSKEGKGTRIWKKVKYQLIEYHALPSFLRDNEFILGY  62



>ref|XP_006411861.1| hypothetical protein EUTSA_v10025437mg [Eutrema salsugineum]
 dbj|BAJ34118.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53314.1| hypothetical protein EUTSA_v10025437mg [Eutrema salsugineum]
Length=386

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            +  KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  24   QNPKGKRLWRKVKYQLVEYHSLPDYLRDNEYIIGH  58



>ref|XP_004234646.1| PREDICTED: heptahelical transmembrane protein 4-like [Solanum 
lycopersicum]
Length=400

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +1

Query  283  SNDGKYGRDS--RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S++ +  RDS  +  K KRLWKKV  QLVEYHSLPGYLKDNEFILGH
Sbjct  22   SSETQPFRDSISKKEKQKRLWKKVNNQLVEYHSLPGYLKDNEFILGH  68



>dbj|BAD43945.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43963.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43999.1| putative protein [Arabidopsis thaliana]
Length=374

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVE+HSLP YL+DNE+I+GH
Sbjct  27   KGKRLWQKVKYQLVEFHSLPAYLRDNEYIIGH  58



>ref|NP_195545.1| heptahelical protein 5 [Arabidopsis thaliana]
 sp|Q9SVF3.1|HPP5_ARATH RecName: Full=Heptahelical transmembrane protein 5; AltName: 
Full=PAQR family protein HHP5 [Arabidopsis thaliana]
 emb|CAB37488.1| putative protein [Arabidopsis thaliana]
 emb|CAB80497.1| putative protein [Arabidopsis thaliana]
 gb|AAL49910.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20272.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86913.1| heptahelical protein 5 [Arabidopsis thaliana]
Length=374

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVE+HSLP YL+DNE+I+GH
Sbjct  27   KGKRLWQKVKYQLVEFHSLPAYLRDNEYIIGH  58



>ref|XP_002310891.1| hypothetical protein POPTR_0007s14850g [Populus trichocarpa]
 gb|EEE91341.1| hypothetical protein POPTR_0007s14850g [Populus trichocarpa]
Length=401

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            SR GKGKRL  K +YQLVEYHSLPGYL+DNEFI+GH
Sbjct  20   SREGKGKRLCNKAQYQLVEYHSLPGYLRDNEFIVGH  55



>ref|XP_010432040.1| PREDICTED: heptahelical transmembrane protein 4-like [Camelina 
sativa]
Length=387

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYHSLP YL+DNE+I+GH
Sbjct  29   KGKRLWQKVKYQLVEYHSLPDYLRDNEYIIGH  60



>ref|NP_195483.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 ref|NP_001190946.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 sp|Q9SZG0.1|HHP4_ARATH RecName: Full=Heptahelical transmembrane protein 4; AltName: 
Full=PAQR family protein HHP4 [Arabidopsis thaliana]
 gb|AAK25883.1|AF360173_1 unknown protein [Arabidopsis thaliana]
 emb|CAB38307.1| putative protein [Arabidopsis thaliana]
 emb|CAB80433.1| putative protein [Arabidopsis thaliana]
 gb|AAL07197.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86824.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
 gb|AEE86825.1| heptahelical transmembrane protein HHP4 [Arabidopsis thaliana]
Length=385

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVE+HSLP YL+DNE+I+GH
Sbjct  27   KGKRLWQKVKYQLVEFHSLPAYLRDNEYIIGH  58



>ref|XP_002285384.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664496.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664497.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010664498.1| PREDICTED: heptahelical transmembrane protein 4 isoform X1 [Vitis 
vinifera]
 emb|CBI19385.3| unnamed protein product [Vitis vinifera]
Length=415

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+  +GK+LW++V+ QLVEYHSLPGYL+DNEFILGH
Sbjct  29   SKARQGKKLWRRVRCQLVEYHSLPGYLRDNEFILGH  64



>ref|XP_010664499.1| PREDICTED: heptahelical transmembrane protein 4 isoform X2 [Vitis 
vinifera]
Length=377

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+  +GK+LW++V+ QLVEYHSLPGYL+DNEFILGH
Sbjct  29   SKARQGKKLWRRVRCQLVEYHSLPGYLRDNEFILGH  64



>ref|XP_008340785.1| PREDICTED: adiponectin receptor protein 1-like [Malus domestica]
Length=397

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  310  SRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            S+  KGKRL KKVKYQL+EYHSLP +L+DNEFILGH
Sbjct  27   SKEAKGKRLXKKVKYQLIEYHSLPXFLRDNEFILGH  62



>gb|KDP41605.1| hypothetical protein JCGZ_16012 [Jatropha curcas]
Length=409

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+ GKG  LWKKVKYQLVEYHSLPGYL+DNEFI G+
Sbjct  29   SSKEGKGHILWKKVKYQLVEYHSLPGYLRDNEFIHGY  65



>ref|XP_010687835.1| PREDICTED: heptahelical transmembrane protein 4-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=408

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            R  KGK+LW+KV+YQL EYHSLP YL+DNE+ILGH
Sbjct  23   REKKGKKLWRKVRYQLTEYHSLPAYLRDNEYILGH  57



>ref|XP_010936139.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
 ref|XP_010936140.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
 ref|XP_010936141.1| PREDICTED: heptahelical transmembrane protein ADIPOR3-like [Elaeis 
guineensis]
Length=404

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  313  RGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFIL  411
            + GKG+RLWK+VKYQLVEYHSLP YLKDNE+IL
Sbjct  23   KEGKGRRLWKRVKYQLVEYHSLPVYLKDNEYIL  55



>emb|CDX69320.1| BnaC01g01330D [Brassica napus]
Length=383

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KGKRLW+KVKYQLVEYH+LP YL+DNE+IL H
Sbjct  25   KGKRLWQKVKYQLVEYHALPAYLRDNEYILRH  56



>ref|XP_007136770.1| hypothetical protein PHAVU_009G072600g [Phaseolus vulgaris]
 gb|ESW08764.1| hypothetical protein PHAVU_009G072600g [Phaseolus vulgaris]
Length=457

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +1

Query  286  NDGKYGRDSRGG----KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            ND   G D R      KG RLW+K+KYQLVEY+SLP Y++DNEFILG+
Sbjct  71   NDLLDGEDERTSSKLRKGVRLWRKLKYQLVEYNSLPAYMRDNEFILGY  118



>ref|XP_003523624.1| PREDICTED: adiponectin receptor protein 1-like [Glycine max]
Length=402

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +1

Query  286  NDGKYGRDSRGG----KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            ND   G D R      KG RLW+K+KYQL+EY+SLP Y++DNEFILG+
Sbjct  17   NDFVDGEDERASSKSRKGVRLWRKLKYQLIEYNSLPAYMRDNEFILGY  64



>ref|XP_011099397.1| PREDICTED: heptahelical transmembrane protein 4-like [Sesamum 
indicum]
 ref|XP_011099398.1| PREDICTED: heptahelical transmembrane protein 4-like [Sesamum 
indicum]
Length=413

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +1

Query  235  MEKDQGN-IXXMGGXCXSNDGKYGRDSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFIL  411
            M + QGN    + G       K       G+G  LWKKVKYQLVEYHSLP YLKDNE+IL
Sbjct  1    MGQTQGNSALEVSGLGSDETEKLCSSPIEGRGASLWKKVKYQLVEYHSLPAYLKDNEYIL  60



>emb|CDY29576.1| BnaA03g54210D [Brassica napus]
Length=387

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            K +RLW+KVKYQLVEYH+LP YL+DNE+I+GH
Sbjct  29   KRRRLWQKVKYQLVEYHALPAYLRDNEYIIGH  60



>ref|XP_009138520.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009138521.1| PREDICTED: adiponectin receptor protein 1-like isoform X1 [Brassica 
rapa]
Length=387

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            K +RLW+KVKYQLVEYH+LP YL+DNE+I+GH
Sbjct  29   KRRRLWQKVKYQLVEYHALPAYLRDNEYIIGH  60



>emb|CDX72648.1| BnaC07g46700D [Brassica napus]
Length=384

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            K +RLW+KVKYQLVEYH+LP YL+DNE+I+GH
Sbjct  26   KRRRLWQKVKYQLVEYHALPAYLRDNEYIIGH  57



>ref|XP_002510080.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52267.1| conserved hypothetical protein [Ricinus communis]
Length=416

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            KG  LWKKVKYQLV+YHSLPGYLKDNEFI G+
Sbjct  34   KGHMLWKKVKYQLVDYHSLPGYLKDNEFIRGY  65



>ref|XP_006581272.1| PREDICTED: adiponectin receptor protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581273.1| PREDICTED: adiponectin receptor protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006581274.1| PREDICTED: adiponectin receptor protein 2-like isoform X3 [Glycine 
max]
Length=402

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +1

Query  286  NDGKYGRDSRGG----KGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
            ND     D R      KG RLW+K+KYQLVEY+SLP Y++DNEFILG+
Sbjct  17   NDFVDCEDERASSKFRKGVRLWRKLKYQLVEYNSLPPYMRDNEFILGY  64



>ref|XP_004501515.1| PREDICTED: ADIPOR-like receptor CG5315-like [Cicer arietinum]
Length=403

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  307  DSRGGKGKRLWKKVKYQLVEYHSLPGYLKDNEFILGH  417
             S+G K  ++++K KYQL+EY SLP YL+DNEFILGH
Sbjct  28   QSKGWKRVKIFEKSKYQLIEYSSLPHYLRDNEFILGH  64



>ref|XP_001778966.1| predicted protein [Physcomitrella patens]
 gb|EDQ56221.1| predicted protein [Physcomitrella patens]
Length=434

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = +1

Query  319  GKGKRLWKKVK--YQLVEYHSLPGYLKDNEFILGH  417
            G+ + LW+KVK  Y LVEYH LP YL+DNE+IL H
Sbjct  61   GRAQDLWRKVKKQYDLVEYHVLPDYLRDNEYILRH  95



>ref|XP_001757760.1| predicted protein [Physcomitrella patens]
 gb|EDQ77400.1| predicted protein [Physcomitrella patens]
Length=432

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 2/34 (6%)
 Frame = +1

Query  322  KGKRLWKKVK--YQLVEYHSLPGYLKDNEFILGH  417
            + K LW+KVK  Y LVEYH LP YL+DNEFIL H
Sbjct  61   RAKDLWRKVKKQYALVEYHVLPEYLRDNEFILRH  94



>ref|XP_007047564.1| Heptahelical protein 4 isoform 1 [Theobroma cacao]
 gb|EOX91721.1| Heptahelical protein 4 isoform 1 [Theobroma cacao]
Length=497

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +1

Query  352  YQLVEYHSLPGYLKDNEFILGH  417
            YQLVEYHSLPGYL+DNE+I+GH
Sbjct  125  YQLVEYHSLPGYLRDNEYIVGH  146



>gb|KJB84319.1| hypothetical protein B456_N018100 [Gossypium raimondii]
Length=110

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 1/29 (3%)
 Frame = +1

Query  322  KGKRLWKKVKYQLVEYHSLPGYLKDNEFI  408
             GKRLW+KVKYQLVEYHSLP  L  N FI
Sbjct  81   TGKRLWEKVKYQLVEYHSLPN-LICNLFI  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700