BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS163B05

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849  80.9    5e-14   Nicotiana sylvestris
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193  74.3    6e-12   Nicotiana tomentosiformis
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214  67.4    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509  66.6    2e-09   Solanum lycopersicum
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174  66.2    3e-09   Solanum lycopersicum
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695  66.2    3e-09   Populus euphratica
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g           65.9    4e-09   
ref|XP_006378261.1|  hypothetical protein POPTR_0010s060502g          64.7    4e-09   
gb|KDP26703.1|  hypothetical protein JCGZ_17861                       63.5    2e-08   Jatropha curcas
gb|ADN32812.1|  sieve element occlusion c                             63.2    3e-08   Solanum phureja [chaucha]
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329  63.2    3e-08   Solanum tuberosum [potatoes]
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg           62.8    4e-08   Citrus clementina [clementine]
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551  62.4    4e-08   Citrus sinensis [apfelsine]
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                 62.0    6e-08   Citrus sinensis [apfelsine]
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...  61.6    9e-08   Solanum lycopersicum
gb|ADN32811.1|  sieve element occlusion b                             59.3    4e-07   Solanum phureja [chaucha]
emb|CAN65891.1|  hypothetical protein VITISV_041167                   58.5    9e-07   Vitis vinifera
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366  58.2    1e-06   Vitis vinifera
emb|CBI14908.3|  unnamed protein product                              58.2    1e-06   Vitis vinifera
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310  56.6    3e-06   Populus euphratica
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...  56.2    4e-06   Solanum lycopersicum
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g           55.8    6e-06   Phaseolus vulgaris [French bean]
gb|KJB75974.1|  hypothetical protein B456_012G066300                  55.5    8e-06   Gossypium raimondii
gb|KHN29013.1|  hypothetical protein glysoja_008348                   55.1    1e-05   Glycine soja [wild soybean]
ref|NP_001240968.1|  uncharacterized protein LOC100799626             55.1    1e-05   Glycine max [soybeans]
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g           54.3    2e-05   
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g           54.3    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g           54.3    2e-05   
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...  53.9    2e-05   Populus euphratica
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...  53.9    2e-05   Populus euphratica
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g           53.9    3e-05   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g           53.5    3e-05   
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652  53.5    3e-05   Populus euphratica
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991  53.5    3e-05   Populus euphratica
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161  53.1    5e-05   Populus euphratica
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g           52.8    6e-05   
gb|KHG12713.1|  hypothetical protein F383_04328                       53.1    6e-05   Gossypium arboreum [tree cotton]
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666  52.8    6e-05   Populus euphratica
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845  52.8    7e-05   Vitis vinifera
emb|CBI34821.3|  unnamed protein product                              52.8    8e-05   Vitis vinifera
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g           52.4    8e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007031665.1|  Uncharacterized protein TCM_017020               52.4    9e-05   
ref|XP_002526966.1|  conserved hypothetical protein                   52.4    1e-04   
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152  51.6    1e-04   Populus euphratica
emb|CAN62582.1|  hypothetical protein VITISV_034667                   51.6    2e-04   Vitis vinifera
emb|CBI34823.3|  unnamed protein product                              51.6    2e-04   Vitis vinifera
ref|XP_002526964.1|  conserved hypothetical protein                   51.6    2e-04   Ricinus communis
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392  51.2    2e-04   Vitis vinifera
gb|KJB75975.1|  hypothetical protein B456_012G066400                  51.2    2e-04   Gossypium raimondii
ref|XP_002515051.1|  conserved hypothetical protein                   50.4    4e-04   
ref|XP_011013170.1|  PREDICTED: uncharacterized protein LOC105117262  50.1    5e-04   Populus euphratica
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294  50.1    5e-04   Vitis vinifera
emb|CDP13257.1|  unnamed protein product                              50.1    6e-04   Coffea canephora [robusta coffee]
ref|XP_010248720.1|  PREDICTED: uncharacterized protein LOC104591548  50.1    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002526965.1|  conserved hypothetical protein                   49.7    7e-04   
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167  49.7    7e-04   Vitis vinifera
ref|XP_002282172.1|  PREDICTED: uncharacterized protein LOC100261038  49.3    9e-04   Vitis vinifera
ref|XP_002526959.1|  conserved hypothetical protein                   49.3    0.001   Ricinus communis
emb|CAN83922.1|  hypothetical protein VITISV_026532                   49.3    0.001   Vitis vinifera



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  502
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  82   INPRTTNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRAP  140

Query  503  AAIPGHVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
            AAIPGH+     Q A L+A LEEKV HSGLSE++  LA
Sbjct  141  AAIPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEILNYLA  176



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  502
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  76   INPRTPNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRA-  133

Query  503  AAIPGHVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
             AIPGH+     Q A L+A LEEKV HSGLSE++  LA
Sbjct  134  PAIPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEILNYLA  169



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  368  RGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQ  541
            RGD  L +SS+DTTM++ +RATH  D     V+PL H+IEDI  RA   IPG  Q    +
Sbjct  14   RGDRHLFSSSDDTTMLNQLRATHAPDGRDIDVRPLFHIIEDIFHRAAPTIPGSNQG--AE  71

Query  542  PARLDAILEEKVLHSGLSEVVEALA  616
            P  LDA L++K L +G  +++E LA
Sbjct  72   P-HLDA-LDDKTLQAGYGDLIELLA  94



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +2

Query  356  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  529
            L +RRGD  +  +S+D TMM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  86   LPHRRGDHRMFLASDDNTMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  144

Query  530  ILTQPARLDAILEEKVLHSGLSEVVEALA  616
               Q A L A L+EK  HSGL+E++  LA
Sbjct  145  AKVQ-AHLQA-LDEKAPHSGLTEILYYLA  171



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +2

Query  356  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  529
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  93   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  151

Query  530  ILTQPARLDAILEEKVLHSGLSEVVEALA  616
               Q A L+A LEEK  HSGL++++  LA
Sbjct  152  AKVQ-AHLEA-LEEKAPHSGLTDILNYLA  178



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  538
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  539  QPARLDAILEEKVLHSGLSEVVEALA  616
              A+LD  LEEK L +G  E +E L+
Sbjct  70   HQAQLDE-LEEKALQNGFHETIEMLS  94



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  538
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFPVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  539  QPARLDAILEEKVLHSGLSEVVEALA  616
              A+LD  LEEK L +G  E +E L+
Sbjct  70   HQAQLDE-LEEKALQNGFHETIEMLS  94



>ref|XP_006378261.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
 gb|ERP56058.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
Length=340

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  538
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  13   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  72

Query  539  QPARLDAILEEKVLHSGLSEVVEALA  616
              A+LD  LEEK L +G  E +E L+
Sbjct  73   HQAQLDE-LEEKALQNGFHETIEMLS  97



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 8/84 (10%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL----TQP  544
            + +SS+D TMM  ++ATH  D   + VKPLLH++EDI  RA    P  + T++       
Sbjct  15   MFSSSDDNTMMKQIQATHAPDGREFAVKPLLHVVEDIFQRAK---PTGLATLVHHQGAHQ  71

Query  545  ARLDAILEEKVLHSGLSEVVEALA  616
            A+LDA LEEK L +G  E++E L+
Sbjct  72   AQLDA-LEEKALQNGFYEMLEVLS  94



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +2

Query  362  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V    
Sbjct  118  HRRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAK  176

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
             Q A L+A LEEK  HSGL+E++  LA
Sbjct  177  VQ-AHLEA-LEEKAPHSGLTEILNYLA  201



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +2

Query  362  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V    
Sbjct  111  HRRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAK  169

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
             Q A L+A LEEK  HSGL+E++  LA
Sbjct  170  VQ-AHLEA-LEEKAPHSGLTEILNYLA  194



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 56/92 (61%), Gaps = 9/92 (10%)
 Frame = +2

Query  341  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  520
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  521  VQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
            +Q   TQ A+LD +L++K   SG  ++++ L+
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGFFDMLDLLS  94



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 56/92 (61%), Gaps = 9/92 (10%)
 Frame = +2

Query  341  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  520
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  521  VQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
            +Q   TQ A+LD +L++K   SG  ++++ L+
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGFFDMLDLLS  94



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  544
            R   + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG +Q   TQ 
Sbjct  15   RERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGFIQE--TQ-  71

Query  545  ARLDAILEEKVLHSGLSEVVEALA  616
            A+LD +L++K   SG  ++++ L+
Sbjct  72   AQLD-VLDDKAFQSGFFDMLDLLS  94



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +2

Query  356  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  529
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  87   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  145

Query  530  ILTQPARLDAILEEKVLHSGLSEVVEALA  616
               Q A L+A LEEK  H+ L E++  LA
Sbjct  146  AKVQ-AHLEA-LEEKAPHNELIEILNYLA  172



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +2

Query  365  RRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILT  538
            RRGD  +  +S+D  MM H+  TH  D   + VKPL+ +IEDI+ RA   I G V     
Sbjct  123  RRGDHHMFLTSDDNAMMRHIEETHIPDGRDFDVKPLVDIIEDIVHRA-TPIAGRVHEAKV  181

Query  539  QPARLDAILEEKVLHSGLSEVVEALA  616
            Q A L+A LEEK  HSGL+E++  LA
Sbjct  182  Q-AHLEA-LEEKAPHSGLTELLNYLA  205



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPXHLE  81

Query  557  AILEEKVLHSGLSEVVEALA  616
            A LE++    GL  ++E LA
Sbjct  82   A-LEDRSSQDGLXGILEELA  100



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  557  AILEEKVLHSGLSEVVEALA  616
            A LE++    GL  ++E LA
Sbjct  82   A-LEDRSSQDGLHGILEELA  100



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  557  AILEEKVLHSGLSEVVEALA  616
            A LE++    GL  ++E LA
Sbjct  82   A-LEDRSSQDGLHGILEELA  100



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA--IPGHVQTILT  538
            R   + A+S++  MM  ++ATH  D   + VK LLH++EDI  R  +A  I   VQ   +
Sbjct  10   RERTVFAASDENVMMKQIQATHAPDGREFSVKLLLHIVEDIFHRTTSAPGITDFVQHQGS  69

Query  539  QPARLDAILEEKVLHSGLSEVVEALA  616
              A+L   LEEKVL +G +E+++ L+
Sbjct  70   HQAQLYE-LEEKVLQNGFNEMIDMLS  94



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
            +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV     Q A L+
Sbjct  1    MFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRAT-PIAGHVHEAKVQ-AHLE  58

Query  557  AILEEKVLHSGLSEVVEALA  616
            A LEEK  H+ L E++  LA
Sbjct  59   A-LEEKAPHNELIEILNYLA  77



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +2

Query  374  DLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARL  553
            ++ ++S+DTTM  +VRATH  D  H +V+PLL++++DI+ R  + IP  VQ    +P + 
Sbjct  15   NIFSASDDTTMTKNVRATHAPDDRHVEVRPLLNVVQDILHRVASLIPDIVQ---GKPVQT  71

Query  554  DAILEEKVLHSGLSEVVE  607
             A+ E+    S L+EV++
Sbjct  72   GAV-EDSNHQSDLAEVLD  88



>gb|KJB75974.1| hypothetical protein B456_012G066300 [Gossypium raimondii]
Length=807

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +R+ RG +L+ S+D  MM  + ATH  D   + V+PLL+L+EDI+ RA+     HV  ++
Sbjct  102  IRSDRGSMLSLSDDNVMMKQILATHAPDGREFDVRPLLNLVEDILNRASQ----HVDFLV  157

Query  536  TQPARLDAILEEKVLHSGLSEVVEAL  613
                +    +EEK L +    ++EAL
Sbjct  158  KGTTQAQIEMEEKALQANHIVMLEAL  183



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ    +  ++D
Sbjct  9    IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ---GKQVQMD  65

Query  557  AILEEKVLHSGLSEVVE  607
            A +++    S L+ V++
Sbjct  66   A-MKDSAYQSDLANVID  81



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ    +  ++D
Sbjct  16   IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ---GKQVQMD  72

Query  557  AILEEKVLHSGLSEVVE  607
            A +++    S L+ V++
Sbjct  73   A-MKDSAYQSDLANVID  88



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 3/86 (3%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  544
            R   + A+S++  MM  ++ATH  D   + VK LL ++EDI  RA  A PG    +  Q 
Sbjct  10   RERTVFAASDENVMMKQIQATHAPDGREFSVKLLLQIVEDIFHRATPA-PGITDFVQHQG  68

Query  545  ARLDAI--LEEKVLHSGLSEVVEALA  616
            +    +  LEEKVL +G +E+++ L+
Sbjct  69   SHQAQLYELEEKVLQNGFNEMIDMLS  94



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM+ +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMNQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A +E+K  H     +++AL+
Sbjct  79   ---SKAHAEMEDKTYHVNFVSMLDALS  102



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGTMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDALS  102



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQ  80

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
             Q     A +E+K  H     +++AL+
Sbjct  81   AQ-----AEMEDKTYHVNFVSMLDALS  102



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            ++  RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKGDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A LE+K        +++AL+
Sbjct  79   ---SQAHAELEDKTHQINFVSMLDALS  102



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  365  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI  511
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+
Sbjct  9    RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRAAPAL  57



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 5/86 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +R  RG +L+ S+D  MM+ + ATH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  143  IRGDRGSMLSMSDDNVMMNQILATHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  202

Query  536  TQPARLDAILEEKVLHSGLSEVVEAL  613
             Q       LEE+   +    ++EAL
Sbjct  203  DQVE-----LEERAQAANHIAMLEAL  223



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTS-  79

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
              PA ++   E+K  H     +++AL+
Sbjct  80   QAPAEME---EDKTYHVNFVSMLDALS  103



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +2

Query  335  PIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIP  514
            PI   + ++  R  ++  S+D  MM  + ATH  D     V+PL  L+EDI+   N + P
Sbjct  3    PISLQQMIKGDR-SMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDIL---NRSTP  58

Query  515  GHVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
            G    + T   R++  LE++  H+G   ++EAL+
Sbjct  59   GVDAIVTTTETRVEP-LEDRTQHAGFIAMIEALS  91



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +2

Query  335  PIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIP  514
            PI   + ++  R  ++  S+D  MM  + ATH  D     V+PL  L+EDI+   N + P
Sbjct  848  PISLQQMIKGDR-SMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDIL---NRSTP  903

Query  515  GHVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
            G    + T   R++  LE++  H+G   ++EAL+
Sbjct  904  GVDAIVTTTETRVEP-LEDRTQHAGFIAMIEALS  936


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  78   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  136

Query  509  I  511
            +
Sbjct  137  V  137



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  20   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTT--  77

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
               ++  A +E+K  H     +++AL+
Sbjct  78   ---SQAHAEMEDKTSHVNFVSMLDALS  101



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 5/86 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +R+ RG +L+ S+D  MM  +  TH  D     V+PLL+L+EDI+ RA   +   V+  L
Sbjct  110  IRSDRGSMLSMSDDNVMMKQIMTTHAPDGREVDVRPLLYLVEDILNRATQHVDFLVKGTL  169

Query  536  TQPARLDAILEEKVLHSGLSEVVEAL  613
             Q       LEEK   +    ++EAL
Sbjct  170  AQIE-----LEEKAQQANYIAMLEAL  190



>ref|XP_002526966.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35453.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 3/85 (4%)
 Frame = +2

Query  368  RGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQ  541
            +GD  L +SS++  M   ++ATH  D   + VKPLL+++E+I  RA   I          
Sbjct  97   KGDRLLFSSSDENAMTKQIQATHSPDGREFDVKPLLNIVENIFDRAAPTIESLALPAAAH  156

Query  542  PARLDAILEEKVLHSGLSEVVEALA  616
             AR DA L++K  HS    ++E+L+
Sbjct  157  QARPDA-LDDKTYHSSFMAMLESLS  180



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSL-TNS  79

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
              PA ++   E+K  H     +++AL+
Sbjct  80   QAPAEME---EDKTYHVNFVSMLDALS  103



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  509  I  511
            +
Sbjct  114  V  114



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  509  I  511
            +
Sbjct  114  V  114



>ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35451.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  377  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  556
            L +SS+D  M   ++ATH  D   + VKPLL+++EDI  RA  AI           AR +
Sbjct  115  LFSSSDDNAMTKQIQATHSPDGREFDVKPLLNIVEDIFDRAAPAIESLALPAAAHHARNE  174

Query  557  AILEEKVLHSGLSEVVEALA  616
            A L++   HS +  ++E+L+
Sbjct  175  A-LDDNTYHSSVMAMLESLS  193



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  509  I  511
            +
Sbjct  114  V  114



>gb|KJB75975.1| hypothetical protein B456_012G066400 [Gossypium raimondii]
Length=865

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 5/86 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +R  RG +L+ S+D  MM+ +  TH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  161  IRGDRGSMLSMSDDNVMMNQILTTHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  220

Query  536  TQPARLDAILEEKVLHSGLSEVVEAL  613
             Q       LEE+   +    ++EAL
Sbjct  221  DQVE-----LEERAQAANHIAMLEAL  241



>ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47605.1| conserved hypothetical protein [Ricinus communis]
Length=701

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 12/87 (14%)
 Frame = +2

Query  362  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            N RG+  + ++S+D  MM  ++ATH  D   + V+PLL+++ED+  R   A+P      +
Sbjct  9    NPRGERHMFSTSDDNAMMKQIQATHAPDGREFDVRPLLNVVEDVFQR---AVPPSGLATI  65

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
             QP       +EK L +G  E+++ L+
Sbjct  66   VQP-------QEKTLQNGFYEMLDLLS  85



>ref|XP_011013170.1| PREDICTED: uncharacterized protein LOC105117262 [Populus euphratica]
Length=722

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 5/87 (6%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLAEDILKRATLQIDSSLTTSQ  80

Query  536  TQPARLDAILEEKVLHSGLSEVVEALA  616
             Q     A +++K  H     +++AL+
Sbjct  81   AQ-----AEMKDKTYHVNFVSMLDALS  102



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  41   INPVPLQKLIKHDR-SMITMSDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  99

Query  509  I  511
            +
Sbjct  100  V  100



>emb|CDP13257.1| unnamed protein product [Coffea canephora]
Length=812

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 17/101 (17%)
 Frame = +2

Query  332  NPIPAGR---YLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  502
            N  PAGR    +R R   L +SS+D  MM  + A H  D   + VK L+ ++EDIM RA 
Sbjct  110  NQPPAGRSGHLMRERH--LFSSSDDNAMMKQILAAHAPDGREFDVKTLVFIVEDIMRRA-  166

Query  503  AAIPGHVQTILTQPARLDA---ILEEKVLHSGLSEVVEALA  616
                    T L + A+  A     E++ +H G ++++E LA
Sbjct  167  --------TFLGEGAQSQAPADTWEDRAIHGGYTDMLELLA  199



>ref|XP_010248720.1| PREDICTED: uncharacterized protein LOC104591548 [Nelumbo nucifera]
Length=700

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  535
            +R  R  + ++S+D+ MM  + ATH  D     VKPL+ LI DI   +    P  V  ++
Sbjct  1    MRGDRNIMFSTSDDSAMMKQILATHAHDGREIDVKPLIQLIGDIFQTSPPTAPTAVDGVI  60

Query  536  TQPARLDAI--LEEKVLHSGLSEVVEALA  616
               A    I  L +K  H G   V+EA+A
Sbjct  61   VPAAETHPIDALVDKTQHLGFVGVMEAVA  89



>ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35452.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +2

Query  368  RGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQ  541
            +GD  L +SS++  M   ++ATH  D   + VKPLL+++EDI  RA   I          
Sbjct  113  KGDRLLFSSSDENAMTKQIQATHSPDGREFDVKPLLNIVEDIFERAAPTIESLALPAAGH  172

Query  542  PARLDAILEEKVLHSGLSEVVEALA  616
             AR + +L++K+ HS    ++E+L+
Sbjct  173  QARPE-VLDDKIYHSSSMAMLESLS  196



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  329  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  508
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  32   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  90

Query  509  I  511
            +
Sbjct  91   V  91



>ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera]
 emb|CBI16823.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANA------AIPG  517
            +R R GD + +S+D  +M  + A H  D   + VKPLL ++E+I+ R  +      A+PG
Sbjct  13   VRQRSGDRMFASDDNGIMKQIHAIHVPDGRDFDVKPLLRIVENILLRTTSSTTLTPALPG  72

Query  518  HVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
                + +  A+LDA LE+K L  G S +++ LA
Sbjct  73   --IPLGSNQAQLDA-LEDKTLQDGSSNMIDLLA  102



>ref|XP_002526959.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35446.1| conserved hypothetical protein [Ricinus communis]
Length=718

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +2

Query  344  AGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHV  523
            A + +R+ R  + A S++ +MM  ++ATH  D   + V+PLL+++ DI+ RAN  IP H 
Sbjct  15   AQQLIRSDRS-MFALSDENSMMKQIQATHAPDGREFDVRPLLNIVADILSRAN--IP-HA  70

Query  524  QTILTQPARLDAILEEKVLHSGLSEVVEALA  616
             T LT  ++  A +E+K   +    ++EALA
Sbjct  71   DTALT-ASQTHAEMEDKNRQANFIAMLEALA  100



>emb|CAN83922.1| hypothetical protein VITISV_026532 [Vitis vinifera]
Length=714

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +2

Query  356  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANA------AIPG  517
            +R R GD + +S+D  +M  + A H  D   + VKPLL ++E+I+ R  +      A+PG
Sbjct  13   VRQRSGDRMFASDDNGIMKQIHAIHVPDGRDFDVKPLLRIVENILLRTTSSTTLTPALPG  72

Query  518  HVQTILTQPARLDAILEEKVLHSGLSEVVEALA  616
                + +  A+LDA LE+K L  G S +++ LA
Sbjct  73   --IPLGSNQAQLDA-LEDKTLQDGSSNMIDLLA  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520