BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS163B08

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804950.1|  PREDICTED: gamma aminobutyrate transaminase ...    249   4e-76   Nicotiana sylvestris
ref|XP_009592076.1|  PREDICTED: gamma aminobutyrate transaminase ...    245   1e-74   Nicotiana tomentosiformis
ref|XP_010313637.1|  PREDICTED: gamma aminobutyrate transaminase ...    245   1e-74   
ref|XP_009789181.1|  PREDICTED: gamma aminobutyrate transaminase ...    244   3e-74   Nicotiana sylvestris
ref|XP_006351982.1|  PREDICTED: gamma aminobutyrate transaminase ...    242   2e-73   Solanum tuberosum [potatoes]
ref|NP_001233777.1|  gamma aminobutyrate transaminase 3, chloropl...    242   2e-73   
ref|XP_006357874.1|  PREDICTED: gamma aminobutyrate transaminase ...    241   3e-73   Solanum tuberosum [potatoes]
ref|NP_001234336.1|  gamma aminobutyrate transaminase 1, mitochon...    237   1e-71   
gb|AGX01485.1|  mitochondrial gamma aminobutyrate transaminase 1        237   1e-71   Nicotiana tabacum [American tobacco]
ref|XP_009610291.1|  PREDICTED: gamma aminobutyrate transaminase ...    236   5e-71   Nicotiana tomentosiformis
ref|XP_009610292.1|  PREDICTED: gamma aminobutyrate transaminase ...    226   2e-67   Nicotiana tomentosiformis
gb|EYU42835.1|  hypothetical protein MIMGU_mgv1a004733mg                226   3e-67   Erythranthe guttata [common monkey flower]
ref|XP_011100393.1|  PREDICTED: gamma aminobutyrate transaminase ...    224   1e-66   Sesamum indicum [beniseed]
gb|KDP30431.1|  hypothetical protein JCGZ_16670                         224   1e-66   Jatropha curcas
ref|XP_010941664.1|  PREDICTED: probable gamma-aminobutyrate tran...    224   1e-66   Elaeis guineensis
gb|AGF95098.1|  4-aminobutyrate aminotransferase                        215   2e-66   Prunus persica
ref|XP_008652021.1|  PREDICTED: gamma aminobutyrate transaminase ...    222   1e-65   
ref|XP_006429770.1|  hypothetical protein CICLE_v10011509mg             220   5e-65   Citrus clementina [clementine]
gb|KDO64363.1|  hypothetical protein CISIN_1g010250mg                   219   8e-65   Citrus sinensis [apfelsine]
ref|XP_010036076.1|  PREDICTED: gamma aminobutyrate transaminase ...    219   1e-64   Eucalyptus grandis [rose gum]
ref|XP_009399251.1|  PREDICTED: probable gamma-aminobutyrate tran...    217   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008229658.1|  PREDICTED: gamma aminobutyrate transaminase ...    217   5e-64   Prunus mume [ume]
gb|KHG00607.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    214   6e-64   Gossypium arboreum [tree cotton]
gb|ABF69998.1|  gamma-aminobutyrate transaminase, putative              218   7e-64   Musa acuminata [banana]
ref|XP_008798241.1|  PREDICTED: gamma-aminobutyrate transaminase ...    216   1e-63   
ref|XP_007215238.1|  hypothetical protein PRUPE_ppa004369mg             215   3e-63   Prunus persica
ref|XP_011100394.1|  PREDICTED: gamma aminobutyrate transaminase ...    214   9e-63   
ref|XP_007049029.1|  Pyridoxal phosphate-dependent transferases s...    214   1e-62   
ref|XP_006858237.1|  hypothetical protein AMTR_s00062p00194620          212   4e-62   Amborella trichopoda
ref|XP_002307913.1|  POLLEN-PISTIL INTERACTION 2 family protein         212   4e-62   
ref|XP_009347869.1|  PREDICTED: probable gamma-aminobutyrate tran...    212   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_009349580.1|  PREDICTED: gamma aminobutyrate transaminase ...    212   6e-62   Pyrus x bretschneideri [bai li]
sp|B8BBZ7.1|GATP3_ORYSI  RecName: Full=Probable gamma-aminobutyra...    212   6e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009349581.1|  PREDICTED: gamma aminobutyrate transaminase ...    212   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_002322549.2|  hypothetical protein POPTR_0016s02000g             211   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002445207.1|  hypothetical protein SORBIDRAFT_07g005930          211   2e-61   Sorghum bicolor [broomcorn]
gb|AFS28620.1|  gamma-aminobutyrate transaminase 1                      210   2e-61   Malus domestica [apple tree]
gb|EPS57260.1|  hypothetical protein M569_17559                         198   2e-61   Genlisea aurea
ref|XP_008365554.1|  PREDICTED: gamma-aminobutyrate transaminase ...    210   3e-61   
ref|NP_001061237.1|  Os08g0205900                                       210   3e-61   
ref|XP_011001061.1|  PREDICTED: gamma aminobutyrate transaminase ...    209   4e-61   Populus euphratica
ref|XP_010260596.1|  PREDICTED: probable gamma-aminobutyrate tran...    208   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_006659928.1|  PREDICTED: probable gamma-aminobutyrate tran...    209   1e-60   
emb|CDP16027.1|  unnamed protein product                                208   1e-60   Coffea canephora [robusta coffee]
ref|XP_004972609.1|  PREDICTED: probable gamma-aminobutyrate tran...    208   2e-60   Setaria italica
ref|XP_008378345.1|  PREDICTED: gamma aminobutyrate transaminase ...    208   2e-60   Malus domestica [apple tree]
ref|XP_004303943.1|  PREDICTED: gamma aminobutyrate transaminase ...    207   3e-60   Fragaria vesca subsp. vesca
ref|NP_001280788.1|  gamma aminobutyrate transaminase 3, chloropl...    207   3e-60   Malus domestica [apple tree]
ref|XP_003573535.1|  PREDICTED: probable gamma-aminobutyrate tran...    207   3e-60   Brachypodium distachyon [annual false brome]
ref|XP_010234450.1|  PREDICTED: probable gamma-aminobutyrate tran...    207   3e-60   Brachypodium distachyon [annual false brome]
ref|XP_002268803.1|  PREDICTED: gamma aminobutyrate transaminase ...    207   4e-60   Vitis vinifera
gb|AFW59441.1|  putative aminotransferase class III superfamily p...    205   4e-60   
ref|XP_010093137.1|  putative aminotransferase y4uB                     206   5e-60   
emb|CBI34106.3|  unnamed protein product                                207   5e-60   Vitis vinifera
ref|XP_011004456.1|  PREDICTED: gamma aminobutyrate transaminase ...    207   5e-60   Populus euphratica
ref|XP_002521054.1|  aminobutyrate aminotransferase, putative           206   8e-60   
ref|NP_001152508.1|  aminotransferase y4uB                              206   1e-59   Zea mays [maize]
gb|ACF87978.1|  unknown                                                 206   2e-59   Zea mays [maize]
ref|NP_001053863.1|  Os04g0614600                                       205   3e-59   
gb|EEC77995.1|  hypothetical protein OsI_17385                          204   4e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_004171018.1|  PREDICTED: gamma aminobutyrate transaminase ...    204   4e-59   
ref|XP_004147736.1|  PREDICTED: gamma aminobutyrate transaminase ...    204   4e-59   Cucumis sativus [cucumbers]
sp|Q01K11.1|GATP1_ORYSI  RecName: Full=Gamma-aminobutyrate transa...    204   6e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006652817.1|  PREDICTED: gamma-aminobutyrate transaminase ...    204   7e-59   Oryza brachyantha
dbj|BAK05511.1|  predicted protein                                      204   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004976801.1|  PREDICTED: gamma-aminobutyrate transaminase ...    203   1e-58   Setaria italica
gb|KHN05488.1|  Putative aminotransferase y4uB                          202   2e-58   Glycine soja [wild soybean]
ref|XP_006592029.1|  PREDICTED: gamma aminobutyrate transaminase ...    202   2e-58   Glycine max [soybeans]
dbj|BAI66419.1|  aminotransferase                                       202   2e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008677242.1|  PREDICTED: aminotransferase y4uB isoform X1        202   2e-58   Zea mays [maize]
gb|AFW61009.1|  putative aminotransferase class III superfamily p...    202   3e-58   
gb|AFW61008.1|  putative aminotransferase class III superfamily p...    202   3e-58   
ref|NP_001148620.1|  aminotransferase y4uB                              202   3e-58   Zea mays [maize]
ref|XP_002883348.1|  gamma-aminobutyrate transaminase subunit pre...    201   7e-58   
ref|XP_008451896.1|  PREDICTED: gamma aminobutyrate transaminase ...    201   9e-58   Cucumis melo [Oriental melon]
ref|XP_003580544.1|  PREDICTED: gamma-aminobutyrate transaminase ...    201   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_009597725.1|  PREDICTED: gamma aminobutyrate transaminase ...    190   1e-57   
ref|XP_008451895.1|  PREDICTED: gamma aminobutyrate transaminase ...    201   1e-57   Cucumis melo [Oriental melon]
ref|XP_010525163.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-aminob...    199   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_002447091.1|  hypothetical protein SORBIDRAFT_06g028440          199   5e-57   Sorghum bicolor [broomcorn]
ref|XP_010525162.1|  PREDICTED: gamma-aminobutyrate transaminase ...    198   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_003537747.1|  PREDICTED: gamma aminobutyrate transaminase ...    198   1e-56   Glycine max [soybeans]
emb|CDY58748.1|  BnaCnng33690D                                          197   2e-56   Brassica napus [oilseed rape]
gb|KHN09253.1|  Putative aminotransferase y4uB                          197   2e-56   Glycine soja [wild soybean]
ref|XP_006406200.1|  hypothetical protein EUTSA_v10020563mg             196   3e-56   Eutrema salsugineum [saltwater cress]
gb|KJB22727.1|  hypothetical protein B456_004G063100                    196   6e-56   Gossypium raimondii
ref|XP_006592030.1|  PREDICTED: gamma aminobutyrate transaminase ...    195   9e-56   Glycine max [soybeans]
ref|XP_008668890.1|  PREDICTED: gamma-aminobutyrate transaminase ...    195   1e-55   Zea mays [maize]
gb|KFK39511.1|  hypothetical protein AALP_AA3G253600                    195   1e-55   Arabis alpina [alpine rockcress]
ref|XP_009776834.1|  PREDICTED: gamma aminobutyrate transaminase ...    191   1e-55   Nicotiana sylvestris
ref|XP_007131572.1|  hypothetical protein PHAVU_011G024300g             195   1e-55   Phaseolus vulgaris [French bean]
ref|XP_006406198.1|  hypothetical protein EUTSA_v10020531mg             195   2e-55   
emb|CDY37389.1|  BnaC05g30410D                                          194   2e-55   Brassica napus [oilseed rape]
ref|XP_009145420.1|  PREDICTED: gamma-aminobutyrate transaminase ...    194   2e-55   Brassica rapa
tpg|DAA59557.1|  TPA: putative aminotransferase class III superfa...    193   2e-55   
ref|XP_004505667.1|  PREDICTED: gamma aminobutyrate transaminase ...    194   2e-55   Cicer arietinum [garbanzo]
ref|XP_010488236.1|  PREDICTED: gamma-aminobutyrate transaminase ...    193   6e-55   Camelina sativa [gold-of-pleasure]
ref|NP_566700.1|  gamma-aminobutyrate transaminase POP2                 192   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAK52899.1|AF351125_1  gamma-aminobutyrate transaminase subuni...    192   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64364.1|  hypothetical protein CISIN_1g010250mg                   191   1e-54   Citrus sinensis [apfelsine]
ref|NP_001189947.1|  gamma-aminobutyrate transaminase POP2              192   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511056.1|  PREDICTED: gamma-aminobutyrate transaminase ...    192   2e-54   
dbj|BAB03068.1|  aminotransferase-like protein                          191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607298.1|  Aminotransferase y4uB                              191   4e-54   Medicago truncatula
ref|XP_010648197.1|  PREDICTED: gamma aminobutyrate transaminase ...    191   4e-54   Vitis vinifera
ref|XP_009109118.1|  PREDICTED: gamma-aminobutyrate transaminase ...    191   4e-54   Brassica rapa
emb|CDY39506.1|  BnaA01g24820D                                          190   7e-54   Brassica napus [oilseed rape]
emb|CBI34103.3|  unnamed protein product                                189   1e-53   Vitis vinifera
ref|XP_006297475.1|  hypothetical protein CARUB_v10013496mg             189   1e-53   
ref|XP_004244777.1|  PREDICTED: gamma aminobutyrate transaminase ...    188   2e-53   Solanum lycopersicum
gb|ADM13673.1|  putative aminotransferase                               188   3e-53   Capsicum annuum
ref|XP_010466490.1|  PREDICTED: gamma-aminobutyrate transaminase ...    188   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010313638.1|  PREDICTED: gamma aminobutyrate transaminase ...    186   8e-53   
gb|AAC78480.1|  putative aminotransferase                               186   1e-52   Capsicum chinense [bonnet pepper]
ref|XP_010680154.1|  PREDICTED: gamma aminobutyrate transaminase ...    186   4e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|ADG65346.1|  putative aminotransferase                               184   8e-52   Capsicum frutescens [bird pepper]
ref|XP_011467676.1|  PREDICTED: gamma aminobutyrate transaminase ...    182   2e-51   Fragaria vesca subsp. vesca
ref|NP_001053862.1|  Os04g0614500                                       182   5e-51   
ref|XP_008464679.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    181   3e-50   Cucumis melo [Oriental melon]
ref|XP_009145417.1|  PREDICTED: gamma-aminobutyrate transaminase ...    180   4e-50   Brassica rapa
ref|XP_004166491.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    179   8e-50   
emb|CDY10622.1|  BnaA05g17400D                                          179   8e-50   Brassica napus [oilseed rape]
ref|XP_004145993.1|  PREDICTED: gamma aminobutyrate transaminase ...    179   1e-49   
ref|XP_006652818.1|  PREDICTED: probable gamma-aminobutyrate tran...    178   2e-49   Oryza brachyantha
ref|XP_006351980.1|  PREDICTED: gamma aminobutyrate transaminase ...    177   2e-49   Solanum tuberosum [potatoes]
ref|XP_004147774.1|  PREDICTED: gamma aminobutyrate transaminase ...    177   7e-49   Cucumis sativus [cucumbers]
gb|AFK39370.1|  unknown                                                 176   9e-49   Lotus japonicus
emb|CAD12664.1|  viroid RNA-binding protein                             176   2e-48   Solanum lycopersicum
gb|EEC77994.1|  hypothetical protein OsI_17384                          174   6e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001234340.1|  gamma aminobutyrate transaminase 2                 172   3e-47   
gb|EMT06765.1|  Putative aminotransferase y4uB                          172   4e-47   
gb|EMS61591.1|  putative aminotransferase y4uB                          171   1e-46   Triticum urartu
ref|NP_001045660.1|  Os02g0112900                                       170   2e-46   
gb|AAK11219.1|AF324485_1  aminotransferase-like protein                 170   3e-46   Oryza sativa [red rice]
gb|EEE61675.1|  hypothetical protein OsJ_16144                          164   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451902.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    164   2e-44   
ref|XP_002970285.1|  hypothetical protein SELMODRAFT_270846             156   2e-41   Selaginella moellendorffii
ref|XP_002978448.1|  hypothetical protein SELMODRAFT_177017             156   2e-41   Selaginella moellendorffii
ref|XP_008652184.1|  PREDICTED: gamma-aminobutyrate transaminase ...    139   5e-38   
ref|XP_008652185.1|  PREDICTED: gamma-aminobutyrate transaminase ...    139   5e-38   Zea mays [maize]
ref|XP_001783174.1|  predicted protein                                  147   6e-38   
ref|XP_001762156.1|  predicted protein                                  144   5e-37   
gb|EMS53048.1|  putative aminotransferase y4uB                          144   1e-36   Triticum urartu
gb|EMT11453.1|  Putative aminotransferase y4uB                          139   7e-35   
ref|XP_008662070.1|  PREDICTED: aminotransferase y4uB isoform X1        138   8e-35   Zea mays [maize]
ref|XP_004173032.1|  PREDICTED: gamma aminobutyrate transaminase ...    133   4e-33   
ref|XP_003604707.1|  Aminotransferase                                   119   1e-29   
ref|XP_006576527.1|  PREDICTED: gamma aminobutyrate transaminase ...    115   7e-29   
gb|EEC77996.1|  hypothetical protein OsI_17386                          123   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_008674137.1|  PREDICTED: gamma-aminobutyrate transaminase ...    111   6e-28   
ref|XP_008669882.1|  PREDICTED: gamma-aminobutyrate transaminase ...  99.8    3e-23   
ref|XP_008669883.1|  PREDICTED: gamma-aminobutyrate transaminase ...  99.4    3e-23   
ref|WP_018897972.1|  aminotransferase                                   102   7e-22   Rhizobium sp. 2MFCol3.1
ref|WP_013742690.1|  aminotransferase                                   101   8e-22   Pusillimonas sp. T7-7
ref|WP_041862975.1|  aminotransferase                                 99.8    4e-21   Bordetella petrii
emb|CAP43438.1|  putative aminotransferase                            99.8    5e-21   Bordetella petrii
ref|WP_027569703.1|  aminotransferase                                 99.4    6e-21   Bradyrhizobium sp. URHA0013
ref|WP_027517565.1|  aminotransferase                                 99.4    6e-21   Bradyrhizobium sp. WSM1417
ref|WP_028793896.1|  aminotransferase                                 99.4    7e-21   Thalassobaculum
ref|WP_025035884.1|  aminotransferase                                 99.0    9e-21   Bradyrhizobium sp. DOA9
ref|WP_018456285.1|  aminotransferase                                 99.0    9e-21   Bradyrhizobium
ref|WP_007591914.1|  aminotransferase                                 99.0    9e-21   Bradyrhizobium sp. WSM1253
ref|WP_008129949.1|  aminotransferase                                 99.0    9e-21   Bradyrhizobium sp. YR681
ref|WP_007609403.1|  aminotransferase                                 99.0    1e-20   Bradyrhizobium sp. WSM471
ref|WP_027542945.1|  aminotransferase                                 98.6    1e-20   Bradyrhizobium sp. WSM2254
gb|EJZ32369.1|  aminotransferase                                      98.6    1e-20   
ref|WP_036022740.1|  aminotransferase                                 98.6    1e-20   Bradyrhizobium yuanmingense
ref|WP_036000540.1|  aminotransferase                                 98.6    1e-20   Bradyrhizobium yuanmingense
ref|WP_025516482.1|  aminotransferase                                 98.6    1e-20   Bordetella trematum
ref|WP_018317519.1|  aminotransferase                                 98.6    1e-20   Bradyrhizobium sp. WSM2793
ref|WP_044033419.1|  aminotransferase                                 98.2    2e-20   Roseobacter denitrificans
gb|ABG31913.1|  aminotransferase                                      98.2    2e-20   Roseobacter denitrificans OCh 114
ref|WP_035675727.1|  aminotransferase                                 98.2    2e-20   Bradyrhizobium liaoningense
ref|WP_024338082.1|  aminotransferase                                 98.2    2e-20   Bradyrhizobium japonicum
ref|WP_044433671.1|  aminotransferase                                 98.2    2e-20   Skermanella aerolata
ref|WP_025165321.1|  aminotransferase                                 97.8    2e-20   Pseudomonas taeanensis
ref|WP_035715448.1|  aminotransferase                                 97.8    2e-20   Bradyrhizobium sp. CCBAU 43298
ref|WP_023048105.1|  MULTISPECIES: aminotransferase                   97.8    2e-20   Pseudomonas
ref|WP_027557626.1|  MULTISPECIES: aminotransferase                   97.8    2e-20   Bradyrhizobium
ref|WP_027551405.1|  aminotransferase                                 97.8    3e-20   Bradyrhizobium sp. Cp5.3
ref|WP_026641250.1|  aminotransferase                                 97.4    3e-20   Bordetella petrii
ref|WP_028181072.1|  aminotransferase                                 97.4    3e-20   Bradyrhizobium japonicum
ref|WP_027576286.1|  aminotransferase                                 97.4    3e-20   Bradyrhizobium sp. WSM1743
ref|WP_011086907.1|  MULTISPECIES: aminotransferase                   97.4    3e-20   Bradyrhizobium diazoefficiens
ref|WP_028355511.1|  aminotransferase                                 97.1    4e-20   Bordetella
ref|WP_028171115.1|  MULTISPECIES: aminotransferase                   97.4    4e-20   Bradyrhizobium
ref|WP_028136798.1|  aminotransferase                                 97.1    4e-20   Bradyrhizobium japonicum
ref|WP_041710497.1|  aminotransferase                                 97.1    4e-20   
ref|WP_039371201.1|  aminotransferase                                 97.1    4e-20   Burkholderia
ref|WP_024509951.1|  aminotransferase                                 97.1    4e-20   Bradyrhizobium sp. ARR65
ref|WP_034191978.1|  aminotransferase                                 97.1    4e-20   Burkholderia cenocepacia
ref|WP_041798615.1|  aminotransferase                                 97.1    5e-20   
ref|WP_018645424.1|  aminotransferase                                 97.1    5e-20   Bradyrhizobium japonicum
ref|WP_028144979.1|  MULTISPECIES: aminotransferase                   96.7    5e-20   Bradyrhizobium
gb|ABD06201.1|  aminotransferase                                      96.7    5e-20   Rhodopseudomonas palustris HaA2
gb|KJC55260.1|  aminotransferase                                      96.7    6e-20   Bradyrhizobium sp. LTSP849
gb|KJC51996.1|  aminotransferase                                      96.7    6e-20   Bradyrhizobium sp. LTSP857
ref|WP_015686609.1|  aminotransferase                                 96.7    6e-20   Bradyrhizobium sp. S23321
ref|WP_027535373.1|  aminotransferase                                 96.7    6e-20   Bradyrhizobium sp. WSM3983
ref|WP_028055523.1|  aminotransferase                                 96.7    6e-20   Sinorhizobium meliloti
ref|WP_025374662.1|  aminotransferase                                 96.3    7e-20   
ref|WP_041957850.1|  aminotransferase                                 96.3    7e-20   Bradyrhizobium japonicum
gb|AFK64419.1|  aminotransferase                                      97.1    7e-20   Advenella kashmirensis WT001
ref|WP_027523883.1|  aminotransferase                                 96.3    7e-20   Bradyrhizobium sp. Ec3.3
ref|WP_024810724.1|  aminotransferase                                 96.3    8e-20   Oceanicola sp. HL-35
ref|XP_011468608.1|  PREDICTED: gamma aminobutyrate transaminase ...  94.7    8e-20   Fragaria vesca subsp. vesca
ref|WP_042300360.1|  aminotransferase                                 96.3    8e-20   Paraburkholderia kururiensis
ref|WP_028466856.1|  aminotransferase                                 96.3    8e-20   Nisaea denitrificans
ref|WP_017775036.1|  aminotransferase                                 95.9    9e-20   Paraburkholderia kururiensis
ref|WP_016558738.1|  aminotransferase                                 96.3    1e-19   Rhizobium grahamii
ref|WP_036254762.1|  MULTISPECIES: aminotransferase                   95.9    1e-19   Mesorhizobium
ref|WP_020680029.1|  hypothetical protein                             95.9    1e-19   Marinobacterium rhizophilum
ref|WP_029742660.1|  aminotransferase                                 95.5    2e-19   Rhizobiales bacterium
ref|WP_008069788.1|  aminotransferase                                 95.5    2e-19   Pseudomonas sp. GM79
ref|WP_031360219.1|  aminotransferase                                 95.5    2e-19   Caballeronia sordidicola
ref|WP_013962061.1|  aminotransferase                                 95.5    2e-19   Roseobacter litoralis
ref|WP_020336055.1|  hypothetical protein                             95.5    2e-19   
ref|WP_017227445.1|  hypothetical protein                             95.5    2e-19   
ref|WP_038761742.1|  aminotransferase                                 95.5    2e-19   
gb|AHY51042.1|  hypothetical protein BJS_03890                        95.1    2e-19   Bradyrhizobium japonicum SEMIA 5079
ref|WP_033067194.1|  aminotransferase                                 95.1    2e-19   
ref|WP_038957353.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium japonicum
ref|WP_038937402.1|  MULTISPECIES: aminotransferase                   95.1    2e-19   Bradyrhizobium
gb|KGJ67633.1|  putative aminotransferase                             95.1    2e-19   Bradyrhizobium diazoefficiens SEMIA 5080
ref|WP_014495749.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium japonicum
gb|AHY56964.1|  aminotransferase                                      95.1    2e-19   Bradyrhizobium japonicum SEMIA 5079
ref|WP_039149393.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium japonicum
ref|WP_014498006.1|  MULTISPECIES: aminotransferase                   95.1    2e-19   
ref|WP_028147775.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium japonicum
ref|WP_035681626.1|  aminotransferase                                 95.1    2e-19   
ref|WP_035668747.1|  MULTISPECIES: aminotransferase                   95.1    2e-19   Bradyrhizobium japonicum
ref|WP_042133140.1|  aminotransferase                                 95.1    2e-19   Pseudomonas
ref|WP_034802113.1|  aminotransferase                                 95.1    2e-19   
ref|WP_028157521.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium japonicum
ref|WP_035716738.1|  aminotransferase                                 95.1    2e-19   
ref|WP_038945793.1|  aminotransferase                                 95.1    2e-19   
ref|WP_028144457.1|  aminotransferase                                 95.1    2e-19   Bradyrhizobium
ref|WP_011084499.1|  MULTISPECIES: aminotransferase                   95.1    2e-19   Bradyrhizobium
ref|WP_038376943.1|  aminotransferase                                 95.1    2e-19   
gb|KDP71648.1|  aminotransferase                                      95.1    2e-19   Ensifer adhaerens
ref|WP_035633702.1|  aminotransferase                                 95.1    2e-19   
emb|CCF21345.1|  Uncharacterized aminotransferase y4uB                94.7    2e-19   Rhizobium sp. NT-26
ref|WP_018898134.1|  hypothetical protein                             94.7    3e-19   Rhizobium sp. 2MFCol3.1
gb|ETF04525.1|  aminotransferase                                      94.7    3e-19   Advenella kashmirensis W13003
ref|WP_037990023.1|  aminotransferase                                 94.7    3e-19   
ref|WP_035541932.1|  aminotransferase                                 94.7    3e-19   Burkholderia sp. UYPR1.413
ref|WP_040060658.1|  aminotransferase                                 94.7    3e-19   
gb|KEO56896.1|  aminotransferase                                      94.7    3e-19   Thalassospira permensis NBRC 106175
ref|WP_022709596.1|  aminotransferase                                 94.7    3e-19   Pseudochrobactrum
gb|AJD51480.1|  aminotransferase                                      94.7    3e-19   Thalassospira xiamenensis M-5 = DSM 17429
ref|WP_017128138.1|  hypothetical protein                             94.4    3e-19   Pseudomonas gingeri
ref|WP_036350477.1|  aminotransferase                                 94.4    4e-19   Microvirga sp. BSC39
ref|WP_029014519.1|  aminotransferase                                 94.4    4e-19   Niveispirillum irakense
ref|WP_035022366.1|  MULTISPECIES: aminotransferase                   94.4    4e-19   Aquamicrobium defluvii
ref|WP_026226723.1|  aminotransferase                                 94.4    4e-19   Hoeflea sp. 108
ref|WP_012566210.1|  aminotransferase                                 94.0    5e-19   Rhodospirillum centenum
ref|WP_019171585.1|  aminotransferase                                 94.0    6e-19   Pseudaminobacter salicylatoxidans
ref|WP_026616781.1|  aminotransferase                                 94.0    6e-19   Ensifer aridi
ref|WP_025899271.1|  aminotransferase                                 94.0    6e-19   Sneathiella glossodoripedis
ref|WP_007067086.1|  aminotransferase                                 93.6    7e-19   Fulvimarina pelagi
ref|WP_007733279.1|  aminotransferase                                 93.6    7e-19   Burkholderia sp. BT03
ref|WP_009770733.1|  aminotransferase                                 93.6    7e-19   Paraburkholderia hospita
ref|WP_036032589.1|  aminotransferase                                 92.0    7e-19   Bradyrhizobium yuanmingense
ref|WP_037454523.1|  aminotransferase                                 93.6    8e-19   Skermanella stibiiresistens
ref|WP_040121086.1|  aminotransferase                                 93.6    8e-19   Sinorhizobium meliloti
ref|WP_012367259.1|  aminotransferase                                 93.2    1e-18   Burkholderia ambifaria
ref|WP_008597642.1|  aminotransferase                                 93.2    1e-18   Nitratireductor pacificus
ref|WP_035988183.1|  aminotransferase                                 93.2    1e-18   Paraburkholderia caribensis
ref|WP_021132241.1|  aminotransferase                                 93.2    1e-18   Phaeospirillum fulvum
ref|WP_012417867.1|  aminotransferase                                 93.2    1e-18   Bordetella avium
ref|WP_027263575.1|  aminotransferase                                 92.8    1e-18   Sedimentitalea nanhaiensis
ref|WP_023663383.1|  aminotransferase                                 92.8    1e-18   Pseudomonas
ref|WP_020950496.1|  aminotransferase                                 92.8    1e-18   Paracoccus aminophilus
ref|WP_021586359.1|  MULTISPECIES: aminotransferase                   92.8    1e-18   Ochrobactrum
ref|WP_031242205.1|  aminotransferase                                 92.8    1e-18   
ref|WP_009756518.1|  aminotransferase                                 92.8    1e-18   Nitratireductor indicus
ref|WP_023002240.1|  MULTISPECIES: aminotransferase                   92.8    1e-18   Labrenzia
ref|WP_040973849.1|  aminotransferase                                 92.8    1e-18   Mesorhizobium sp. ORS 3324
ref|WP_034858533.1|  aminotransferase                                 92.8    1e-18   Ensifer sojae
ref|WP_022733433.1|  aminotransferase                                 92.8    2e-18   
ref|WP_037131992.1|  aminotransferase                                 92.8    2e-18   
ref|WP_024849370.1|  aminotransferase                                 92.4    2e-18   
ref|WP_036500215.1|  aminotransferase                                 92.4    2e-18   
gb|EGD57468.1|  aminotransferase                                      92.8    2e-18   
ref|WP_025031754.1|  aminotransferase                                 92.4    2e-18   
emb|CCQ73232.1|  Aminotransferase                                     92.4    2e-18   
ref|WP_007681117.1|  aminotransferase                                 92.4    2e-18   
ref|WP_037395619.1|  aminotransferase                                 92.4    2e-18   
ref|WP_002726500.1|  aminotransferase                                 92.4    2e-18   
ref|WP_037434041.1|  aminotransferase                                 92.4    2e-18   
ref|WP_036349682.1|  aminotransferase                                 92.4    2e-18   
ref|WP_036995912.1|  aminotransferase                                 92.4    2e-18   
ref|WP_042778065.1|  aminotransferase                                 92.4    2e-18   
ref|WP_008526387.1|  aminotransferase                                 87.0    2e-18   
ref|WP_028003714.1|  aminotransferase                                 92.0    3e-18   
ref|WP_020949918.1|  adenosylmethionine-8-amino-7-oxononanoate am...  92.0    3e-18   
ref|WP_043209568.1|  aminotransferase                                 92.0    3e-18   
ref|WP_032964494.1|  aminotransferase                                 92.0    3e-18   
ref|WP_026987379.1|  aminotransferase                                 92.0    3e-18   
ref|WP_036577631.1|  aminotransferase                                 92.0    3e-18   
ref|WP_010658032.1|  aminotransferase                                 92.0    3e-18   
ref|WP_029579725.1|  aminotransferase                                 92.0    3e-18   
ref|WP_029925894.1|  MULTISPECIES: aminotransferase                   92.0    3e-18   
ref|WP_011982390.1|  aminotransferase                                 91.7    3e-18   
ref|WP_037458242.1|  aminotransferase                                 91.7    3e-18   
ref|WP_008840155.1|  aminotransferase                                 91.7    4e-18   
ref|WP_007758462.1|  aminotransferase                                 91.7    4e-18   
ref|WP_007008906.1|  aminotransferase                                 91.7    4e-18   
gb|AAF99609.1|AF247644_1  family II aminotransferase                  91.7    4e-18   
ref|WP_011810918.1|  aminotransferase                                 91.7    4e-18   
ref|WP_026621810.1|  aminotransferase                                 91.7    4e-18   
ref|WP_006465915.1|  aminotransferase                                 91.7    4e-18   
ref|WP_018010394.1|  aminotransferase                                 91.7    4e-18   
ref|WP_008190932.1|  aminotransferase                                 91.3    4e-18   
ref|WP_041006007.1|  aminotransferase                                 91.7    4e-18   
ref|WP_039191434.1|  aminotransferase                                 91.3    4e-18   
ref|WP_033967567.1|  aminotransferase                                 91.3    5e-18   
ref|WP_024514240.1|  aminotransferase                                 91.7    5e-18   
ref|WP_007995736.1|  aminotransferase                                 91.3    5e-18   
ref|WP_016494812.1|  putative aminotransferase                        91.3    5e-18   
ref|WP_019647031.1|  hypothetical protein                             91.3    5e-18   
ref|WP_025056008.1|  aminotransferase                                 91.3    5e-18   
ref|WP_011969374.1|  aminotransferase                                 91.3    5e-18   
ref|WP_029964768.1|  aminotransferase                                 91.3    5e-18   
ref|WP_036993733.1|  aminotransferase                                 90.9    6e-18   
ref|WP_041006181.1|  aminotransferase                                 91.3    6e-18   
ref|WP_005014723.1|  aminotransferase                                 90.9    6e-18   
ref|WP_029617577.1|  aminotransferase                                 90.9    6e-18   
ref|WP_036487003.1|  aminotransferase                                 90.9    6e-18   
ref|WP_040983804.1|  aminotransferase                                 90.9    6e-18   
ref|WP_040996134.1|  aminotransferase                                 90.9    6e-18   
ref|WP_014193010.1|  aminotransferase                                 90.9    6e-18   
ref|WP_037164468.1|  MULTISPECIES: aminotransferase                   90.9    6e-18   
dbj|BAO90602.1|  aminotransferase                                     90.9    6e-18   
ref|WP_023628464.1|  aminotransferase                                 90.9    6e-18   
ref|WP_038546843.1|  aminotransferase                                 90.9    7e-18   
ref|WP_037081315.1|  aminotransferase                                 90.9    7e-18   
ref|WP_038591093.1|  aminotransferase                                 90.9    7e-18   
ref|WP_027283997.1|  aminotransferase                                 90.9    7e-18   
ref|WP_044417924.1|  aminotransferase                                 90.9    8e-18   
ref|WP_037156550.1|  aminotransferase                                 90.5    8e-18   
ref|WP_034103255.1|  aminotransferase                                 90.5    8e-18   
ref|WP_010100080.1|  putative aminotransferase                        85.1    8e-18   
gb|ELS27909.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...  90.9    9e-18   
ref|WP_037017213.1|  aminotransferase                                 90.5    1e-17   
ref|WP_028601482.1|  aminotransferase                                 90.5    1e-17   
ref|WP_018904326.1|  aminotransferase                                 90.5    1e-17   
dbj|GAK69890.1|  putative aminotransferase                            90.5    1e-17   
gb|EWM49408.1|  aminotransferase class-III family protein             90.9    1e-17   
ref|WP_043683550.1|  aminotransferase                                 90.1    1e-17   
ref|WP_018701456.1|  hypothetical protein                             90.1    1e-17   
ref|WP_029350573.1|  aminotransferase                                 90.1    1e-17   
ref|WP_018430650.1|  hypothetical protein                             90.1    1e-17   
ref|WP_042727875.1|  aminotransferase                                 89.7    2e-17   
ref|WP_037063023.1|  aminotransferase                                 89.7    2e-17   
ref|WP_027151432.1|  aminotransferase                                 89.7    2e-17   
ref|WP_037123301.1|  aminotransferase                                 89.7    2e-17   
ref|WP_023797840.1|  aminotransferase                                 89.7    2e-17   
ref|WP_020296127.1|  aminotransferase                                 89.4    2e-17   
ref|WP_027165281.1|  aminotransferase                                 89.4    2e-17   
ref|WP_040511780.1|  aminotransferase                                 89.4    2e-17   
ref|WP_043683574.1|  aminotransferase                                 89.4    2e-17   
emb|CCV15251.1|  Uncharacterized aminotransferase y4uB                89.4    2e-17   
ref|WP_020810512.1|  aminotransferase                                 89.4    3e-17   
gb|EFG84567.1|  aminotransferase                                      89.4    3e-17   
ref|WP_028880172.1|  aminotransferase                                 89.4    3e-17   
gb|ESW84520.1|  aminotransferase                                      89.0    3e-17   
ref|WP_009870283.1|  COG0161: Adenosylmethionine-8-amino-7-oxonon...  89.4    3e-17   
ref|WP_006934289.1|  aminotransferase                                 89.0    3e-17   
ref|WP_036242028.1|  aminotransferase                                 89.0    3e-17   
ref|WP_040701702.1|  aminotransferase                                 89.0    3e-17   
ref|WP_003576511.1|  aminotransferase                                 89.0    3e-17   
ref|WP_025769698.1|  aminotransferase                                 89.4    3e-17   
ref|WP_031211906.1|  aminotransferase                                 89.0    3e-17   
gb|EDQ03816.1|  aminotransferase                                      89.0    3e-17   
ref|WP_028002805.1|  aminotransferase                                 89.0    3e-17   
ref|WP_003525818.1|  aminotransferase                                 89.0    4e-17   
ref|WP_016733076.1|  aminotransferase                                 89.0    4e-17   
ref|WP_043948562.1|  aminotransferase                                 89.0    4e-17   
gb|ENS36263.1|  hypothetical protein C087_00163                       87.4    4e-17   
ref|WP_015343311.1|  aminotransferase class-III                       89.0    4e-17   
ref|XP_003389628.1|  PREDICTED: gamma aminobutyrate transaminase ...  89.0    4e-17   
ref|WP_026756592.1|  aminotransferase                                 88.6    4e-17   
ref|WP_015008570.1|  aminotransferase                                 88.6    4e-17   
ref|WP_019013610.1|  hypothetical protein                             88.6    4e-17   
ref|WP_038688957.1|  aminotransferase                                 88.6    4e-17   
ref|WP_006315267.1|  aminotransferase                                 88.6    5e-17   
ref|XP_005966148.1|  PREDICTED: gamma aminobutyrate transaminase ...  88.6    5e-17   
ref|WP_010972924.1|  MULTISPECIES: aminotransferase                   88.6    5e-17   
ref|WP_028053780.1|  aminotransferase                                 88.6    5e-17   
ref|WP_017273373.1|  aminotransferase                                 88.6    5e-17   
ref|WP_038972945.1|  aminotransferase                                 88.6    5e-17   
ref|WP_011425411.1|  aminotransferase                                 88.6    5e-17   
gb|KJF69288.1|  aminotransferase                                      88.6    5e-17   
ref|WP_027991581.1|  aminotransferase                                 88.6    5e-17   
ref|WP_017266638.1|  aminotransferase                                 88.6    5e-17   
ref|WP_010975253.1|  aminotransferase                                 88.6    5e-17   
emb|CDX30075.1|  Gamma aminobutyrate transaminase 1, mitochondrial    88.6    5e-17   
ref|WP_013850008.1|  aminotransferase                                 88.6    5e-17   
ref|WP_042639479.1|  aminotransferase                                 88.6    5e-17   
ref|WP_017277372.1|  aminotransferase                                 88.6    5e-17   
ref|WP_028030241.1|  aminotransferase                                 88.2    5e-17   
ref|WP_027616365.1|  aminotransferase                                 88.2    5e-17   
gb|KJF70622.1|  aminotransferase                                      88.2    5e-17   
ref|WP_037138943.1|  aminotransferase                                 88.2    5e-17   
ref|WP_036367910.1|  aminotransferase                                 88.2    6e-17   
ref|WP_037114065.1|  aminotransferase                                 88.2    6e-17   
ref|WP_007798845.1|  aminotransferase                                 88.2    6e-17   
ref|WP_012483828.1|  aminotransferase                                 88.2    6e-17   
ref|WP_013761561.1|  MULTISPECIES: aminotransferase                   88.2    6e-17   
ref|WP_035199442.1|  aminotransferase                                 88.2    6e-17   
ref|WP_038494050.1|  aminotransferase                                 88.2    6e-17   
ref|WP_003510848.1|  aminotransferase                                 88.2    6e-17   
ref|WP_019564661.1|  aminotransferase                                 88.2    6e-17   
ref|WP_025038425.1|  aminotransferase                                 88.2    6e-17   
ref|WP_020049965.1|  aminotransferase                                 88.2    7e-17   
ref|WP_017802338.1|  aminotransferase                                 87.8    7e-17   
gb|EHH09382.1|  aminotransferase                                      87.8    8e-17   
ref|WP_022729947.1|  aminotransferase                                 87.8    8e-17   
ref|WP_015243391.1|  Adenosylmethionine-8-amino-7-oxononanoate am...  87.8    8e-17   
ref|WP_037014756.1|  aminotransferase                                 87.8    8e-17   
ref|WP_027136175.1|  aminotransferase                                 87.8    8e-17   
ref|WP_008619221.1|  aminotransferase                                 87.8    8e-17   
ref|WP_040583492.1|  aminotransferase                                 87.8    9e-17   
ref|WP_028754908.1|  aminotransferase                                 87.8    9e-17   
ref|WP_038405296.1|  aminotransferase                                 87.8    9e-17   
ref|WP_010511363.1|  aminotransferase                                 87.8    9e-17   
ref|WP_017750300.1|  aminotransferase                                 87.8    9e-17   
ref|WP_012783843.1|  aminotransferase                                 87.8    9e-17   
ref|WP_006212579.1|  hypothetical protein                             87.8    1e-16   
ref|WP_004689415.1|  aminotransferase                                 87.4    1e-16   
gb|EXU84827.1|  aminotransferase                                      87.4    1e-16   
ref|WP_002967099.1|  MULTISPECIES: aminotransferase                   87.4    1e-16   
ref|WP_004687895.1|  aminotransferase                                 87.4    1e-16   
ref|WP_044287138.1|  aminotransferase                                 87.4    1e-16   
ref|WP_008933706.1|  aminotransferase                                 87.4    1e-16   
ref|WP_002965440.1|  aminotransferase                                 87.4    1e-16   
ref|WP_006120346.1|  hypothetical protein                             87.4    1e-16   
ref|WP_006195177.1|  hypothetical protein                             87.4    1e-16   
ref|WP_022563671.1|  Aminotransferase                                 87.4    1e-16   
ref|WP_037091143.1|  aminotransferase                                 87.4    1e-16   
ref|WP_006698559.1|  MULTISPECIES: aminotransferase                   87.4    1e-16   
ref|WP_044459848.1|  aminotransferase                                 87.4    1e-16   
ref|WP_035208105.1|  aminotransferase                                 87.4    1e-16   
ref|WP_007924918.1|  aminotransferase                                 87.4    1e-16   
ref|WP_028286734.1|  aminotransferase                                 87.4    1e-16   
ref|WP_026398823.1|  aminotransferase                                 87.4    1e-16   
ref|WP_029043410.1|  aminotransferase                                 87.4    1e-16   
ref|WP_003524048.1|  aminotransferase                                 87.0    1e-16   
ref|WP_028958672.1|  aminotransferase                                 87.0    1e-16   
ref|WP_026363963.1|  MULTISPECIES: aminotransferase                   87.0    1e-16   
ref|WP_003506383.1|  aminotransferase                                 87.0    1e-16   
ref|WP_035220886.1|  aminotransferase                                 87.0    2e-16   
gb|KJF72733.1|  aminotransferase                                      87.0    2e-16   
ref|WP_003500709.1|  aminotransferase                                 87.0    2e-16   
ref|WP_029062246.1|  aminotransferase                                 87.0    2e-16   
ref|WP_007439629.1|  aminotransferase                                 87.0    2e-16   
ref|WP_027300272.1|  aminotransferase                                 87.0    2e-16   
ref|WP_008935239.1|  MULTISPECIES: aminotransferase                   87.0    2e-16   
ref|WP_036521510.1|  aminotransferase                                 86.7    2e-16   
ref|WP_043621741.1|  aminotransferase                                 86.7    2e-16   
ref|WP_034843846.1|  aminotransferase                                 86.7    2e-16   
ref|WP_033534791.1|  aminotransferase                                 86.7    2e-16   
ref|WP_019013437.1|  hypothetical protein                             86.7    2e-16   
ref|WP_008944855.1|  aminotransferase                                 86.7    2e-16   
ref|WP_006191222.1|  MULTISPECIES: aminotransferase                   86.3    2e-16   
ref|WP_024589111.1|  aminotransferase                                 86.7    3e-16   
ref|WP_009469786.1|  aminotransferase                                 86.3    3e-16   
ref|WP_035705889.1|  aminotransferase                                 86.3    3e-16   
ref|WP_020809000.1|  aminotransferase                                 86.3    3e-16   
gb|EAP77299.1|  hypothetical protein ISM_03380                        86.3    3e-16   
ref|WP_014239351.1|  aminotransferase                                 86.3    3e-16   
ref|WP_024078559.1|  putative aminotransferase                        86.3    3e-16   
ref|WP_011384093.1|  aminotransferase                                 86.3    3e-16   
ref|WP_040998245.1|  aminotransferase                                 86.3    3e-16   
emb|CDX33772.1|  Gamma aminobutyrate transaminase 1, mitochondrial    86.3    3e-16   
ref|WP_017275479.1|  omega amino acid--pyruvate aminotransferase      85.9    3e-16   
ref|WP_035675507.1|  aminotransferase                                 85.9    4e-16   
emb|CAM76190.1|  Aminotransferase class-III                           85.9    4e-16   
ref|WP_038526098.1|  aminotransferase                                 85.9    4e-16   
ref|WP_007998730.1|  aminotransferase                                 85.9    4e-16   
ref|WP_040618275.1|  aminotransferase                                 85.9    4e-16   
gb|EEE56165.1|  hypothetical protein OsJ_05081                        85.9    4e-16   
ref|WP_010485545.1|  aminotransferase                                 85.9    4e-16   
ref|WP_035741142.1|  aminotransferase                                 85.5    5e-16   
gb|KJF72155.1|  aminotransferase                                      85.5    5e-16   
ref|WP_029358614.1|  aminotransferase                                 83.6    5e-16   
ref|WP_043754256.1|  aminotransferase                                 85.5    5e-16   
ref|WP_029202940.1|  aminotransferase                                 85.5    5e-16   
ref|WP_023690393.1|  aminotransferase                                 85.5    5e-16   
ref|WP_041794682.1|  aminotransferase                                 85.5    5e-16   
gb|EBA15654.1|  aminotransferase, class III family protein            85.5    5e-16   
ref|WP_037255381.1|  aminotransferase                                 85.5    5e-16   
ref|WP_038313987.1|  aminotransferase                                 85.1    7e-16   
emb|CCG07898.1|  Aminotransferase                                     85.5    7e-16   
ref|WP_037377324.1|  aminotransferase                                 85.1    8e-16   
ref|WP_013166382.1|  aminotransferase                                 85.1    8e-16   
ref|WP_007257253.1|  aminotransferase                                 84.7    9e-16   
ref|WP_028137934.1|  aminotransferase                                 84.7    1e-15   
ref|WP_037210883.1|  aminotransferase                                 84.7    1e-15   



>ref|XP_009804950.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana sylvestris]
Length=516

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGS-HVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  276
            +AMI+RLL  T+K A    GS H KH+PAVS     I+R  +  R++S Q S+QND  ST
Sbjct  1    MAMISRLLRSTVKAAITAQGSFHAKHIPAVSSLQEHIVRNSTQARYNSTQASLQNDIPST  60

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D +GFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAF
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAF  168



>ref|XP_009592076.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=516

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  276
            +AMI+RLL  T+K A T Q G H KH+PAVS     I+R  +  R++S + S+QND  +T
Sbjct  1    MAMISRLLRSTIKAAITAQGGFHTKHIPAVSSLQEHIVRNSTQARYNSTEASLQNDIPAT  60

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D +GF+GHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFRGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FT  KMAKAF
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTTNKMAKAF  168



>ref|XP_010313637.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=516

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTA KMAKAF
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAF  167



>ref|XP_009789181.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Nicotiana sylvestris]
Length=516

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G  +  ATNQVGS VKH+P VS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSRVKHIPVVSNLQKQIVCDPKQIRWSSTETSLKNDISSAD  60

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  61   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  120

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTA KMAKAF
Sbjct  121  RLVAAATKQLNQLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKAF  167



>ref|XP_006351982.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Solanum tuberosum]
Length=516

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G+ +  ATNQVG H+KH+ AVS     I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITNLIGYGIVAATNQVGPHIKHISAVSNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGW TTDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGG+EP
Sbjct  61   VRGYKGHDMLAPFTAGWHTTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGSEP  120

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTA KMAKAF
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAF  167



>ref|NP_001233777.1| gamma aminobutyrate transaminase 3, chloroplastic [Solanum lycopersicum]
 sp|Q84P52.1|GATP3_SOLLC RecName: Full=Gamma aminobutyrate transaminase 3, chloroplastic; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 3; 
Short=LeGABA-TP3; Short=SlGABA-T3; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92257.1| gamma-aminobutyrate transaminase subunit precursor isozyme 3 
[Solanum lycopersicum]
 dbj|BAG16484.1| gamma aminobutyrate transaminase isoform3 [Solanum lycopersicum]
Length=520

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN L FYHSFWNR+TKPSLDLAKELLD FTA KMAKAF
Sbjct  121  RLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAF  167



>ref|XP_006357874.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Solanum tuberosum]
Length=515

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 138/168 (82%), Gaps = 4/168 (2%)
 Frame = +1

Query  106  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  276
            +A I+RL+G T+K A T Q G H K +PAVS     I++   P R+SS Q  ++ND   T
Sbjct  1    MAKISRLIGSTVKAAITAQAGFHAKRIPAVSSLQEHIVKST-PARYSSTQACLENDISGT  59

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D KGFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KYLD+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYLDTLAGLWCTALGGNE  119

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAF
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAF  167



>ref|NP_001234336.1| gamma aminobutyrate transaminase 1, mitochondrial [Solanum lycopersicum]
 sp|Q84P54.1|GATP1_SOLLC RecName: Full=Gamma aminobutyrate transaminase 1, mitochondrial; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 1; 
Short=LeGABA-TP1; Short=SlGABA-T1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92255.1| gamma-aminobutyrate transaminase subunit precursor isozyme 1 
[Solanum lycopersicum]
 dbj|BAG16482.1| gamma aminobutyrate transaminase isoform1 [Solanum lycopersicum]
Length=515

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 4/168 (2%)
 Frame = +1

Query  106  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  276
            +A I+RL G T+K A T Q G H K +PAVS     I++   P R++S Q  ++ND   T
Sbjct  1    MAKISRLFGSTVKAAITAQAGFHGKRIPAVSSLQEHIVKST-PARYNSTQACLENDISGT  59

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D KGFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KY+D+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYIDTLAGLWCTALGGNE  119

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAF
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAF  167



>gb|AGX01485.1| mitochondrial gamma aminobutyrate transaminase 1 [Nicotiana tabacum]
Length=512

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G  +  ATNQVGSH+    A+S     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AISNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAF
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAF  164



>ref|XP_009610291.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=513

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  279
            +A I  L+G  +  ATNQVGSH+    AVS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+ KMAKAF
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAF  164



>ref|XP_009610292.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=510

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = +1

Query  127  LGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKGFKGH  300
            L +  +   NQVGSH+    AVS     I+      RWSS + S++ND  S D +G+KGH
Sbjct  5    LDNVAQLTVNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSADIRGYKGH  61

Query  301  DMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAM  480
            DMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA 
Sbjct  62   DMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAAT  121

Query  481  KQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+ KMAKAF
Sbjct  122  KQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAF  161



>gb|EYU42835.1| hypothetical protein MIMGU_mgv1a004733mg [Erythranthe guttata]
Length=512

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 132/164 (80%), Gaps = 3/164 (2%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKG  288
            ++RLL  TL+ A+ Q G  VK + A      ++I+     +  S +  +Q D  +TD+KG
Sbjct  1    MHRLLRLTLRNAS-QAGYCVKEISAGKNLPINVIQPPLLAKSYSTEAYLQKDPPTTDDKG  59

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGG+EPRLV
Sbjct  60   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYLDSLAGLWCTALGGSEPRLV  119

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            DAA+KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  120  DAAIKQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTATKMAKVF  163



>ref|XP_011100393.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Sesamum indicum]
Length=512

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEK  285
            M++RLL  TL+ A+ Q G +VK + A       +++     +    + S+Q D  STD+K
Sbjct  1    MMHRLLQLTLRNAS-QAGHYVKDISAGKNLQKHLVQASVRAKSYGTEASLQKDVSSTDDK  59

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G+KGHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRL
Sbjct  60   GYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRL  119

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTA KMAK F
Sbjct  120  VAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVF  164



>gb|KDP30431.1| hypothetical protein JCGZ_16670 [Jatropha curcas]
Length=517

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 8/168 (5%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND-----ST  276
            +IN++L  TLK   NQ+GSH KH+ A   S   +       +    + S+Q D     S 
Sbjct  2    VINKILRSTLK---NQLGSHSKHVAASGSSQKHLASAPCLAKLYGTEASLQKDDSTTDSR  58

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D +G+KGHDMLAPFTAGWQ+TDLHPLVI+KSEGSYVYDINGKKYLDSLAGLWCTALGG+E
Sbjct  59   DGRGYKGHDMLAPFTAGWQSTDLHPLVIDKSEGSYVYDINGKKYLDSLAGLWCTALGGSE  118

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL+TFT+ KMAKAF
Sbjct  119  PRLVAAATEQLHKLPFYHSFWNRTTKPSLDLAKELLETFTSSKMAKAF  166



>ref|XP_010941664.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Elaeis guineensis]
Length=508

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 129/162 (80%), Gaps = 3/162 (2%)
 Frame = +1

Query  124  LLGHTLKR--ATNQVGSHVKHLP-AVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  294
            ++G +L R  A+++VG  ++H+  A      +     S  R  S++ S+Q D TDE+GFK
Sbjct  1    MIGKSLLRSKASSKVGMLIRHIATAEGLQSHAPPYIASVARLMSSEASLQTDPTDERGFK  60

Query  295  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  474
            GHDMLAPFTAGWQ+TDLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGG+EPRLV+A
Sbjct  61   GHDMLAPFTAGWQSTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVEA  120

Query  475  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            A  QL  LPFYHSFWNRTTKPSLDLAKELL+TFTA KM K F
Sbjct  121  ATAQLKKLPFYHSFWNRTTKPSLDLAKELLETFTARKMGKVF  162



>gb|AGF95098.1| 4-aminobutyrate aminotransferase [Prunus persica]
Length=220

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  285
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  286  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  462
             GFKGH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  463  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAF  165



>ref|XP_008652021.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Zea mays]
 gb|KJB42908.1| hypothetical protein B456_007G173800 [Gossypium raimondii]
Length=515

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 127/164 (77%), Gaps = 6/164 (4%)
 Frame = +1

Query  118  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  288
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLV  120

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA  QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK F
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVF  164



>ref|XP_006429770.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
 ref|XP_006481368.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Citrus sinensis]
 gb|ESR43010.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
Length=514

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = +1

Query  103  AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDE  282
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S+Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASLQKEDSTT  60

Query  283  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  462
             GFKGHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYDINGKKYLDSL+GLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDINGKKYLDSLSGLWCTALGGSEPR  120

Query  463  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVF  166



>gb|KDO64363.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=514

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = +1

Query  103  AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDE  282
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASSQKEDSTT  60

Query  283  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  462
             GFKGHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPR  120

Query  463  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVF  166



>ref|XP_010036076.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW47596.1| hypothetical protein EUGRSUZ_K01341 [Eucalyptus grandis]
Length=509

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  241  SSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSL  420
            +S Q     +S D  GFKGHDMLAPFTAGWQTTDLHPLVIE+SEGSYVYDINGKKYLDSL
Sbjct  41   ASLQKEESTESKDGLGFKGHDMLAPFTAGWQTTDLHPLVIERSEGSYVYDINGKKYLDSL  100

Query  421  AGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AGLWCTALGGNEPRLV+AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  101  AGLWCTALGGNEPRLVNAAVAQLNTLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAF  160



>ref|XP_009399251.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=505

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            +R  S+   +Q++ST+E+GFKGHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYL
Sbjct  33   SRLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYL  92

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLWCTALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM 
Sbjct  93   DALAGLWCTALGGNEPRLIAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMG  152

Query  592  KAF  600
            K F
Sbjct  153  KVF  155



>ref|XP_008229658.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Prunus mume]
Length=514

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  285
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYIAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  286  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  462
             GFKGHDMLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHDMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  463  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAF  165



>gb|KHG00607.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Gossypium 
arboreum]
Length=392

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 126/164 (77%), Gaps = 6/164 (4%)
 Frame = +1

Query  118  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  288
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD +GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTHGKKYLDSLAGLWCTALGGSEPRLV  120

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA  QLN LPFYHSFWNRTTK SLDLAK+LL+TFTA KMAK F
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKLSLDLAKDLLETFTATKMAKVF  164



>gb|ABF69998.1| gamma-aminobutyrate transaminase, putative [Musa acuminata]
Length=534

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  414
            R  S+   +Q++ST+E+GFKGHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYLD
Sbjct  23   RLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYLD  82

Query  415  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAK  594
            +LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM K
Sbjct  83   ALAGLWCTALGGNEPRLVAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMGK  142

Query  595  AF  600
             F
Sbjct  143  VF  144



>ref|XP_008798241.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial, 
partial [Phoenix dactylifera]
Length=506

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  145  RATNQVGSHVKHLPAVsgshgsiirrrsP-TRWSSAQVSVQNDSTDEKGFKGHDMLAPFT  321
            +A+++VG  ++H+              +   R   +Q S+  D TDEKGFKGHDMLAPFT
Sbjct  10   KASSKVGMLIRHVATAERFQSHGPPYIASFARLMCSQASLLTDPTDEKGFKGHDMLAPFT  69

Query  322  AGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLP  501
            AGWQ+TDLHPLVIEKSEGSYVYD NGKKYLD+LAGLWCTALGG+EPRLV+AA  QL  LP
Sbjct  70   AGWQSTDLHPLVIEKSEGSYVYDNNGKKYLDTLAGLWCTALGGSEPRLVEAATAQLKKLP  129

Query  502  FYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            FYHSFWNRTTKPSLDLAKELL+TFTA KM K F
Sbjct  130  FYHSFWNRTTKPSLDLAKELLETFTARKMGKVF  162



>ref|XP_007215238.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
 gb|EMJ16437.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
Length=514

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  285
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  286  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  462
             GFKGH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  463  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAF  165



>ref|XP_011100394.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Sesamum indicum]
Length=501

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 2/119 (2%)
 Frame = +1

Query  250  QVSVQND--STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLA  423
            + S+Q D  STD+KG+KGHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LA
Sbjct  35   EASLQKDVSSTDDKGYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALA  94

Query  424  GLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            GLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTA KMAK F
Sbjct  95   GLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVF  153



>ref|XP_007049029.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
 gb|EOX93186.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
Length=525

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 122/164 (74%), Gaps = 6/164 (4%)
 Frame = +1

Query  118  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  288
            N  L  TLK    Q+GS++K+  A         +     R  S + S+Q + +D K   G
Sbjct  14   NSFLRSTLKL---QLGSYIKNAAAYRSFMDQSPKGPVLARLYSTEPSLQKEDSDLKDGNG  70

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD+NG+KYLD+LAGLWCTALGGNE RLV
Sbjct  71   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDVNGRKYLDTLAGLWCTALGGNEARLV  130

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             AA  QLN LPFYHSFWNRTTKPSLDLAKELL TFTA KMAK F
Sbjct  131  AAATDQLNKLPFYHSFWNRTTKPSLDLAKELLGTFTARKMAKVF  174



>ref|XP_006858237.1| hypothetical protein AMTR_s00062p00194620 [Amborella trichopoda]
 gb|ERN19704.1| hypothetical protein AMTR_s00062p00194620 [Amborella trichopoda]
Length=510

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = +1

Query  145  RATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKGFKGHDMLAPF  318
            R+  Q+G  +KH+ A            +   +SS + S+Q+D   +++KGFKGHDMLAPF
Sbjct  10   RSNLQLGKFIKHVAAARNLKVPPHHCPTFASYSS-EASLQSDVPESNDKGFKGHDMLAPF  68

Query  319  TAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTL  498
            TAGWQ+TDLHPLVI++SEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +QLN L
Sbjct  69   TAGWQSTDLHPLVIDRSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATRQLNKL  128

Query  499  PFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PFYHSFWNRTTKPSLDLA ELL+ FTA KM K F
Sbjct  129  PFYHSFWNRTTKPSLDLATELLEMFTARKMGKVF  162



>ref|XP_002307913.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
 gb|EEE91436.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
Length=514

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQ-NDST-DEK  285
            +I++LL  TLK   +Q+ S +K+  A   S    +R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCIKNGTASGSSQEHHLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
             FKGHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRL  118

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAF  163



>ref|XP_009347869.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Pyrus x bretschneideri]
Length=514

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 3/124 (2%)
 Frame = +1

Query  238  WSSAQVSVQNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            +S+     + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEGSYVYD NGKKY
Sbjct  42   YSTGSPLRREESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGSYVYDSNGKKY  101

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            LD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM
Sbjct  102  LDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKM  161

Query  589  AKAF  600
            AKAF
Sbjct  162  AKAF  165



>ref|XP_009349580.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=521

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 4/126 (3%)
 Frame = +1

Query  235  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  402
            R  S   SVQ +  +TDEKG  FKGHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  106

Query  403  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAX  582
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  583  KMAKAF  600
            KMAKAF
Sbjct  167  KMAKAF  172



>sp|B8BBZ7.1|GATP3_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|EEC83087.1| hypothetical protein OsI_28220 [Oryza sativa Indica Group]
Length=510

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  291
            MI R L      A ++  S VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASSIVKHVAATGCLPEYSSEA--PARYFSSESSLQVDSTEENGF  58

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K F
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIF  161



>ref|XP_009349581.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=514

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 4/126 (3%)
 Frame = +1

Query  235  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  402
            R  S   SVQ +  +TDEKG  FKGHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  99

Query  403  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAX  582
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  583  KMAKAF  600
            KMAKAF
Sbjct  160  KMAKAF  165



>ref|XP_002322549.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
 gb|EEF04310.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
Length=514

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 128/165 (78%), Gaps = 5/165 (3%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKG-  288
            +I++LL  TLK    Q+GS +K+  A   S   ++R     R    + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLGSCIKNGTASGSSQEHLLRGPFLARLYGTEASLQKEDSTTEGN  58

Query  289  -FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
             FKGHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAF  163



>ref|XP_002445207.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
 gb|EES14702.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
Length=509

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = +1

Query  124  LLGHTLKR---ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  294
            ++   L+R   A++QV   VK++ +     G      SP R  S++ S+Q  +T+E GFK
Sbjct  1    MIAQGLRRSSAASSQVSRLVKYIASAGRLQGGHSFSESPARCYSSEPSLQ--ATEENGFK  58

Query  295  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  474
            GH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRLV A
Sbjct  59   GHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLVKA  118

Query  475  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            A +QL+ LPFYHSFWNRTTKPSLDLA E+L  FTA +M K F
Sbjct  119  ATEQLHKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVF  160



>gb|AFS28620.1| gamma-aminobutyrate transaminase 1 [Malus domestica]
Length=514

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 3/124 (2%)
 Frame = +1

Query  238  WSSAQVSVQNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            +S+     + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKY
Sbjct  42   YSTGSPLRREESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKY  101

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            LD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM
Sbjct  102  LDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKM  161

Query  589  AKAF  600
            AKAF
Sbjct  162  AKAF  165



>gb|EPS57260.1| hypothetical protein M569_17559, partial [Genlisea aurea]
Length=117

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGHDMLAPFTAGWQT+DL+PLVIE+SEGSYVYD++GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  1    FKGHDMLAPFTAGWQTSDLNPLVIERSEGSYVYDVHGKKYLDSLAGLWCTALGGSEPRLV  60

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            DAA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTA KMAK F
Sbjct  61   DAATKQLNKLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKVF  104



>ref|XP_008365554.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Malus domestica]
Length=514

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 3/124 (2%)
 Frame = +1

Query  238  WSSAQVSVQNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            +S+     + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKY
Sbjct  42   YSTGSPLRREESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKY  101

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            LD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM
Sbjct  102  LDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKM  161

Query  589  AKAF  600
            AKAF
Sbjct  162  AKAF  165



>ref|NP_001061237.1| Os08g0205900 [Oryza sativa Japonica Group]
 sp|Q6ZCF0.1|GATP3_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05337.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAD11549.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAF23151.1| Os08g0205900 [Oryza sativa Japonica Group]
 gb|EEE68226.1| hypothetical protein OsJ_26408 [Oryza sativa Japonica Group]
Length=510

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  291
            MI R L      A ++  + VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASNIVKHVAATGCLPKYSSEA--PARYFSSEPSLQVDSTEENGF  58

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K F
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIF  161



>ref|XP_011001061.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Populus euphratica]
Length=514

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 128/165 (78%), Gaps = 5/165 (3%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKG-  288
            +I++LL  TLK    Q+ S +K+  A   S   ++R     R+   + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLSSCIKNGTASGSSQEHLLRAPFLARFYGTKASLQKEDSTTEGN  58

Query  289  -FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
             FKGHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAF  163



>ref|XP_010260596.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Nelumbo nucifera]
Length=517

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 107/127 (84%), Gaps = 5/127 (4%)
 Frame = +1

Query  235  RWSSAQVSVQNDST-----DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDING  399
            RW+S + S+Q +       D KGFKGHDMLAPFTAGWQ+ DLHPLVIEKSEG YVYDING
Sbjct  40   RWNSTEASLQKEGQTPELKDGKGFKGHDMLAPFTAGWQSNDLHPLVIEKSEGCYVYDING  99

Query  400  KKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTA  579
             K+LDSLAGLWCTALGGNEPRLV AA KQL+TLPFYHSFWNRTTKPSLDLAK++L+ FTA
Sbjct  100  NKFLDSLAGLWCTALGGNEPRLVAAATKQLDTLPFYHSFWNRTTKPSLDLAKDILEIFTA  159

Query  580  XKMAKAF  600
             KM K F
Sbjct  160  RKMGKVF  166



>ref|XP_006659928.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Oryza brachyantha]
Length=537

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY
Sbjct  65   PARYFSSEPSLQVDSTEENGFKGHGMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKY  124

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            +D+LAGLW TALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M
Sbjct  125  IDALAGLWSTALGGNEPRLIKAATDQLNKLPFYHSFWNRTTKPSLDLANEILMMFTAREM  184

Query  589  AKAF  600
             K F
Sbjct  185  GKVF  188



>emb|CDP16027.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +1

Query  235  RWSSAQVSVQND--STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            RW+S + + Q D  + D+KGFKGH+MLAPFTAGWQ+TDL+PLVIE+SEGSYVYD+NGKKY
Sbjct  51   RWNSTEAAAQKDVSAIDDKGFKGHEMLAPFTAGWQSTDLNPLVIERSEGSYVYDVNGKKY  110

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            LD+LAGLW TALGGNEPRL+ AA KQLNTLPFYHSFWNRTTKPSLDLAKEL++ FT   M
Sbjct  111  LDALAGLWSTALGGNEPRLIAAAAKQLNTLPFYHSFWNRTTKPSLDLAKELIELFTPSTM  170

Query  589  AKAF  600
            +KAF
Sbjct  171  SKAF  174



>ref|XP_004972609.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Setaria italica]
Length=509

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 122/163 (75%), Gaps = 3/163 (2%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  291
            MI R L  +   A +Q    VK++ +     G+      P R+ S++ S++   T+E GF
Sbjct  1    MIARGLFRS-NAAASQFSRLVKYVASAGSLQGTHNFAEIPARYYSSEPSLKE--TEENGF  57

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRL+ 
Sbjct  58   KGHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLIK  117

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA +QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K F
Sbjct  118  AATEQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVF  160



>ref|XP_008378345.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Malus domestica]
Length=521

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  235  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  402
            R  S   SVQ +  +T EKG  FKGHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  106

Query  403  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAX  582
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  583  KMAKAF  600
            KMAKAF
Sbjct  167  KMAKAF  172



>ref|XP_004303943.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Fragaria vesca subsp. vesca]
Length=506

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 7/162 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  294
            INRL+   L   T Q+GS +K++ A   S   +    S  R      ++Q+    E GFK
Sbjct  3    INRLVRSNL---TTQLGSCIKYVAASRSSQERLFSAPSIARVYGTSATLQS----EDGFK  55

Query  295  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  474
            GHDMLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+A
Sbjct  56   GHDMLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEA  115

Query  475  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            A +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAF
Sbjct  116  ATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAF  157



>ref|NP_001280788.1| gamma aminobutyrate transaminase 3, chloroplastic [Malus domestica]
 gb|AFS28621.1| gamma-aminobutyrate transaminase 2 [Malus domestica]
Length=514

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  235  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  402
            R  S   SVQ +  +T EKG  FKGHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  99

Query  403  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAX  582
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  583  KMAKAF  600
            KMAKAF
Sbjct  160  KMAKAF  165



>ref|XP_003573535.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X2 [Brachypodium distachyon]
Length=515

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  43   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  102

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  103  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  162

Query  589  AKAF  600
             K F
Sbjct  163  GKVF  166



>ref|XP_010234450.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X1 [Brachypodium distachyon]
Length=519

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  229  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  47   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  106

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  107  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  166

Query  589  AKAF  600
             K F
Sbjct  167  GKVF  170



>ref|XP_002268803.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Vitis vinifera]
Length=516

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 125/168 (74%), Gaps = 6/168 (4%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTD----  279
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  280  -EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
              K FKGHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAF
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAF  167



>gb|AFW59441.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=447

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  592  KAF  600
            K F
Sbjct  161  KVF  163



>ref|XP_010093137.1| putative aminotransferase y4uB [Morus notabilis]
 gb|EXB53589.1| putative aminotransferase y4uB [Morus notabilis]
Length=466

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  160  VGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTT  339
            +GS+ K++ A       I +  S  R  S            +GFKGHDMLAPFTAGWQ+T
Sbjct  23   LGSYAKYVYASRIPQDQIPQVSSLARHYSTATEAAASDPKSRGFKGHDMLAPFTAGWQST  82

Query  340  DLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFW  519
            DLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA  QLNTLPFYHSFW
Sbjct  83   DLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAATAQLNTLPFYHSFW  142

Query  520  NRTTKPSLDLAKELLDTFTAXKMAKAF  600
            NRTTKPSLDLAK+L++ FTA KM K F
Sbjct  143  NRTTKPSLDLAKDLIEMFTARKMGKVF  169



>emb|CBI34106.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 125/168 (74%), Gaps = 6/168 (4%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTD----  279
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  280  -EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
              K FKGHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAF
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAF  167



>ref|XP_011004456.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Populus euphratica]
Length=514

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 129/165 (78%), Gaps = 5/165 (3%)
 Frame = +1

Query  112  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQ-NDST-DEK  285
            +I++LL  TLK   +Q+ S  K+  A   S   ++R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCTKNGTASGSSQEHLLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
             FKGHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEP L
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPWL  118

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAF  163



>ref|XP_002521054.1| aminobutyrate aminotransferase, putative [Ricinus communis]
 gb|EEF41338.1| aminobutyrate aminotransferase, putative [Ricinus communis]
Length=528

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 121/168 (72%), Gaps = 16/168 (10%)
 Frame = +1

Query  145  RATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQN----------------DST  276
            R   ++GS VKH  A   S   + +  S TR  S++  VQ                 D+ 
Sbjct  10   RIGFELGSCVKHANASGTSQKHLFQTASLTRLYSSEGFVQRESDNGGSSILRPATVADNF  69

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            D   +KGHDMLAPFTAGWQ+TDL PLVIEKSEGSYVYDING KYLDSLAGLWCTALGGNE
Sbjct  70   DNCSYKGHDMLAPFTAGWQSTDLDPLVIEKSEGSYVYDINGNKYLDSLAGLWCTALGGNE  129

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  130  PRLVAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAF  177



>ref|NP_001152508.1| aminotransferase y4uB [Zea mays]
 gb|ACG47973.1| aminotransferase y4uB [Zea mays]
Length=514

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  592  KAF  600
            K F
Sbjct  161  KVF  163



>gb|ACF87978.1| unknown [Zea mays]
 gb|AFW59440.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=514

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  592  KAF  600
            K F
Sbjct  161  KVF  163



>ref|NP_001053863.1| Os04g0614600 [Oryza sativa Japonica Group]
 sp|Q7XN11.2|GATP1_ORYSJ RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAQ14479.1|AF297651_1 putative aminotransferase [Oryza sativa]
 emb|CAE04333.2| OSJNBa0008M17.4 [Oryza sativa Japonica Group]
 dbj|BAF15777.1| Os04g0614600 [Oryza sativa Japonica Group]
 dbj|BAG95492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61676.1| hypothetical protein OsJ_16145 [Oryza sativa Japonica Group]
Length=516

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            TR  S+  S Q +ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQYNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  592  KAF  600
            K F
Sbjct  164  KVF  166



>gb|EEC77995.1| hypothetical protein OsI_17385 [Oryza sativa Indica Group]
Length=496

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            TR  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  47   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  106

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  107  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  166

Query  592  KAF  600
            K F
Sbjct  167  KVF  169



>ref|XP_004171018.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like, 
partial [Cucumis sativus]
Length=504

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 125/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKH-LPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  291
            IN+LL  TL+   +Q+G+  K  + +   S    I     +R  S Q S Q +   + GF
Sbjct  3    INQLLRSTLR---SQLGTFAKTVISSGRASQEHAILAPFLSRLHSTQASAQKE---DSGF  56

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYLDSLAGLWCT+LGGNE RLV 
Sbjct  57   KGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYLDSLAGLWCTSLGGNESRLVA  116

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AAMKQLNTLPFYHSFWNRTT+PSLDLAK+LL+ FTA KM K F
Sbjct  117  AAMKQLNTLPFYHSFWNRTTRPSLDLAKDLLEMFTARKMGKVF  159



>ref|XP_004147736.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53495.1| hypothetical protein Csa_4G056830 [Cucumis sativus]
Length=507

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 125/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  115  INRLLGHTLKRATNQVGSHVKH-LPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  291
            IN+LL  TL+   +Q+G+  K  + +   S    I     +R  S Q S Q +   + GF
Sbjct  3    INQLLRSTLR---SQLGTFAKTVISSGRASQEHAILAPFLSRLHSTQASAQKE---DSGF  56

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYLDSLAGLWCT+LGGNE RLV 
Sbjct  57   KGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYLDSLAGLWCTSLGGNESRLVA  116

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AAMKQLNTLPFYHSFWNRTT+PSLDLAK+LL+ FTA KM K F
Sbjct  117  AAMKQLNTLPFYHSFWNRTTRPSLDLAKDLLEMFTARKMGKVF  159



>sp|Q01K11.1|GATP1_ORYSI RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAH66914.1| OSIGBa0126B18.7 [Oryza sativa Indica Group]
Length=516

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            TR  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  592  KAF  600
            K F
Sbjct  164  KVF  166



>ref|XP_006652817.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Oryza brachyantha]
Length=513

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            +R  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI GKKYL
Sbjct  41   SRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIEGKKYL  100

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKE+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKEMLSIFTAREMG  160

Query  592  KAF  600
            K F
Sbjct  161  KVF  163



>dbj|BAK05511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q +STDE GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTDENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTANKMG  159

Query  592  KAF  600
            KAF
Sbjct  160  KAF  162



>ref|XP_004976801.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Setaria italica]
Length=512

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q+DST+E GFKGH MLAPFTAGWQ+ +LHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDSTEENGFKGHGMLAPFTAGWQSNELHPLIIERSEGSYVYDINGNKYL  100

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTT+PSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTRPSLDLAQEILSMFTAREMG  160

Query  592  KAF  600
            K F
Sbjct  161  KVF  163



>gb|KHN05488.1| Putative aminotransferase y4uB [Glycine soja]
Length=513

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            T  S A+ +  ND  + +GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  592  KAF  600
            KAF
Sbjct  162  KAF  164



>ref|XP_006592029.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Glycine max]
Length=513

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            T  S A+ +  ND  + +GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  592  KAF  600
            KAF
Sbjct  162  KAF  164



>dbj|BAI66419.1| aminotransferase [Triticum aestivum]
Length=511

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R  S+  S Q +ST+E GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMG  159

Query  592  KAF  600
            KAF
Sbjct  160  KAF  162



>ref|XP_008677242.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=484

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  148  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  327
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  328  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  507
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  508  HSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            HSFWNRTTKPSLDLA ++L  FTA +M K F
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVF  160



>gb|AFW61009.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=509

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  148  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  327
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  328  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  507
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  508  HSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            HSFWNRTTKPSLDLA ++L  FTA +M K F
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVF  160



>gb|AFW61008.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=493

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  148  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  327
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  328  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  507
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  508  HSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            HSFWNRTTKPSLDLA ++L  FTA +M K F
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVF  160



>ref|NP_001148620.1| aminotransferase y4uB [Zea mays]
 gb|ACG32262.1| aminotransferase y4uB [Zea mays]
Length=509

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  148  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  327
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  328  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  507
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  508  HSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            HSFWNRTTKPSLDLA ++L  FTA +M K F
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVF  160



>ref|XP_002883348.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59607.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=504

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  268  DSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALG  447
            +  +  G KGHDMLAPFTAGWQ+TDL PLVI KSEGSYVYD NGKKYLDSLAGLWCTALG
Sbjct  43   EKLNSAGSKGHDMLAPFTAGWQSTDLDPLVIAKSEGSYVYDANGKKYLDSLAGLWCTALG  102

Query  448  GNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            GNEPRLV AA+KQLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAF
Sbjct  103  GNEPRLVSAAVKQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTANKMAKAF  153



>ref|XP_008451896.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=507

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            +R  S Q S Q +   + GFKGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  40   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  96

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  97   DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  156

Query  592  KAF  600
            K F
Sbjct  157  KVF  159



>ref|XP_003580544.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial 
[Brachypodium distachyon]
Length=515

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  414
            R  S+  S Q++ST+E GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYD NG KYLD
Sbjct  45   RHFSSAPSPQSNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDTNGNKYLD  104

Query  415  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAK  594
            SLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM K
Sbjct  105  SLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPTLDLAGDLLSMFTARKMGK  164

Query  595  AF  600
            AF
Sbjct  165  AF  166



>ref|XP_009597725.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=155

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            F GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRLV
Sbjct  8    FGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRLV  66

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKEL+D FTA KMAKAF
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELIDLFTANKMAKAF  110



>ref|XP_008451895.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=515

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            +R  S Q S Q +   + GFKGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  48   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  104

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  105  DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  164

Query  592  KAF  600
            K F
Sbjct  165  KVF  167



>ref|XP_010525163.1| PREDICTED: LOW QUALITY PROTEIN: gamma-aminobutyrate transaminase 
POP2, mitochondrial-like [Tarenaya hassleriana]
Length=504

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 126/165 (76%), Gaps = 10/165 (6%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK  285
            +A+INRL    L R++ QV  + ++  +V    GS       +R+ S + S +  S    
Sbjct  1    MAVINRLF--RLARSS-QVNFYSRNAASVKFIPGSCT-----SRFFSTEASQEKQSP--V  50

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G+KGHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKYLD+LAGLWCTALGGNEPRL
Sbjct  51   GYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKYLDALAGLWCTALGGNEPRL  110

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAKAF
Sbjct  111  VAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKKMAKAF  155



>ref|XP_002447091.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
 gb|EES11419.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
Length=511

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  274  TDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGN  453
            T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+
Sbjct  54   TEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGS  113

Query  454  EPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA KM K F
Sbjct  114  EPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSIFTARKMGKVF  162



>ref|XP_010525162.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Tarenaya hassleriana]
Length=504

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +1

Query  241  SSAQVSVQNDSTDEK----GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  408
            SS   S   +++ EK    G+KGHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKY
Sbjct  32   SSTSRSFSTEASQEKKSPVGYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKY  91

Query  409  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKM  588
            LD+LAGLWCTALGGNEPRLV AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA  M
Sbjct  92   LDALAGLWCTALGGNEPRLVAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKNM  151

Query  589  AKAF  600
            AKAF
Sbjct  152  AKAF  155



>ref|XP_003537747.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Glycine max]
Length=513

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            T  S A+ +  ND  + +G+KGH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  101

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  592  KAF  600
            KAF
Sbjct  162  KAF  164



>emb|CDY58748.1| BnaCnng33690D [Brassica napus]
Length=498

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNEPRL
Sbjct  43   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEPRL  102

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  103  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  147



>gb|KHN09253.1| Putative aminotransferase y4uB [Glycine soja]
Length=536

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            T  S A+ +  ND  + +G+KGH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  58   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  117

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  118  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  177

Query  592  KAF  600
            KAF
Sbjct  178  KAF  180



>ref|XP_006406200.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
 gb|ESQ47653.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
Length=503

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +G KYLDSLAGLWCTALGGNEPRL
Sbjct  48   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGTKYLDSLAGLWCTALGGNEPRL  107

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AAM+QLNTLPFYHSFWNRTTKPSLDLAK+LL  FTA KMAKAF
Sbjct  108  VSAAMEQLNTLPFYHSFWNRTTKPSLDLAKDLLGMFTANKMAKAF  152



>gb|KJB22727.1| hypothetical protein B456_004G063100 [Gossypium raimondii]
Length=502

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 115/161 (71%), Gaps = 13/161 (8%)
 Frame = +1

Query  118  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKG  297
            N+ L  TLK    Q+GS++K+  A        I+ +   RW S              FKG
Sbjct  4    NKYLRSTLK---TQLGSYIKNAAACKSLLEYPIKGQCEARWCSTNTC----------FKG  50

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            H+MLAPFT GWQ+T+++PLVI KSEGSYVYDIN KKYLD+LAGLWCTALGGNEPRLV AA
Sbjct  51   HNMLAPFTPGWQSTEVNPLVIVKSEGSYVYDINEKKYLDTLAGLWCTALGGNEPRLVAAA  110

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
              QLN LPFYHSFWNRTTKPSLDLAKEL +TFTA KMAK F
Sbjct  111  TDQLNKLPFYHSFWNRTTKPSLDLAKELTETFTATKMAKVF  151



>ref|XP_006592030.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=480

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  271  STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGG  450
            S  E  FKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD+LAGLW T+LGG
Sbjct  22   SFGESMFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWATSLGG  81

Query  451  NEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM KAF
Sbjct  82   SEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMGKAF  131



>ref|XP_008668890.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Zea mays]
 tpg|DAA36030.1| TPA: putative aminotransferase class III superfamily protein 
[Zea mays]
Length=510

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            +E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+E
Sbjct  54   EENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGSE  113

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M K F
Sbjct  114  PRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSMFTAREMGKVF  161



>gb|KFK39511.1| hypothetical protein AALP_AA3G253600 [Arabis alpina]
Length=506

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 120/165 (73%), Gaps = 10/165 (6%)
 Frame = +1

Query  106  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK  285
            +AMIN L    L R+T QV  H ++     G+    +     +R  + + S Q  ++   
Sbjct  1    MAMINNL--RRLARST-QVNLHSRY-----GASTKCMSGSFTSRIFTTEASPQKQNS--A  50

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DL PL+I KSEG YVYD  G+KYLDSLAGLWCTALGGNEPRL
Sbjct  51   GSKGHDMLAPFTAGWQSADLDPLIIAKSEGCYVYDDQGRKYLDSLAGLWCTALGGNEPRL  110

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  111  VSAALNQLNTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  155



>ref|XP_009776834.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=347

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            GF GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRL
Sbjct  7    GFGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRL  65

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V+AA KQLNTLPFYHSFWNRTTKPSLDLA+EL+D FTA KMAK F
Sbjct  66   VEAATKQLNTLPFYHSFWNRTTKPSLDLARELIDLFTANKMAKVF  110



>ref|XP_007131572.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
 gb|ESW03566.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
Length=513

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
            T  S A+    N+  +  GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYL
Sbjct  42   TEASLAKDDSANEGKNGPGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYL  101

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            D+LAGLW TALGG+E RLVDAAM Q   LPFYHSFWNRTT PSL+LAKELL+ FTA KMA
Sbjct  102  DALAGLWATALGGSESRLVDAAMAQFKKLPFYHSFWNRTTLPSLELAKELLEMFTARKMA  161

Query  592  KAF  600
            KAF
Sbjct  162  KAF  164



>ref|XP_006406198.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
 gb|ESQ47651.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
Length=513

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G+KGH MLAPFTAGWQ+ DL PL+I KSEGSYVYDI+GKKYLDSLAGLWCTALGGNEPRL
Sbjct  51   GYKGHSMLAPFTAGWQSADLDPLIIAKSEGSYVYDIHGKKYLDSLAGLWCTALGGNEPRL  110

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA+ QLNTLPFYHSFWN TTKPSLDLAKELLD FTA KM KAF
Sbjct  111  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAKELLDMFTANKMTKAF  155



>emb|CDY37389.1| BnaC05g30410D [Brassica napus]
Length=500

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  247  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  426
            +++     S ++ G KGHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRIFTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  427  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAF
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAF  149



>ref|XP_009145420.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Brassica rapa]
 emb|CDY10619.1| BnaA05g17430D [Brassica napus]
Length=500

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  247  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  426
            +++     S ++ G KGHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRILTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  427  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAF
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAF  149



>tpg|DAA59557.1| TPA: putative aminotransferase class III superfamily protein, 
partial [Zea mays]
Length=447

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLVEAATA  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK F
Sbjct  61   QLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVF  99



>ref|XP_004505667.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cicer arietinum]
Length=513

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  265  NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  444
            +D   ++ FKGHDMLAPFTAGWQTTDL PL+I+KSEGSYVYDI GKKYLD LAGLWCTAL
Sbjct  53   DDVNPDQRFKGHDMLAPFTAGWQTTDLDPLIIDKSEGSYVYDITGKKYLDPLAGLWCTAL  112

Query  445  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            GGNE RL+DAA  QL  LPFYHSFWNRTTKPSLDLAKELL  FTA KMAKAF
Sbjct  113  GGNEQRLIDAATAQLKKLPFYHSFWNRTTKPSLDLAKELLQFFTARKMAKAF  164



>ref|XP_010488236.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Camelina sativa]
Length=504

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  49   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  108

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  109  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  153



>ref|NP_566700.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 sp|Q94CE5.1|GATP_ARATH RecName: Full=Gamma-aminobutyrate transaminase POP2, mitochondrial; 
Short=AtGABA-T; AltName: Full=Protein HEXENAL RESPONSE 
1; AltName: Full=Protein POLLEN-PISTIL INCOMPATIBILITY 2; 
Short=AtPOP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59430.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AAN13140.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AEE76602.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=504

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTA KMAKAF
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAF  153



>gb|AAK52899.1|AF351125_1 gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
thaliana]
Length=504

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTA KMAKAF
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAF  153



>gb|KDO64364.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
 gb|KDO64365.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=447

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  61   QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVF  99



>ref|NP_001189947.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 gb|AEE76603.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=513

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  58   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  117

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTA KMAKAF
Sbjct  118  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAF  162



>ref|XP_010511056.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=547

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  92   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  151

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  152  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  196



>dbj|BAB03068.1| aminotransferase-like protein [Arabidopsis thaliana]
Length=466

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRLV 
Sbjct  13   KGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRLVS  72

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTA KMAKAF
Sbjct  73   AAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAF  115



>ref|XP_003607298.1| Aminotransferase y4uB [Medicago truncatula]
 gb|AES89495.1| gamma-aminobutyrate transaminase [Medicago truncatula]
Length=513

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  247  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  426
            A+ S  +D+   +GFK HDMLAPFTAGWQT +L+PL+IEKSEGSYVYDINGKKYLD+LAG
Sbjct  47   AKDSSTSDAKTGQGFKSHDMLAPFTAGWQTNELNPLIIEKSEGSYVYDINGKKYLDALAG  106

Query  427  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LW TALGG+E RLVDAA  QL  LPFYHSFWNRTT+P+LDLAKELL+ FTA KMAKAF
Sbjct  107  LWSTALGGSEQRLVDAATAQLKKLPFYHSFWNRTTRPALDLAKELLELFTARKMAKAF  164



>ref|XP_010648197.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Vitis vinifera]
Length=514

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +1

Query  157  QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST---DEKGFKGHDMLAPFTAG  327
            Q G ++ H+         +    +  + SS + S+Q + +   + KGFKGHDML+PFT G
Sbjct  15   QAGFYINHVVTARILMKHLHPAPALAKCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTG  74

Query  328  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  507
            WQ+T+L PL+IE+SEG YVYD NG+KYLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFY
Sbjct  75   WQSTNLDPLLIERSEGPYVYDSNGRKYLDALAGLWCTALGGSEPRLIAAATAQLNTLPFY  134

Query  508  HSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            HSFWN  +KPSLDLAKELL+TFTA KM K F
Sbjct  135  HSFWNHASKPSLDLAKELLNTFTATKMGKVF  165



>ref|XP_009109118.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=501

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  46   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  105

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTA KMAKAF
Sbjct  106  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAF  150



>emb|CDY39506.1| BnaA01g24820D [Brassica napus]
Length=506

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  51   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  110

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTA KMAKAF
Sbjct  111  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAF  155



>emb|CBI34103.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  235  RWSSAQVSVQNDST---DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  405
            + SS + S+Q + +   + KGFKGHDML+PFT GWQ+T+L PL+IE+SEG YVYD NG+K
Sbjct  12   KCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTGWQSTNLDPLLIERSEGPYVYDSNGRK  71

Query  406  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXK  585
            YLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFYHSFWN  +KPSLDLAKELL+TFTA K
Sbjct  72   YLDALAGLWCTALGGSEPRLIAAATAQLNTLPFYHSFWNHASKPSLDLAKELLNTFTATK  131

Query  586  MAKAF  600
            M K F
Sbjct  132  MGKVF  136



>ref|XP_006297475.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
 gb|EOA30373.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
Length=505

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGHDMLAPFTAGWQ+ D+ PL+I KSEGSYVYD NGKKYLDSLAGLWCTALGGNE RL
Sbjct  50   GSKGHDMLAPFTAGWQSADVDPLIIAKSEGSYVYDDNGKKYLDSLAGLWCTALGGNEERL  109

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA++QL  LPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  110  VSAAVEQLKILPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  154



>ref|XP_004244777.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum lycopersicum]
Length=458

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            GF GH+MLAPFTAGWQ  D+ PLVIEK+EGSYVYDINGKKYLDSL+GLWCT+LGG+E RL
Sbjct  6    GFMGHNMLAPFTAGWQI-DMGPLVIEKAEGSYVYDINGKKYLDSLSGLWCTSLGGSEARL  64

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            ++AA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAK F
Sbjct  65   IEAANKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTARKMAKVF  109



>gb|ADM13673.1| putative aminotransferase [Capsicum annuum]
Length=459

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWCT LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCTTLGGSETRLV  66

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVF  110



>ref|XP_010466490.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=504

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGHDMLAPFTAGWQ+ D+ PL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RLV 
Sbjct  51   KGHDMLAPFTAGWQSADVDPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRLVS  110

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTA KMAKAF
Sbjct  111  AAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAF  153



>ref|XP_010313638.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=448

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEPRLV AA K
Sbjct  1    MLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATK  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLN LPFYHSFWNR+TKPSLDLAKELLD FTA KMAKAF
Sbjct  61   QLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAF  99



>gb|AAC78480.1| putative aminotransferase [Capsicum chinense]
Length=459

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVF  110



>ref|XP_010680154.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  232  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  411
             R+ S+  S+ + +   + +KGH MLAPFTAGWQTTD HPLVI+KSEG YV+DI G KYL
Sbjct  32   VRYMSSDASLDSTTESNRSYKGHGMLAPFTAGWQTTDTHPLVIDKSEGCYVFDIQGNKYL  91

Query  412  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMA  591
            DSLAGLW TALGGNE RL+DAA  QL  LPFYHSFWNRTTK SLDLA+ELL  FTA KMA
Sbjct  92   DSLAGLWSTALGGNESRLIDAATTQLKKLPFYHSFWNRTTKVSLDLAEELLQMFTARKMA  151

Query  592  KAF  600
            KAF
Sbjct  152  KAF  154



>gb|ADG65346.1| putative aminotransferase [Capsicum frutescens]
Length=459

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            F GHDMLAPFTAGWQ+ D+ PLVIEKS+GSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSKGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK F
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVF  110



>ref|XP_011467676.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Fragaria vesca subsp. vesca]
Length=448

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +
Sbjct  1    MLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATR  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAF
Sbjct  61   QLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAF  99



>ref|NP_001053862.1| Os04g0614500 [Oryza sativa Japonica Group]
 sp|Q7XN12.2|GATP2_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|Q01K12.1|GATP2_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAE04332.2| OSJNBa0008M17.3 [Oryza sativa Japonica Group]
 dbj|BAF15776.1| Os04g0614500 [Oryza sativa Japonica Group]
 emb|CAH66913.1| OSIGBa0126B18.6 [Oryza sativa Indica Group]
 dbj|BAG94519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  235  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  414
            ++S++  S   DST+  GFKGH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD
Sbjct  27   KFSTSGSSPLLDSTEGNGFKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLD  86

Query  415  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAK  594
            +LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K
Sbjct  87   TLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGK  146

Query  595  AF  600
             F
Sbjct  147  VF  148



>ref|XP_008464679.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
2-like [Cucumis melo]
Length=516

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 7/161 (4%)
 Frame = +1

Query  139  LKRATN-QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND------STDEKGFKG  297
            L+  TN ++GS  K + A   S   +I+ +  ++  S + S+Q D      +   + FKG
Sbjct  7    LRVITNPKLGSCAKDVAAFRTSGERLIQVQLLSQQYSTEASLQRDDNSTIDTRSGQSFKG  66

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            H MLAPFT GWQ  D++PLVIE+SEG+Y+YDINGKKYLDSLAGLW T+LGG+EPRLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIERSEGTYLYDINGKKYLDSLAGLWSTSLGGSEPRLVAAA  126

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K F
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEIFTARKMGKVF  167



>ref|XP_009145417.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=502

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            G KGH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RL
Sbjct  48   GPKGHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARL  107

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            V AA+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAF
Sbjct  108  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAF  152



>ref|XP_004166491.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
3, chloroplastic-like, partial [Cucumis sativus]
Length=475

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 7/161 (4%)
 Frame = +1

Query  139  LKRATN-QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKG----FKG  297
            L+  TN ++GS  K + A+  S   +I+ +  ++  + + S+Q D  ST + G    FKG
Sbjct  7    LRVITNPKLGSCAKDVAALRTSGERLIQVQLLSQQYATEASLQRDDNSTTDTGSGQSFKG  66

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            H MLAPFT GWQ  D++PLVIEKSEG+Y+YDINGKKYLDSLAGLW T+LGG+E RLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIEKSEGTYLYDINGKKYLDSLAGLWSTSLGGSEARLVAAA  126

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K F
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEMFTARKMGKVF  167



>emb|CDY10622.1| BnaA05g17400D [Brassica napus]
Length=472

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  292  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  471
            KGH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RLV 
Sbjct  20   KGHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARLVS  79

Query  472  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            AA+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAF
Sbjct  80   AAVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAF  122



>ref|XP_004145993.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54978.1| hypothetical protein Csa_4G618430 [Cucumis sativus]
Length=516

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 7/161 (4%)
 Frame = +1

Query  139  LKRATN-QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKG----FKG  297
            L+  TN ++GS  K + A+  S   +I+ +  ++  + + S+Q D  ST + G    FKG
Sbjct  7    LRVITNPKLGSCAKDVAALRTSGERLIQVQLLSQQYATEASLQRDDNSTTDTGSGQSFKG  66

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            H MLAPFT GWQ  D++PLVIEKSEG+Y+YDINGKKYLDSLAGLW T+LGG+E RLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIEKSEGTYLYDINGKKYLDSLAGLWSTSLGGSEARLVAAA  126

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K F
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEMFTARKMGKVF  167



>ref|XP_006652818.1| PREDICTED: probable gamma-aminobutyrate transaminase 2, mitochondrial-like 
[Oryza brachyantha]
Length=496

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +1

Query  268  DSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALG  447
            DS +E GFKGH ML+PFTAGWQ  D HP +IE+SEGSYVYD  G KYLD+LAGLWCTALG
Sbjct  37   DSPEEAGFKGHSMLSPFTAGWQAKD-HPFIIERSEGSYVYDSKGNKYLDALAGLWCTALG  95

Query  448  GNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            G+EPRLV AA  QLN LPFYHSFWN TTKP LDLAKEL+  FTA +M K F
Sbjct  96   GSEPRLVKAATDQLNKLPFYHSFWNSTTKPPLDLAKELIGMFTAREMGKVF  146



>ref|XP_006351980.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum tuberosum]
Length=459

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            GFKGHDMLAPFTA W   D+ PLVI+++EGSYVYD+NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  7    GFKGHDMLAPFTAAWMI-DMGPLVIDRAEGSYVYDVNGKKYLDSLSGLWCTVLGGSEPRL  65

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            ++AA KQLN L FYHSFWNR+TKPSLDLAKEL++ FTA KM K F
Sbjct  66   IEAANKQLNKLAFYHSFWNRSTKPSLDLAKELINMFTANKMGKVF  110



>ref|XP_004147774.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53496.1| hypothetical protein Csa_4G056840 [Cucumis sativus]
Length=510

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  280  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  459
            E   KGHDMLAPFT+GW++ ++ P+++ +SEGSYVYD NG+KYLD+LAGLWCTALGGNE 
Sbjct  56   EPKVKGHDMLAPFTSGWESNNVGPMIMARSEGSYVYDNNGRKYLDALAGLWCTALGGNES  115

Query  460  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            RLV AA KQLNTLPFYHSFWN TT+PSLDLAKELL+ FTA KM K F
Sbjct  116  RLVAAATKQLNTLPFYHSFWNHTTQPSLDLAKELLEMFTARKMGKVF  162



>gb|AFK39370.1| unknown [Lotus japonicus]
Length=447

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFTAGWQT DL PL+IEKSEGSY+YD+NGKKYLD+LAGLW TALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQT-DLTPLIIEKSEGSYIYDVNGKKYLDALAGLWSTALGGNEPRLVEAANA  59

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QL  LPFYHSFWNRTT+PSLDLAKELL+ FTA KMAKAF
Sbjct  60   QLKKLPFYHSFWNRTTRPSLDLAKELLEMFTARKMAKAF  98



>emb|CAD12664.1| viroid RNA-binding protein [Solanum lycopersicum]
Length=476

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVYD+NGKKYLDSL+GLWC+ LGG+EPRL
Sbjct  16   GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYDVNGKKYLDSLSGLWCSVLGGSEPRL  74

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            ++AA KQLN L FYHSFWNRTTKPSLDLAKEL++ FTA KM K F
Sbjct  75   IEAANKQLNKLAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVF  119



>gb|EEC77994.1| hypothetical protein OsI_17384 [Oryza sativa Indica Group]
Length=493

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV
Sbjct  54   FKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLV  113

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K F
Sbjct  114  KAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVF  157



>ref|NP_001234340.1| gamma aminobutyrate transaminase 2 [Solanum lycopersicum]
 sp|Q84P53.1|GATP2_SOLLC RecName: Full=Gamma aminobutyrate transaminase 2; AltName: Full=Gamma-aminobutyrate 
transaminase isozyme 2; Short=LeGABA-TP2; 
Short=SlGABA-T2 [Solanum lycopersicum]
 gb|AAO92256.1| gamma-aminobutyrate transaminase subunit precursor isozyme 2 
[Solanum lycopersicum]
 dbj|BAG16483.1| gamma aminobutyrate transaminase isoform2 [Solanum lycopersicum]
Length=458

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +1

Query  286  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  465
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVY +NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  6    GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYGVNGKKYLDSLSGLWCTVLGGSEPRL  64

Query  466  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            ++AA KQLN   FYHSFWNRTTKPSLDLAKEL++ FTA KM K F
Sbjct  65   IEAASKQLNKSAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVF  109



>gb|EMT06765.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=499

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 29/135 (21%)
 Frame = +1

Query  283  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSE-----------------------------G  375
            + FKGH MLAPFTAGWQ+TD+HPLVI++SE                             G
Sbjct  54   EAFKGHGMLAPFTAGWQSTDVHPLVIDRSEVLGLNAHLSINCSDFNLKVLSYTLQLILQG  113

Query  376  SYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAK  555
            +YVYDINGKKY+D+LAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA 
Sbjct  114  AYVYDINGKKYIDALAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAN  173

Query  556  ELLDTFTAXKMAKAF  600
            ++L+ FTA +M K F
Sbjct  174  DVLNMFTAREMGKVF  188



>gb|EMS61591.1| putative aminotransferase y4uB [Triticum urartu]
Length=542

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 86/104 (83%), Gaps = 6/104 (6%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FKGH MLAPFTAGWQ+ D+HPL      GSYVYDING KYLDSLAGLWCTALGG+EPRLV
Sbjct  51   FKGHGMLAPFTAGWQSNDVHPL------GSYVYDINGNKYLDSLAGLWCTALGGSEPRLV  104

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM KAF
Sbjct  105  KAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAF  148



>ref|NP_001045660.1| Os02g0112900 [Oryza sativa Japonica Group]
 sp|Q6ZH29.1|GATP4_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 4; Short=OsGABA-T 
[Oryza sativa Japonica Group]
 dbj|BAD07632.1| putative 4-aminobutyrate aminotransferase [Oryza sativa Japonica 
Group]
 dbj|BAF07574.1| Os02g0112900 [Oryza sativa Japonica Group]
Length=483

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +1

Query  235  RWSSAQVSVQ---NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  405
            ++SS   S Q   +DS +E G K H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  406  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXK  585
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  586  MAKAF  600
            M K F
Sbjct  129  MGKVF  133



>gb|AAK11219.1|AF324485_1 aminotransferase-like protein [Oryza sativa]
Length=483

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +1

Query  235  RWSSAQVSVQ---NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  405
            ++SS   S Q   +DS +E G K H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  406  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXK  585
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  586  MAKAF  600
            M K F
Sbjct  129  MGKVF  133



>gb|EEE61675.1| hypothetical protein OsJ_16144 [Oryza sativa Japonica Group]
Length=435

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATD  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K F
Sbjct  61   QLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVF  99



>ref|XP_008451902.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
1, mitochondrial-like [Cucumis melo]
Length=447

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            MLAPFT+GW++ ++ P++I +SEG YVYD NG+KYLD+LAGLWCTALGGNE RLV AA K
Sbjct  1    MLAPFTSGWESNNVDPVIIARSEGPYVYDNNGRKYLDALAGLWCTALGGNESRLVAAATK  60

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QLNTLPFYHSFWN TT+PSLDLAK+LL+ FTA KM K F
Sbjct  61   QLNTLPFYHSFWNHTTQPSLDLAKKLLEMFTARKMGKVF  99



>ref|XP_002970285.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
 gb|EFJ28415.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
Length=463

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  262  QNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  441
            ++ + DE   + H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  442  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVL  115



>ref|XP_002978448.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
 gb|EFJ20434.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
Length=463

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  262  QNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  441
            ++ + DE   + H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  442  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVL  115



>ref|XP_008652184.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=124

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  370  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  549
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  550  AKELLDTFTAXKMAKAF  600
            A+E+L  FTA +M K F
Sbjct  62   AQEILSMFTAREMGKVF  78



>ref|XP_008652185.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=120

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  370  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  549
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  550  AKELLDTFTAXKMAKAF  600
            A+E+L  FTA +M K F
Sbjct  62   AQEILSMFTAREMGKVF  78



>ref|XP_001783174.1| predicted protein [Physcomitrella patens]
 gb|EDQ52005.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +1

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            H MLAPFTAGWQ     PLVIE+ EG YV+D  G KYLD+LAGLWCTALG +E RLV AA
Sbjct  44   HSMLAPFTAGWQMKAGTPLVIERGEGVYVWDNKGNKYLDALAGLWCTALGFSEKRLVAAA  103

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             KQL+TLPFYH+FWNRT++P+LDLA EL   FTA +M+K F
Sbjct  104  EKQLSTLPFYHNFWNRTSQPTLDLASELSKLFTASEMSKVF  144



>ref|XP_001762156.1| predicted protein [Physcomitrella patens]
 gb|EDQ72948.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            + GH MLAPFT+G Q  +  PL+I K EG YV+D NGKKYLD+LAGLWC ++G +E RL+
Sbjct  2    YHGHSMLAPFTSGSQQMETEPLIIAKGEGVYVWDRNGKKYLDALAGLWCASMGFSEKRLM  61

Query  469  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +AA  Q+  LPFYHSFWNRT++P LDLAKEL+D F   KM K F
Sbjct  62   NAAWNQMTQLPFYHSFWNRTSQPPLDLAKELIDIFKPVKMGKVF  105



>gb|EMS53048.1| putative aminotransferase y4uB [Triticum urartu]
Length=574

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 12/168 (7%)
 Frame = +1

Query  97   REAVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST  276
            R++++   RL   T+     +  S VK++ +    HG      +  R  S++ S+Q DST
Sbjct  129  RDSLSFSYRLPIETVDVGEKEAESLVKYVASAGSWHGLHSFSEASARGFSSEPSLQADST  188

Query  277  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  456
            +E G              +     P +I   +G+YVYDINGKKY+D+LAGLWCTALGGNE
Sbjct  189  EEIG----------DCNLKVLSYTPQLI--LQGAYVYDINGKKYIDALAGLWCTALGGNE  236

Query  457  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M K F
Sbjct  237  PRLVKAATEQLNKLPFYHSFWNRTTKPSLDLANDVLNMFTAREMGKVF  284



>gb|EMT11453.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=516

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +1

Query  328  WQTTDLH------PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQL  489
            W  TDL        +++    GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA  QL
Sbjct  72   WLLTDLRLRLSNSSIILHAMVGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATDQL  131

Query  490  NTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            N LPFYHSFWNRTTKP+LDLA +LL  FTA KM KAF
Sbjct  132  NKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAF  168



>ref|XP_008662070.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=442

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  370  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  549
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  15   QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDL  74

Query  550  AKELLDTFTAXKMAKAF  600
            A+E+L  FTA +M K F
Sbjct  75   AQEILSMFTAREMGKVF  91



>ref|XP_004173032.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like, 
partial [Cucumis sativus]
Length=422

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  379  YVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKE  558
            YVYD NG+KYLD+LAGLWCTALGGNE RLV AA KQLNTLPFYHSFWN TT+PSLDLAKE
Sbjct  1    YVYDNNGRKYLDALAGLWCTALGGNESRLVAAATKQLNTLPFYHSFWNHTTQPSLDLAKE  60

Query  559  LLDTFTAXKMAKAF  600
            LL+ FTA KM K F
Sbjct  61   LLEMFTARKMGKVF  74



>ref|XP_003604707.1| Aminotransferase [Medicago truncatula]
 gb|AES86904.1| class III aminotransferase [Medicago truncatula]
Length=200

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  468
            FK HDMLAPFTAGWQT +L+PL+IEKSEGSYVYDIN KKYLD LAGLW TALGG+E  LV
Sbjct  86   FKSHDMLAPFTAGWQTNELNPLIIEKSEGSYVYDINEKKYLDPLAGLWSTALGGSEQGLV  145

Query  469  DAAMKQLNTLPFY--HSFWNRTT  531
            DAA  QL  LP    H  W   T
Sbjct  146  DAATAQLKKLPSIQTHRHWMSVT  168



>ref|XP_006576527.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Glycine max]
Length=134

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  265  NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  444
            ND  + +GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD+LAGLW T+L
Sbjct  60   NDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWATSL  119

Query  445  G  447
            G
Sbjct  120  G  120



>gb|EEC77996.1| hypothetical protein OsI_17386 [Oryza sativa Indica Group]
Length=2239

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  370   EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  549
             +GSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDL
Sbjct  1887  QGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDL  1946

Query  550   AKELLDTFTAXKMAKAF  600
             A+EL+  FTA +M K F
Sbjct  1947  AEELISMFTAKEMGKVF  1963



>ref|XP_008674137.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Zea mays]
 ref|XP_008674138.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Zea mays]
Length=85

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
            MLA FTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+EPRLV AA
Sbjct  1    MLASFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAA  58



>ref|XP_008669882.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=91

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  444
            FKGH MLAPFTA WQ+ DLH L+IE+SEGSYVYDING KYLDSLAGLWCT+L
Sbjct  6    FKGHGMLAPFTADWQSNDLHHLIIERSEGSYVYDINGNKYLDSLAGLWCTSL  57



>ref|XP_008669883.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=87

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  289  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  444
            FKGH MLAPFTA WQ+ DLH L+IE+SEGSYVYDING KYLDSLAGLWCT+L
Sbjct  6    FKGHGMLAPFTADWQSNDLHHLIIERSEGSYVYDINGNKYLDSLAGLWCTSL  57



>ref|WP_018897972.1| aminotransferase [Rhizobium sp. 2MFCol3.1]
Length=458

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T   +  ++ P+VIEK EG YVYD +G +Y++ LAGLW  A+G NEPRLVDAA +Q
Sbjct  18   LHPYTDARRHEEIGPMVIEKGEGIYVYDADGNRYIEGLAGLWSVAVGFNEPRLVDAAAQQ  77

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LP+YH+F ++  +PS+ LA++L++  T   + + F
Sbjct  78   MAKLPYYHTFSHKAHEPSIRLAEKLVE-MTPDNLTRVF  114



>ref|WP_013742690.1| aminotransferase [Pusillimonas sp. T7-7]
 gb|AEC20154.1| aminotransferase [Pusillimonas sp. T7-7]
Length=453

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T   +   + P +IE+ EG YVYD  G+KY++ +AGLW  A+G NE RLVDAA +Q
Sbjct  16   LHPYTNAIKHRQVGPRIIERGEGIYVYDDQGRKYIEGMAGLWSVAVGFNEQRLVDAAQRQ  75

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F ++T  PS++LA+ L+   T  +M+ AF
Sbjct  76   MQKLPFYHTFTHKTHTPSIELAERLVQA-TQGQMSTAF  112



>ref|WP_041862975.1| aminotransferase [Bordetella petrii]
Length=454

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  16   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  75

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAF
Sbjct  76   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAF  112



>emb|CAP43438.1| putative aminotransferase [Bordetella petrii]
Length=456

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  18   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  77

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAF
Sbjct  78   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAF  114



>ref|WP_027569703.1| aminotransferase [Bradyrhizobium sp. URHA0013]
Length=460

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVF  113



>ref|WP_027517565.1| aminotransferase [Bradyrhizobium sp. WSM1417]
Length=460

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVF  113



>ref|WP_028793896.1| aminotransferase [Thalassobaculum salexigens]
Length=460

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +L P+T      +  P++I K +G YVYD  GK+YL+++AGLWC +LG NE RLV AA K
Sbjct  16   VLHPYTNARAHEENGPMIITKGDGVYVYDDGGKQYLEAMAGLWCASLGFNENRLVKAATK  75

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QL TLP+YH+F ++   P +DLA++L++      M+K F
Sbjct  76   QLETLPYYHTFAHKAHLPGIDLAEKLIN-LAPVPMSKVF  113



>ref|WP_025035884.1| aminotransferase [Bradyrhizobium sp. DOA9]
 dbj|GAJ34911.1| probable aminotransferase Y4UB [Bradyrhizobium sp. DOA9]
Length=460

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAYKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_018456285.1| aminotransferase [Bradyrhizobium sp. WSM4349]
Length=460

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_007591914.1| aminotransferase [Bradyrhizobium sp. WSM1253]
 gb|EIG56562.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. WSM1253]
Length=460

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_008129949.1| aminotransferase [Bradyrhizobium sp. YR681]
 gb|EJN16031.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. YR681]
Length=460

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_007609403.1| aminotransferase [Bradyrhizobium sp. WSM471]
 gb|EHR02897.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. WSM471]
Length=460

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_027542945.1| aminotransferase [Bradyrhizobium sp. WSM2254]
Length=460

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>gb|EJZ32369.1| aminotransferase [Bradyrhizobium sp. CCGE-LA001]
Length=458

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  15   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  74

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  75   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  111



>ref|WP_036022740.1| aminotransferase [Bradyrhizobium yuanmingense]
Length=460

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_036000540.1| aminotransferase [Bradyrhizobium yuanmingense]
Length=460

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_025516482.1| aminotransferase [Bordetella trematum]
Length=455

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 8/117 (7%)
 Frame = +1

Query  259  VQNDSTDEKGFKGHDM---LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGL  429
            + N S D++    HD+   L  +T G +  ++ P ++ + EG YVYD  G +YL+ +AGL
Sbjct  1    MSNLSQDQQ----HDIQYQLHSYTNGVKHAEVGPRIMARGEGIYVYDDKGNRYLEGMAGL  56

Query  430  WCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            W  A+G  EPRLVDAA +QL  LP+YH+F +++    ++LA+ L+D +T  +MA+AF
Sbjct  57   WSVAVGFGEPRLVDAATRQLQELPYYHTFTHKSHPAVIELAQRLID-YTEGRMARAF  112



>ref|WP_018317519.1| aminotransferase [Bradyrhizobium sp. WSM2793]
Length=460

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_044033419.1| aminotransferase [Roseobacter denitrificans]
Length=454

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  31   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              P++DLA+ L+D     +M+K F
Sbjct  91   HGPAIDLAERLID-MAPVQMSKVF  113



>gb|ABG31913.1| aminotransferase [Roseobacter denitrificans OCh 114]
Length=452

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  29   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              P++DLA+ L+D     +M+K F
Sbjct  89   HGPAIDLAERLID-MAPVQMSKVF  111



>ref|WP_035675727.1| aminotransferase [Bradyrhizobium liaoningense]
Length=460

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDATGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_024338082.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAYKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-AIAPVTMSKVF  113



>ref|WP_044433671.1| aminotransferase [Skermanella aerolata]
 gb|KJB92497.1| aminotransferase [Skermanella aerolata KACC 11604]
Length=464

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      D+ PLVIE+ EG +V+D +GK Y++ +AGLWCT+LG  E RLV+AA +Q
Sbjct  18   LHPYTNLKTHEDVGPLVIERGEGVHVFDDSGKAYIEGMAGLWCTSLGFGEERLVEAATRQ  77

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L  LPFYH+F ++   P +DLA+ L+       M+K F
Sbjct  78   LRKLPFYHAFTHKAHDPGIDLAEALIK-IAPVPMSKVF  114



>ref|WP_025165321.1| aminotransferase [Pseudomonas taeanensis]
 gb|KFX70067.1| aminotransferase [Pseudomonas taeanensis MS-3]
Length=455

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      ++ PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQEVGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LNTLPFYH F +++ +PS++LA++L++      M+K F
Sbjct  77   LNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVF  113



>ref|WP_035715448.1| aminotransferase [Bradyrhizobium sp. CCBAU 43298]
Length=460

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_023048105.1| MULTISPECIES: aminotransferase [Pseudomonas]
 gb|ERT17847.1| aminotransferase [Pseudomonas putida SJ3]
 gb|AHC35732.1| aminotransferase [Pseudomonas sp. TKP]
 gb|ETK14138.1| aminotransferase [Pseudomonas sp. FH1]
 gb|EZN87292.1| hypothetical protein AJ67_04667 [Pseudomonas aeruginosa 3580]
 gb|EZN88306.1| hypothetical protein AJ68_04436 [Pseudomonas aeruginosa 3581]
 gb|AIG01262.1| aminotransferase [Pseudomonas fluorescens]
 gb|AIN58561.1| aminotransferase [Pseudomonas mosselii SJ10]
 gb|AJG14397.1| aminotransferase [Pseudomonas plecoglossicida]
Length=455

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      +L PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQELGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             NTLPFYH F +++ +PS++LA++L++      M+K F
Sbjct  77   FNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVF  113



>ref|WP_027557626.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
Length=460

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_027551405.1| aminotransferase [Bradyrhizobium sp. Cp5.3]
Length=460

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA +Q
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDATGKRYFEAMAGLWSVGLGFNEKRLVEAAYRQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_026641250.1| aminotransferase [Bordetella petrii]
Length=455

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RLVDAA +Q
Sbjct  16   LHPYTNAVVHQRTGPVVIDRGEGIYVYDDQGRQYLEAMAGLWSVAVGFGEQRLVDAATRQ  75

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LP+YH+F +++  P+++LA+ L+  +T  +MAKAF
Sbjct  76   MQKLPYYHTFTHKSHTPAIELAERLIG-YTDGRMAKAF  112



>ref|WP_028181072.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAMGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_027576286.1| aminotransferase [Bradyrhizobium sp. WSM1743]
Length=460

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA +Q
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDATGKRYFEAMAGLWSVGLGFNEKRLVEAAHRQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_011086907.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
 ref|NP_770774.1| aminotransferase [Bradyrhizobium diazoefficiens USDA 110]
 dbj|BAC49399.1| aminotransferase [Bradyrhizobium diazoefficiens USDA 110]
Length=460

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_028355511.1| aminotransferase [Bordetella petrii]
Length=455

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RL DAA +QL  LP+YH+F +++
Sbjct  30   PIVIDRGEGVYVYDDQGQRYLEAMAGLWSVAVGFGEQRLADAAARQLQKLPYYHTFTHKS  89

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              P+++LA+ L+  +T  +MAKAF
Sbjct  90   HAPAIELAERLIG-YTGGRMAKAF  112



>ref|WP_028171115.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
 gb|KGJ69680.1| hypothetical protein BJA5080_04557 [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=460

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_028136798.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ +G YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGDGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVAMSKVF  113



>ref|WP_041710497.1| aminotransferase [Advenella kashmirensis]
Length=456

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +1

Query  256  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  435
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  436  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K F
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVF  113



>ref|WP_039371201.1| aminotransferase [Mumia flava]
 gb|KHL08170.1| aminotransferase [Mumia flava]
Length=456

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSESRLADAADR  71

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            Q+  LPFYH+F +++++PS+ LA++L+       M+K F
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVF  109



>ref|WP_024509951.1| aminotransferase [Bradyrhizobium sp. ARR65]
Length=460

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL++E+ EG YVYD NGK+Y++ LAGLW  A+G +E RL +AAMKQ+  LPFYH F++++
Sbjct  30   PLIMERGEGIYVYDTNGKQYIEGLAGLWSVAVGFSEKRLAEAAMKQMEKLPFYHIFFSKS  89

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
             +PS+ L+ +L++     ++++ F
Sbjct  90   HEPSIRLSDKLIEMAADPRLSRVF  113



>ref|WP_034191978.1| aminotransferase [Burkholderia cenocepacia]
 gb|KEA55089.1| aminotransferase [Burkholderia cenocepacia]
Length=456

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSEQRLADAADR  71

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            Q+  LPFYH+F +++++PS+ LA++L+       M+K F
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVF  109



>ref|WP_041798615.1| aminotransferase [Rhodopseudomonas palustris]
Length=459

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  14   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  73

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKEL  561
            Q++ LPFYH F +++  P + LA +L
Sbjct  74   QMSMLPFYHLFAHKSHSPGIRLADKL  99



>ref|WP_018645424.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  G++Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAAGRRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_028144979.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
Length=460

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNERRLVEAAHKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>gb|ABD06201.1| aminotransferase [Rhodopseudomonas palustris HaA2]
Length=463

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  18   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  77

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKEL  561
            Q++ LPFYH F +++  P + LA +L
Sbjct  78   QMSMLPFYHLFAHKSHSPGIRLADKL  103



>gb|KJC55260.1| aminotransferase [Bradyrhizobium sp. LTSP849]
Length=460

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>gb|KJC51996.1| aminotransferase [Bradyrhizobium sp. LTSP857]
Length=460

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_015686609.1| aminotransferase [Bradyrhizobium sp. S23321]
 dbj|BAL77323.1| aminotransferase [Bradyrhizobium sp. S23321]
Length=460

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMQALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_027535373.1| aminotransferase [Bradyrhizobium sp. WSM3983]
Length=460

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMQALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_028055523.1| aminotransferase [Sinorhizobium meliloti]
Length=463

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PL++++ EG YVYDING++Y++S AGLW  A+G +EPRLV+AA KQ
Sbjct  20   LHPYTNARLHETKGPLIMDRGEGIYVYDINGRQYIESFAGLWSVAIGFSEPRLVEAATKQ  79

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLD  567
            +  LPFYH+F + + +P++ LA++L++
Sbjct  80   MQKLPFYHTFNHMSHEPNIRLAEKLVE  106



>ref|WP_025374662.1| aminotransferase [Advenella mimigardefordensis]
 gb|AHG65965.1| aminotransferase [Advenella mimigardefordensis DPN7]
Length=456

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = +1

Query  256  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  435
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  436  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             A+G +E RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K F
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVF  113



>ref|WP_041957850.1| aminotransferase [Bradyrhizobium japonicum]
 gb|KGT76678.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMQALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>gb|AFK64419.1| aminotransferase [Advenella kashmirensis WT001]
Length=514

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +1

Query  256  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  435
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  62   SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  117

Query  436  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K F
Sbjct  118  VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVF  171



>ref|WP_027523883.1| aminotransferase [Bradyrhizobium sp. Ec3.3]
Length=460

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA +Q
Sbjct  17   LHPYTNARTHQQNGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAYRQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F  ++  PS+DLA++L+       M+K F
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_024810724.1| aminotransferase [Oceanicola sp. HL-35]
Length=461

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T   +  +  P+VI++ EG +VYD NGKKY+++L+GLW  A+G NE RL DAAM Q
Sbjct  18   LHPYTDARKHEEQGPIVIDRGEGIHVYDSNGKKYIEALSGLWSVAVGFNEQRLCDAAMAQ  77

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LP+YH+F +++ +PS+ LA++L++  T   + + F
Sbjct  78   MQKLPYYHTFAHKSHEPSIRLAEKLVE-MTPEHLTRVF  114



>ref|XP_011468608.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=288

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  445  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            GGNE RLV+AA +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KMAK F
Sbjct  52   GGNELRLVEAATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTARKMAKVF  103



>ref|WP_042300360.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F +++++PS+ LA++L+ +     M+K F
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVF  109



>ref|WP_028466856.1| aminotransferase [Nisaea denitrificans]
Length=462

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +L P+T      +  P++IE+ EG YVYD  GKKY++ +AGLW T+LG N  RL  AAMK
Sbjct  16   VLHPYTNFEAHEEKGPMIIERGEGIYVYDDAGKKYIEGMAGLWSTSLGFNSERLKQAAMK  75

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            Q +TLP+YH+F ++   PS+DLA++L+       M+K F
Sbjct  76   QFDTLPYYHTFAHKAHLPSIDLAEKLISKMPV-PMSKVF  113



>ref|WP_017775036.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F +++++PS+ LA++L+ +     M+K F
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVF  109



>ref|WP_016558738.1| aminotransferase [Rhizobium grahamii]
 gb|EPE93968.1| aminotransferase [Rhizobium grahamii CCGE 502]
Length=463

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         PL++E+ EG YVYDI+GK+Y++S AGLW  A+G +EPRLV+AA KQ
Sbjct  20   LHPYTNARLHETKGPLIMERGEGIYVYDISGKQYIESFAGLWSVAIGFSEPRLVEAATKQ  79

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLD  567
            +  LPFYH+F + + +P++ LA++L++
Sbjct  80   MQKLPFYHTFNHISHEPNIRLAEKLVE  106



>ref|WP_036254762.1| MULTISPECIES: aminotransferase [Mesorhizobium]
Length=460

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +1

Query  340  DLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFW  519
            ++ P +I + EG +VYD +G ++++ ++G+W   LG +E RL DAAM+Q N LPFYH+FW
Sbjct  30   EVGPTIIVRGEGVFVYDNDGNRFIEGMSGMWSAGLGFSEKRLADAAMRQYNILPFYHTFW  89

Query  520  NRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +R+T P++DLA++L++      M+KAF
Sbjct  90   HRSTPPTIDLAEKLIE-MAPVPMSKAF  115



>ref|WP_020680029.1| hypothetical protein [Marinobacterium rhizophilum]
Length=459

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P +IE+ EG Y+ D +GK+Y++ ++GLWCT+LG +EPRLV+AA +QLNTLPF  +F +R+
Sbjct  31   PSIIERGEGVYIVDDSGKRYIEGVSGLWCTSLGFSEPRLVEAATRQLNTLPFCQNFAHRS  90

Query  529  TKPSLDLAKELLD  567
            ++P+++LA++L++
Sbjct  91   SQPAIELAEKLIE  103



>ref|WP_029742660.1| aminotransferase [Ensifer sp. JGI 0001011-A08]
Length=461

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LIHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QL T+PFYHSF +++T+P + LA++LL+      M+K F
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVF  113



>ref|WP_008069788.1| aminotransferase [Pseudomonas sp. GM79]
 gb|EJN25472.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Pseudomonas 
sp. GM79]
Length=460

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      ++ PLVIE+ EG YVYD  GK+Y+++++GLW  ALG N  RL+ AA KQ
Sbjct  17   LHPYTDARMHEEIGPLVIERGEGIYVYDDQGKQYIEAMSGLWSAALGFNNERLIKAAEKQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L TLPFYH+F ++T   S+ LA EL+       M+K F
Sbjct  77   LRTLPFYHTFNHKTHASSVLLADELI-RLAPVPMSKVF  113



>ref|WP_031360219.1| aminotransferase [Burkholderia sordidicola]
Length=458

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      ++ P+VI++ EG YVYD  G +Y++ L GL+C +LG +E RL DAA +Q
Sbjct  16   LHPYTNLSAHREVGPMVIDRGEGVYVYDTEGNRYIEGLGGLFCASLGFSESRLADAADRQ  75

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F +++++PS+ LA++L+D      M+K F
Sbjct  76   MRKLPFYHAFGHKSSEPSIRLAEKLID-MAPVPMSKVF  112



>ref|WP_013962061.1| aminotransferase [Roseobacter litoralis]
 gb|AEI94137.1| aminotransferase class III [Roseobacter litoralis Och 149]
Length=454

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P+VI++ EG YV+D  GK+Y++ +AGLW  A+G NE RL+DAA  QL  LP+YHSF +++
Sbjct  31   PMVIDRGEGVYVFDTQGKRYIEGMAGLWSVAVGFNESRLIDAAQNQLRKLPYYHSFSHKS  90

Query  529  TKPSLDLAKELLD  567
              P++DLA+ L+D
Sbjct  91   HGPAIDLAERLID  103



>ref|WP_020336055.1| hypothetical protein [Vibrio natriegens]
 gb|EPM38839.1| hypothetical protein M272_20730 [Vibrio natriegens NBRC 15636 
= ATCC 14048 = DSM 759]
Length=461

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +1

Query  340  DLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFW  519
            ++ P++IE+ EG +VYD +GKKYL+ ++G+WC+ LG +E RL +AA KQ + LPFYH+F 
Sbjct  30   EVGPILIERGEGVFVYDNHGKKYLEGMSGMWCSGLGFSEKRLGEAAKKQYDILPFYHTFV  89

Query  520  NRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +R+T P+++LA +L++      M+KAF
Sbjct  90   HRSTGPTIELAAKLVE-MAPVPMSKAF  115



>ref|WP_017227445.1| hypothetical protein [Cupriavidus basilensis]
Length=459

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            P VI + EG YVYD  GK+YL+ +AGLWC +LG +E RLVDAA KQL TLPFYH F +R+
Sbjct  30   PTVITRGEGCYVYDEAGKRYLEGMAGLWCASLGFSEARLVDAATKQLQTLPFYHLFNHRS  89

Query  529  TKPSLDLAKEL  561
              P ++LA+ L
Sbjct  90   HPPGIELARHL  100



>ref|WP_038761742.1| aminotransferase [Burkholderia pseudomallei]
Length=459

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query  316  FTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNT  495
            +T   Q     PLVI++ EG YV+D  G++Y++++AGLW  A+G NEPRLV AA +Q+  
Sbjct  24   YTDAAQNVKTGPLVIDRGEGVYVFDNQGRRYIEAMAGLWSAAVGFNEPRLVRAATRQMEK  83

Query  496  LPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LPFYH+F +++  P +DLA++L+ +     M+K F
Sbjct  84   LPFYHTFSHKSHGPLVDLAEKLV-SMAPVPMSKVF  117



>gb|AHY51042.1| hypothetical protein BJS_03890 [Bradyrhizobium japonicum SEMIA 
5079]
Length=448

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  19   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  78

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  79   HGPSIDLAEKLV-ALAPVPMSKVF  101



>ref|WP_033067194.1| aminotransferase [Thalassospira australica]
Length=456

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P +I   +G YV D  G K ++ +AGLWC +LG +E RLVDAA KQ
Sbjct  19   LHPYTNHAAHEKTGPHIITGGDGIYVTDDQGHKLIEGMAGLWCASLGFSEKRLVDAATKQ  78

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            LNTLP+YH+F +R+T P++DLA++LL+   A  M+K F
Sbjct  79   LNTLPYYHTFASRSTNPAIDLAEKLLEIVPA-PMSKVF  115



>ref|WP_038957353.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_038937402.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
Length=451

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>gb|KGJ67633.1| putative aminotransferase [Bradyrhizobium diazoefficiens SEMIA 
5080]
Length=449

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  19   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  78

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  79   NGPSIALAEKLVK-MSPVPMSKVF  101



>ref|WP_014495749.1| aminotransferase [Bradyrhizobium japonicum]
 dbj|BAL10930.1| aminotransferase [Bradyrhizobium japonicum USDA 6]
 gb|AJA63651.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>gb|AHY56964.1| aminotransferase [Bradyrhizobium japonicum SEMIA 5079]
Length=449

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  19   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  78

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  79   NGPSIALAEKLVK-MSPVPMSKVF  101



>ref|WP_039149393.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_014498006.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
 dbj|BAL13379.1| aminotransferase protein [Bradyrhizobium japonicum USDA 6]
 gb|KGT73032.1| aminotransferase [Bradyrhizobium japonicum]
 gb|AJA65680.1| aminotransferase [Bradyrhizobium japonicum]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>ref|WP_028147775.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVTMSKVF  113



>ref|WP_035681626.1| aminotransferase [Bradyrhizobium liaoningense]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>ref|WP_035668747.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>ref|WP_042133140.1| aminotransferase [Pseudomonas oryzihabitans]
Length=458

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      D  P++IE+ EG +VYD  GK+Y+++++GLW  ALG N  RL+DAA  Q
Sbjct  17   LHPYTNARLHQDTGPMIIERGEGVHVYDTQGKQYIEAMSGLWSVALGFNNQRLIDAATAQ  76

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L  LPFYH F ++   PS++LA++L++      M+K F
Sbjct  77   LQQLPFYHLFSHKAHAPSIELAEKLIE-IAPVPMSKVF  113



>ref|WP_034802113.1| aminotransferase [Ensifer adhaerens]
Length=451

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  477
              ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA
Sbjct  4    QSLVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAA  63

Query  478  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             +QL T+PFYHSF +++T+P + LA++LL+      M+K F
Sbjct  64   TRQLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVF  103



>ref|WP_028157521.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ+  LPFYH+F  ++
Sbjct  31   PLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQMLALPFYHTFSAKS  90

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+DLA++L+       M+K F
Sbjct  91   HGPSIDLAEKLV-ALAPVPMSKVF  113



>ref|WP_035716738.1| aminotransferase [Bradyrhizobium sp. CCBAU 43298]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>ref|WP_038945793.1| aminotransferase [Bradyrhizobium japonicum]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>ref|WP_028144457.1| aminotransferase [Bradyrhizobium japonicum]
Length=463

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  33   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  92

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  93   NGPSIALAEKLVK-MSPVPMSKVF  115



>ref|WP_011084499.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
 ref|NP_768326.1| aminotransferase [Bradyrhizobium diazoefficiens USDA 110]
 dbj|BAC46951.1| blr1686 [Bradyrhizobium diazoefficiens USDA 110]
Length=463

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  33   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  92

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  93   NGPSIALAEKLVK-MSPVPMSKVF  115



>ref|WP_038376943.1| aminotransferase [Bradyrhizobium elkanii]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>gb|KDP71648.1| aminotransferase [Ensifer adhaerens]
Length=461

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            QL T+PFYHSF +++T+P + LA++LL+      M+K F
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVF  113



>ref|WP_035633702.1| aminotransferase [Bradyrhizobium elkanii]
Length=459

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  349  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  528
            PL+IE+ EG YV+D  GK+YLD++AGLW   LG +E RL++AA +Q+  LPFYH+F +R+
Sbjct  29   PLIIERGEGPYVFDTAGKRYLDAMAGLWSAGLGFSEKRLIEAAHRQMQILPFYHTFASRS  88

Query  529  TKPSLDLAKELLDTFTAXKMAKAF  600
              PS+ LA++L+   +   M+K F
Sbjct  89   NGPSIALAEKLVK-MSPVPMSKVF  111



>emb|CCF21345.1| Uncharacterized aminotransferase y4uB [Rhizobium sp.]
Length=452

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  352  LVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTT  531
            LVI++ EG YVYD NGK+Y+++++GLW  A+G  E RLVDAA++Q++ LP+YH+F  RT 
Sbjct  32   LVIDRGEGVYVYDNNGKRYIEAMSGLWSVAVGFGEQRLVDAAVRQMSILPYYHTFTGRTH  91

Query  532  KPSLDLAKELL  564
             PS+DLA++L+
Sbjct  92   GPSVDLAEKLI  102



>ref|WP_018898134.1| hypothetical protein [Rhizobium sp. 2MFCol3.1]
Length=457

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +1

Query  304  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  483
            +L P+T         PLVIE+ EG +VYD  GK+Y+++LAGLW  A+G +EPRLVDAA +
Sbjct  17   VLHPYTNARAHEKSGPLVIERGEGIHVYDTAGKQYIEALAGLWSVAVGFDEPRLVDAAAR  76

Query  484  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            Q+  LP+YH F ++  +PS+ LA++L++  T   + + F
Sbjct  77   QMAKLPYYHIFSHKAHEPSVRLAEKLVE-MTPANLTRVF  114



>gb|ETF04525.1| aminotransferase [Advenella kashmirensis W13003]
Length=457

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +1

Query  256  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  435
            S+     D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  5    SISQQGNDDIAFHMH----PYTNAITHATQGPLVIVRGDGIYVEDENGKKYIEAMAGLWS  60

Query  436  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
             A+G +E RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K F
Sbjct  61   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVF  114



>ref|WP_037990023.1| aminotransferase [Thalassospira permensis]
Length=460

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  22   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  81

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L TLP+YH+F +R+T P++DLA++LL+      M+K F
Sbjct  82   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVF  118



>ref|WP_035541932.1| aminotransferase [Burkholderia sp. UYPR1.413]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T      ++ P+VIE+ EG YVYD  GK+YL+ L GL+C +LG +E RL DAA  Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGKRYLEGLGGLFCASLGFSEHRLADAADGQ  72

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +  LPFYH+F +++++PS+ LA++L+ +     M+K F
Sbjct  73   MRKLPFYHAFGHKSSEPSIRLAEKLI-SIAPVPMSKVF  109



>ref|WP_040060658.1| aminotransferase [Thalassospira xiamenensis]
Length=460

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  22   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  81

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L TLP+YH+F +R+T P++DLA++LL+      M+K F
Sbjct  82   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVF  118



>gb|KEO56896.1| aminotransferase [Thalassospira permensis NBRC 106175]
Length=466

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  28   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  87

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L TLP+YH+F +R+T P++DLA++LL+      M+K F
Sbjct  88   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVF  124



>ref|WP_022709596.1| aminotransferase [Pseudochrobactrum sp. AO18b]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +1

Query  262  QNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  441
            Q +S + +  + H  L  +T   +  ++ P+++EK +G YV D NGK+Y++ LAGLW   
Sbjct  4    QPNSPEARDIQYH--LHSYTNARRHQEIGPMILEKGDGIYVEDNNGKRYIEGLAGLWSVG  61

Query  442  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            +G +E RLVDAA KQ+  LP+YH+F +++  P +DLA++L+ T     M+KAF
Sbjct  62   VGFSEQRLVDAATKQMQKLPYYHNFGHKSHGPVIDLAEKLV-TMAPVPMSKAF  113



>gb|AJD51480.1| aminotransferase [Thalassospira xiamenensis M-5 = DSM 17429]
Length=466

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = +1

Query  307  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  486
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  28   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  87

Query  487  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTAXKMAKAF  600
            L TLP+YH+F +R+T P++DLA++LL+      M+K F
Sbjct  88   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVF  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940