BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS161G06

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABP01597.1|  heat shock protein 70                                   347   3e-117   Ageratina adenophora
gb|AAP42157.1|AF509339_1  heat shock protein 70                         348   7e-116   Saussurea medusa
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     343   4e-115   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAX07349.1|  heat shock protein 70                                   344   4e-115   Zea mays [maize]
gb|AFU34347.1|  70-kDa heat shock protein                               353   6e-115   Ipomoea batatas [batate]
dbj|BAA34919.1|  heat shock protein 70 cognate                          344   2e-114   Salix gilgiana
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   340   2e-114   Citrus sinensis [apfelsine]
gb|ACJ11741.1|  heat shock protein 70                                   351   3e-114   Gossypium hirsutum [American cotton]
gb|AAB65162.1|  heat shock cognate protein                              341   3e-114   Solanum commersonii
ref|XP_009913284.1|  PREDICTED: probable mediator of RNA polymera...    347   3e-114   Haliaeetus albicilla
ref|XP_002527736.1|  heat shock protein, putative                       350   5e-114   Ricinus communis
gb|KJB16979.1|  hypothetical protein B456_002G258500                    350   6e-114   Gossypium raimondii
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   7e-114   
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             350   9e-114   Phaseolus vulgaris [French bean]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         350   9e-114   Jatropha curcas
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   1e-113   Populus euphratica
gb|KJB20110.1|  hypothetical protein B456_003G133400                    349   1e-113   Gossypium raimondii
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   1e-113   Solanum tuberosum [potatoes]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   1e-113   Nicotiana tomentosiformis
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             349   1e-113   Citrus clementina [clementine]
emb|CDP09040.1|  unnamed protein product                                349   1e-113   Coffea canephora [robusta coffee]
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   1e-113   Prunus mume [ume]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     349   1e-113   
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    346   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             349   2e-113   Prunus persica
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       349   2e-113   Cucurbita maxima [Boston marrow]
ref|XP_002532297.1|  heat shock protein, putative                       349   2e-113   Ricinus communis
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    348   2e-113   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   2e-113   
gb|KJB46580.1|  hypothetical protein B456_007G375600                    348   2e-113   Gossypium raimondii
gb|AAR17080.1|  heat shock protein 70-3                                 348   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          348   2e-113   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   2e-113   Nicotiana tomentosiformis
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   2e-113   Solanum lycopersicum
gb|ADD71975.1|  heat shock protein 70                                   348   2e-113   Rhododendron calophytum
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   3e-113   Nicotiana sylvestris
gb|AAM48131.1|AF509336_1  heat shock protein 70                         348   3e-113   Saussurea medusa
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   3e-113   Solanum tuberosum [potatoes]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   3e-113   Cucumis melo [Oriental melon]
gb|ACJ11740.1|  heat shock protein 70                                   348   3e-113   Gossypium hirsutum [American cotton]
emb|CAB72130.1|  heat shock protein 70                                  348   3e-113   Cucumis sativus [cucumbers]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   3e-113   Nicotiana tomentosiformis
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    348   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_002311161.1|  heat shock protein 70                              348   3e-113   Populus trichocarpa [western balsam poplar]
gb|ABX76301.1|  heat shock protein 70                                   348   3e-113   Ageratina adenophora
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   4e-113   Nelumbo nucifera [Indian lotus]
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       346   4e-113   Glycine soja [wild soybean]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       348   4e-113   Glycine soja [wild soybean]
gb|ACJ11745.1|  heat shock protein 70                                   348   4e-113   Gossypium hirsutum [American cotton]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   4e-113   Nicotiana sylvestris
dbj|BAP90755.1|  heat shock protein 70                                  348   4e-113   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           348   4e-113   Cucurbita maxima [Boston marrow]
gb|AIU34470.1|  putative heat shock protein                             348   4e-113   Taraxacum brevicorniculatum
gb|KJB73858.1|  hypothetical protein B456_011G256600                    348   4e-113   Gossypium raimondii
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   5e-113   Eucalyptus grandis [rose gum]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   5e-113   Sesamum indicum [beniseed]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   5e-113   Nelumbo nucifera [Indian lotus]
gb|AEO13403.1|  heat shock 70                                           345   5e-113   Glycine max [soybeans]
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   5e-113   Pyrus x bretschneideri [bai li]
gb|AEX55235.1|  heat shock protein 70                                   338   5e-113   Allium sativum
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     347   5e-113   Glycine max [soybeans]
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     347   6e-113   Vigna radiata [mung bean]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   6e-113   Cicer arietinum [garbanzo]
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             347   6e-113   Phaseolus vulgaris [French bean]
gb|AIA22210.1|  heat shock protein 70                                   347   7e-113   Chrysanthemum indicum
tpg|DAA55190.1|  TPA: heat shock protein70-4                            343   7e-113   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   7e-113   Nicotiana tomentosiformis
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   7e-113   Nicotiana sylvestris
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    343   7e-113   Populus euphratica
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         347   8e-113   Jatropha curcas
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       347   8e-113   Medicago truncatula
gb|AAA62445.1|  heat shock protein                                      347   9e-113   Spinacia oleracea
gb|AAV97978.1|  heat shock protein hsp70                                347   9e-113   Saussurea medusa
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             347   9e-113   Citrus clementina [clementine]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       345   9e-113   Medicago truncatula
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    347   9e-113   
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    347   9e-113   Solanum lycopersicum
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    347   9e-113   Fragaria vesca subsp. vesca
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   1e-112   Nelumbo nucifera [Indian lotus]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         347   1e-112   Spinacia oleracea
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   1e-112   Glycine max [soybeans]
gb|ACM42161.1|  heat shock protein 70.58                                347   1e-112   Ageratina adenophora
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   1e-112   Nicotiana tomentosiformis
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   1e-112   
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    345   1e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             346   1e-112   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             347   1e-112   Citrus clementina [clementine]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    347   1e-112   Prunus mume [ume]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   1e-112   Glycine max [soybeans]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   1e-112   Sesamum indicum [beniseed]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        346   2e-112   Solanum lycopersicum
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     346   2e-112   Vitis vinifera
gb|ACD93209.1|  heat shock protein 70                                   347   2e-112   Camellia sinensis [black tea]
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   2e-112   Nicotiana sylvestris
ref|WP_039310754.1|  molecular chaperone DnaK                           346   2e-112   Paenibacillus sp. IHB B 3415
gb|ACJ11742.1|  heat shock protein 70                                   346   2e-112   Gossypium hirsutum [American cotton]
gb|AIZ68155.1|  heat shock protein 70                                   346   2e-112   Ornithogalum longebracteatum [sea-onion]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                346   3e-112   Erythranthe guttata [common monkey flower]
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          345   3e-112   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ46371.1|  HSP70                                                   346   3e-112   Malus hupehensis
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   3e-112   Fragaria vesca subsp. vesca
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   4e-112   
ref|XP_003621869.1|  Heat shock protein                                 345   4e-112   Medicago truncatula
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   4e-112   Cicer arietinum [garbanzo]
gb|ACJ85522.1|  unknown                                                 345   4e-112   Medicago truncatula
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       345   4e-112   Medicago truncatula
gb|AAV98051.1|  heat shock protein 70                                   345   4e-112   Medicago sativa [alfalfa]
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          345   4e-112   Sorghum bicolor [broomcorn]
ref|XP_003621886.1|  Heat shock protein                                 345   4e-112   Medicago truncatula
ref|NP_001068540.1|  Os11g0703900                                       345   4e-112   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   4e-112   Oryza brachyantha
gb|AAP04522.1|  heat shock protein 70                                   345   5e-112   Nicotiana tabacum [American tobacco]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   5e-112   Populus euphratica
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   5e-112   Tarenaya hassleriana [spider flower]
ref|XP_007009369.1|  Heat shock protein 70                              345   5e-112   
dbj|BAJ91305.1|  predicted protein                                      345   5e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     345   6e-112   Triticum urartu
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   Brachypodium distachyon [annual false brome]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   Vitis vinifera
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   Vitis vinifera
ref|XP_002316294.1|  heat shock protein 70                              345   6e-112   Populus trichocarpa [western balsam poplar]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   Prunus mume [ume]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   6e-112   
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   7e-112   Eucalyptus grandis [rose gum]
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     345   7e-112   
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        345   7e-112   Morus notabilis
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         343   8e-112   Jatropha curcas
ref|XP_002528432.1|  heat shock protein, putative                       344   8e-112   Ricinus communis
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    344   8e-112   Populus euphratica
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    344   8e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             344   9e-112   Prunus persica
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     344   9e-112   Glycine soja [wild soybean]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    344   1e-111   Elaeis guineensis
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    345   1e-111   
ref|XP_006378714.1|  heat shock protein 70 cognate                      344   1e-111   Populus trichocarpa [western balsam poplar]
emb|CDP00073.1|  unnamed protein product                                344   1e-111   Coffea canephora [robusta coffee]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                344   1e-111   Erythranthe guttata [common monkey flower]
gb|AGL07711.1|  heat shock protein 70                                   344   1e-111   Ziziphus jujuba [Chinese jujube]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    344   1e-111   Populus euphratica
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     344   1e-111   
ref|XP_002312089.1|  heat shock protein 70 cognate                      344   1e-111   
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         344   2e-111   Jatropha curcas
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   2e-111   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     343   2e-111   Elaeis guineensis
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    336   2e-111   Eucalyptus grandis [rose gum]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   2e-111   Solanum lycopersicum
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   2e-111   Populus euphratica
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    343   2e-111   
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          343   2e-111   Amborella trichopoda
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   3e-111   Sesamum indicum [beniseed]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    343   3e-111   Zea mays [maize]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   3e-111   Glycine max [soybeans]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     343   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   3e-111   Phoenix dactylifera
ref|XP_002312090.1|  heat shock protein 70 cognate                      343   3e-111   Populus trichocarpa [western balsam poplar]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     343   3e-111   Glycine soja [wild soybean]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             343   3e-111   Phaseolus vulgaris [French bean]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    343   3e-111   Setaria italica
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    343   3e-111   
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   3e-111   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   3e-111   Phoenix dactylifera
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    343   4e-111   
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     345   4e-111   Eucalyptus grandis [rose gum]
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       340   4e-111   Gossypium arboreum [tree cotton]
gb|ABD32895.1|  Heat shock protein Hsp70                                343   4e-111   Medicago truncatula
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   5e-111   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA47948.2|  heat shock protein 70                                  342   5e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   5e-111   Oryza brachyantha
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     345   5e-111   Eucalyptus grandis [rose gum]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    342   6e-111   Gossypium raimondii
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    342   7e-111   
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             340   7e-111   
ref|NP_001051724.1|  Os03g0821100                                       342   8e-111   
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     342   8e-111   Vigna radiata [mung bean]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    342   9e-111   Glycine max [soybeans]
ref|NP_001044757.1|  Os01g0840100                                       342   9e-111   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   1e-110   Setaria italica
gb|EPS60056.1|  heat shock protein 70                                   342   1e-110   Genlisea aurea
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     342   1e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB36734.1|  hypothetical protein B456_006G174000                    342   1e-110   Gossypium raimondii
gb|ACB70177.1|  70 kDa heat shock protein                               342   1e-110   Capparis spinosa [caper]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             342   1e-110   Phaseolus vulgaris [French bean]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    342   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    342   1e-110   Tarenaya hassleriana [spider flower]
emb|CDY52661.1|  BnaC01g38510D                                          342   1e-110   Brassica napus [oilseed rape]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     342   1e-110   Vigna radiata [mung bean]
gb|AII99890.1|  heat shock protein                                      347   1e-110   Cicer arietinum [garbanzo]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             341   1e-110   Phaseolus vulgaris [French bean]
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-110   
gb|ABP35942.1|  heat shock protein 70                                   341   1e-110   Cyclamen persicum
gb|ACR38891.1|  heat shock protein 70                                   341   1e-110   Apopellia endiviifolia (species B)
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    342   1e-110   Brassica rapa
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   1e-110   Solanum tuberosum [potatoes]
emb|CDY50531.1|  BnaA01g30490D                                          341   1e-110   Brassica napus [oilseed rape]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     344   1e-110   Triticum urartu
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   1e-110   Phoenix dactylifera
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             341   2e-110   Eutrema salsugineum [saltwater cress]
emb|CDX73815.1|  BnaA03g32320D                                          341   2e-110   
emb|CDY00784.1|  BnaC03g37680D                                          341   2e-110   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             341   2e-110   Selaginella moellendorffii
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             341   2e-110   Selaginella moellendorffii
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    341   2e-110   Brassica rapa
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             341   2e-110   Citrus clementina [clementine]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   2e-110   Populus euphratica
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   2e-110   Solanum tuberosum [potatoes]
ref|NP_187864.1|  heat shock protein 70-4                               341   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             341   2e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    341   2e-110   Phoenix dactylifera
emb|CAA05547.1|  heat shock protein 70                                  341   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     341   3e-110   Phoenix dactylifera
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             341   3e-110   Capsella rubella
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    340   3e-110   Camelina sativa [gold-of-pleasure]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                340   3e-110   Erythranthe guttata [common monkey flower]
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    340   3e-110   Spinacia oleracea
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       338   3e-110   Phytolacca acinosa [food pokeberry]
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           333   3e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       340   3e-110   Glycine soja [wild soybean]
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     343   3e-110   Triticum urartu
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   4e-110   Cucumis sativus [cucumbers]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    340   4e-110   Setaria italica
gb|AGR45355.1|  HSP70                                                   340   4e-110   Dendrobium officinale
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   4e-110   Elaeis guineensis
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    340   4e-110   Camelina sativa [gold-of-pleasure]
gb|AAB42159.1|  Hsc70                                                   340   4e-110   Solanum lycopersicum
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    340   4e-110   Camelina sativa [gold-of-pleasure]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    340   5e-110   Solanum lycopersicum
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    340   5e-110   Solanum lycopersicum
gb|AEK70336.1|  heat shock protein 70                                   340   5e-110   Paeonia lactiflora [common garden peony]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    340   5e-110   Tarenaya hassleriana [spider flower]
ref|NP_001055754.1|  Os05g0460000                                       340   5e-110   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             340   5e-110   Populus trichocarpa [western balsam poplar]
ref|XP_001783048.1|  predicted protein                                  340   6e-110   
gb|AEO22185.1|  CytHSP70                                                337   6e-110   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    340   6e-110   Pyrus x bretschneideri [bai li]
gb|AHW48175.1|  heat shock protein 70                                   336   6e-110   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             340   6e-110   Eutrema salsugineum [saltwater cress]
dbj|BAJ34054.1|  unnamed protein product                                340   6e-110   Eutrema halophilum
gb|AFA51946.1|  heat shock protein 70                                   340   6e-110   Paeonia suffruticosa [moutan peony]
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        340   7e-110   Morus notabilis
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   7e-110   Solanum tuberosum [potatoes]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   7e-110   Citrus sinensis [apfelsine]
emb|CAB72129.1|  heat shock protein 70                                  340   7e-110   Cucumis sativus [cucumbers]
ref|XP_003625487.1|  Heat shock protein                                 341   8e-110   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    339   8e-110   Brachypodium distachyon [annual false brome]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    339   8e-110   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                339   8e-110   Erythranthe guttata [common monkey flower]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    339   9e-110   Cucumis melo [Oriental melon]
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   9e-110   
dbj|BAK00257.1|  predicted protein                                      339   9e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    339   1e-109   Tarenaya hassleriana [spider flower]
ref|XP_001751923.1|  predicted protein                                  339   1e-109   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          339   1e-109   Sorghum bicolor [broomcorn]
ref|XP_001767839.1|  predicted protein                                  339   1e-109   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    339   1e-109   Arabis alpina [alpine rockcress]
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             339   1e-109   Selaginella moellendorffii
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       339   1e-109   Cucurbita maxima [Boston marrow]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    341   1e-109   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    348   1e-109   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    339   1e-109   Fragaria vesca subsp. vesca
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    338   2e-109   Phoenix dactylifera
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       338   2e-109   Cucumis melo [Oriental melon]
ref|NP_001049712.1|  Os03g0276500                                       338   3e-109   
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    328   3e-109   Camelina sativa [gold-of-pleasure]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     338   3e-109   Triticum urartu
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    338   3e-109   Camelina sativa [gold-of-pleasure]
gb|AAB99745.1|  HSP70                                                   338   3e-109   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    338   3e-109   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    338   3e-109   Fragaria vesca subsp. vesca
emb|CAA54419.1|  heat shock cognate 70-1                                337   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  338   4e-109   Morus notabilis
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             338   4e-109   Capsella rubella
ref|XP_002873056.1|  HSC70-1                                            338   4e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    338   4e-109   Camelina sativa [gold-of-pleasure]
ref|NP_195870.1|  heat shock cognate protein 70-1                       338   4e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    338   4e-109   Tarenaya hassleriana [spider flower]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             338   4e-109   Eutrema salsugineum [saltwater cress]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    338   4e-109   
emb|CAA52684.1|  heat shock protein 70 cognate                          337   4e-109   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    337   4e-109   
ref|NP_187555.1|  heat shock protein 70-3                               337   5e-109   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    337   6e-109   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       337   6e-109   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    337   7e-109   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                337   9e-109   
emb|CAA83548.1|  PsHSC71.0                                              337   9e-109   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    337   1e-108   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     337   1e-108   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    337   1e-108   
dbj|BAJ86014.1|  predicted protein                                      336   1e-108   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             336   1e-108   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       336   2e-108   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             335   2e-108   
emb|CDP09035.1|  unnamed protein product                                336   2e-108   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        336   2e-108   
tpg|DAA44672.1|  TPA: hsp70 protein                                     333   2e-108   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    336   2e-108   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    336   2e-108   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          335   3e-108   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             335   4e-108   
gb|EPS68565.1|  hypothetical protein M569_06198                         335   4e-108   
ref|XP_001785822.1|  predicted protein                                  335   4e-108   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             335   5e-108   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    349   5e-108   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       336   5e-108   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    335   6e-108   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        334   6e-108   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    334   7e-108   
ref|XP_001759874.1|  predicted protein                                  334   8e-108   
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    334   1e-107   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     334   1e-107   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    333   1e-107   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    333   1e-107   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    333   1e-107   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       333   1e-107   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       333   2e-107   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    333   2e-107   
ref|NP_195869.1|  heat shock protein 70                                 333   2e-107   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    333   2e-107   
ref|XP_002873055.1|  predicted protein                                  333   2e-107   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    333   2e-107   
emb|CCA29120.1|  heat shock protein 70 isoform 1                        333   3e-107   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    333   3e-107   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    333   3e-107   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                332   4e-107   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    332   4e-107   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    332   5e-107   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                332   5e-107   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     345   7e-107   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    332   7e-107   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    332   7e-107   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     334   1e-106   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    331   1e-106   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    331   1e-106   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    331   1e-106   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          331   1e-106   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       331   2e-106   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               331   2e-106   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    329   2e-106   
gb|EPS64948.1|  hypothetical protein M569_09829                         330   3e-106   
gb|AAB88009.1|  heat shock cognate protein HSC70                        330   3e-106   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    330   3e-106   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                330   4e-106   
ref|NP_001049719.2|  Os03g0277300                                       322   5e-106   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          329   7e-106   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       329   7e-106   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               327   8e-106   
dbj|BAK02194.1|  predicted protein                                      328   2e-105   
ref|XP_002502667.1|  heat shock 70 kDa protein                          328   2e-105   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    328   3e-105   
gb|KHN17505.1|  Heat shock 70 kDa protein                               323   4e-105   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       326   5e-105   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       327   5e-105   
gb|AIU40169.1|  heat shock protein 70                                   327   7e-105   
gb|ABR18415.1|  unknown                                                 327   7e-105   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    333   9e-105   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          326   1e-104   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       326   1e-104   
ref|XP_005643450.1|  heat shock protein 70                              326   1e-104   
gb|EAY81899.1|  hypothetical protein OsI_37065                          319   1e-104   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    326   2e-104   
gb|ACD45076.1|  heat-shock protein 70                                   326   2e-104   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       325   3e-104   
ref|XP_003064239.1|  heat shock protein 70kDa                           325   3e-104   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   4e-104   
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   325   4e-104   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          322   8e-104   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         324   9e-104   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    323   1e-103   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    327   2e-103   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    323   2e-103   
gb|ACJ54890.1|  heat shock protein 70                                   323   2e-103   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    323   2e-103   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          323   2e-103   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   323   2e-103   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   3e-103   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          323   3e-103   
gb|ACU17965.1|  unknown                                                 308   5e-103   
emb|CEG00633.1|  Heat shock protein 70 family                           322   5e-103   
ref|XP_003083987.1|  putative hsp70 (ISS)                               322   5e-103   
gb|KHN14134.1|  Heat shock 70 kDa protein                               322   6e-103   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          322   7e-103   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    322   8e-103   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               321   8e-103   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               322   8e-103   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        321   9e-103   
gb|EAY89450.1|  hypothetical protein OsI_10982                          315   1e-102   
ref|XP_003610287.1|  Heat-shock protein                                 321   1e-102   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    320   1e-102   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             321   1e-102   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             321   1e-102   
gb|ABK25453.1|  unknown                                                 320   2e-102   
ref|XP_002512742.1|  heat shock protein, putative                       320   2e-102   
gb|EEC76425.1|  hypothetical protein OsI_14101                          313   2e-102   
gb|AAA82975.1|  PsHSP71.2                                               320   2e-102   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          320   3e-102   
gb|ACC93947.1|  heat-shock protein 70                                   320   3e-102   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               320   3e-102   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          320   3e-102   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             320   3e-102   
emb|CAA27330.1|  heat shock protein 70                                  318   3e-102   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    319   5e-102   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  319   6e-102   
ref|XP_007023492.1|  Heat shock protein 70B                             319   6e-102   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             319   6e-102   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          319   6e-102   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               319   6e-102   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             319   6e-102   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          318   1e-101   
gb|EEC71767.1|  hypothetical protein OsI_04375                          311   1e-101   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          318   1e-101   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               318   1e-101   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               318   1e-101   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    305   1e-101   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          318   2e-101   
prf||1205208A  heat shock protein hsp70                                 317   3e-101
ref|XP_001767221.1|  predicted protein                                  317   3e-101   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        317   3e-101   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               317   3e-101   
ref|XP_006368489.1|  heat shock protein 70 cognate                      317   4e-101   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    317   4e-101   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    317   4e-101   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          317   5e-101   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               317   6e-101   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    317   7e-101   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          317   7e-101   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    316   7e-101   
ref|XP_001701326.1|  heat shock protein 70A                             316   8e-101   
emb|CDX83960.1|  BnaC08g16850D                                          316   9e-101   
ref|XP_001781229.1|  predicted protein                                  316   9e-101   
ref|NP_173055.1|  heat shock protein 70B                                316   1e-100   
emb|CAA44820.1|  heat shock protein 70                                  313   1e-100   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          316   1e-100   
emb|CCJ09763.1|  putative heat shock protein-70kDa                      302   1e-100   
emb|CDY33359.1|  BnaC05g12240D                                          311   2e-100   
emb|CDY35063.1|  BnaA06g10730D                                          311   3e-100   
ref|XP_007013854.1|  Heat shock protein 70B                             314   4e-100   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        314   4e-100   
emb|CDX96825.1|  BnaA08g23680D                                          314   4e-100   
gb|EPS69582.1|  heat shock protein hsp70                                313   5e-100   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          314   5e-100   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          314   5e-100   
ref|XP_002512741.1|  heat shock protein, putative                       314   5e-100   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               314   5e-100   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          314   6e-100   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     317   6e-100   
ref|XP_002947129.1|  heat-shock inducible Hsp70                         314   7e-100   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               314   7e-100   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                313   8e-100   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               313   1e-99    
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               313   1e-99    
ref|XP_010091163.1|  Heat shock 70 kDa protein                          313   2e-99    
gb|ACH61066.1|  heat shock protein 70 kDa                               299   2e-99    
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          313   2e-99    
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       313   2e-99    
gb|AGT97046.1|  heat shock protein 70                                   312   2e-99    
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          312   2e-99    
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    311   3e-99    
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     312   3e-99    
emb|CDP02832.1|  unnamed protein product                                312   4e-99    
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             312   4e-99    
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          311   4e-99    
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          311   6e-99    
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         311   6e-99    
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        311   6e-99    
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             311   6e-99    
gb|AAS09825.1|  heat shock cognate protein 70                           311   6e-99    
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        311   8e-99    
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          311   8e-99    
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             311   8e-99    
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    311   8e-99    
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             310   1e-98    
sp|P25840.2|HSP70_CHLRE  RecName: Full=Heat shock 70 kDa protein        310   1e-98    
dbj|BAJ34597.1|  unnamed protein product                                310   1e-98    
gb|ACH61090.1|  heat shock protein 70 kDa                               296   1e-98    
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          310   1e-98    
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          310   2e-98    
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             310   2e-98    
ref|XP_002892893.1|  HSP70B                                             310   2e-98    
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                310   2e-98    
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    309   4e-98    
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         308   1e-97    
dbj|BAE48223.1|  heat shock protein 70                                  308   1e-97    
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    308   1e-97    
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             307   2e-97    
emb|CDO98244.1|  unnamed protein product                                307   4e-97    
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    306   4e-97    
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          306   5e-97    
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        293   8e-97    
emb|CAD12247.1|  heat shock protein 70                                  294   1e-96    
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          305   1e-96    
gb|ACX42438.1|  70 kDa heat shock protein                               305   1e-96    
gb|EAY89457.1|  hypothetical protein OsI_10990                          298   1e-96    
gb|ABR01232.1|  heat shock protein 70                                   305   2e-96    
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     303   4e-96    
emb|CDY04364.1|  BnaC04g18290D                                          292   4e-96    
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          303   7e-96    
dbj|BAA04848.1|  HSP70                                                  303   8e-96    



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   347 bits (890),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  33   VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  92

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  93   QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  152

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  153  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  212

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  213  DEKIGEKLT  221



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   348 bits (892),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  161  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  220

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  221  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  280

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  281  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  340

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  341  DEKIGEKLT  349



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  69   VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  128

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  129  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  188

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  189  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  248

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  249  DDKIASKL  256



>gb|AAX07349.1| heat shock protein 70 [Zea mays]
Length=373

 Score =   344 bits (882),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  105  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  164

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  165  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  224

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENYAYNMRNT+K
Sbjct  225  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRNTIK  284

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  285  DEKIASKLA  293



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 189/189 (100%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  141  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  200

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  201  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  260

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENYAYNMRNTVK
Sbjct  261  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVK  320

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  321  DEKISSKL  328



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  62   VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  121

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  122  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  181

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENYAYNMRNT+K
Sbjct  182  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIK  241

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  242  DEKISAKL  249



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  71   VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  130

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  131  QPGVLIQVYEGERPRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  190

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  191  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIK  250

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  251  DDKISSKL  258



>ref|XP_009913284.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Haliaeetus albicilla]
Length=520

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  332  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  391

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  392  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  451

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  452  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  511

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  512  DEKIGAKL  519



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   350 bits (898),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  276  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  335

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  336  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  395

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKN+LENYAYNMRNT+K
Sbjct  396  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIK  455

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  456  DDKISSKLS  464



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   350 bits (897),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGGKL  568



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   350 bits (897),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLN  569



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDV PLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLA  569



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVR  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLN  569



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  276  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  335

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  336  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  395

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  396  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  455

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  456  DEKIASKL  463



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVR  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLN  569



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTV 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVN  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKISSKL  568



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTV 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVN  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIG+KL+
Sbjct  561  DEKIGAKLT  569



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HK+KVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTV 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVN  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSSGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTV 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVN  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMV+EAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVEEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLN  569



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSSGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KL+
Sbjct  561  DEKIGAKLA  569



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  318  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  377

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  378  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  437

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNT+K
Sbjct  438  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIK  497

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  498  DEKIGGKL  505



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  378  VQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  437

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  438  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  497

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  498  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  557

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  558  DDKIASKLS  566



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTV 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVN  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI +KLS
Sbjct  561  DEKISAKLS  569



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KL+
Sbjct  561  DEKIGAKLA  569



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  292  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  351

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  352  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  411

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN LENYAYNMRNT+K
Sbjct  412  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRNTIK  471

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  472  DDKIASKLS  480



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDEDHKKKVEAKNALENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTVR  560

Query  543  DEKIGSKLS  569
            DEKIGSKL+
Sbjct  561  DEKIGSKLN  569



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score =   338 bits (868),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  100  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  159

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  160  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  219

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KN LENYAYNMRNT+K
Sbjct  220  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNTLENYAYNMRNTIK  279

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  280  DDKIASKLS  288



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   347 bits (891),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGGKL  568



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   347 bits (891),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   347 bits (891),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKISSKLS  569



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAED+T
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDRT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  253  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  312

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  313  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  372

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKN+LENY+YNMRNT+K
Sbjct  373  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRNTIK  432

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  433  DEKIASKL  440



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   343 bits (880),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  248  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  307

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  308  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  367

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENYAYNMRNTVK
Sbjct  368  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVK  427

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  428  DEKISSKL  435



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   347 bits (890),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKISSKLA  569



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   347 bits (890),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC+DIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCYDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLT  569



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  310  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  369

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  370  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  429

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HK+KVEAKNALENYAYNMRNT+K
Sbjct  430  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRNTIK  489

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  490  DDKIASKLS  498



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   347 bits (889),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANG LNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGTLNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGEKL  568



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  352  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  411

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  412  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  471

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KNALENYAYNMRNTV+
Sbjct  472  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNALENYAYNMRNTVR  531

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  532  DEKIASKLA  540



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SK+S
Sbjct  561  DEKISSKIS  569



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEGKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIG KLS
Sbjct  561  DEKIGEKLS  569



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKISSKLS  569



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  334  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  393

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  394  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  453

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  454  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  513

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  514  DEKIASKL  521



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  369  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  428

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  429  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  488

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  489  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  548

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  549  DEKIGAKL  556



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D++IGSKLS
Sbjct  561  DDQIGSKLS  569



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  318  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  377

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  378  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  437

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  438  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  497

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  498  DEKIASKLS  506



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKI ITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKIPITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGEKL  568



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPP+PRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPSPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGEKL  568



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKIASKLA  569



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFD+DANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDLDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  364  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  423

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  424  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  483

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  484  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  543

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  544  DEKIASKL  551



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTT+PTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTVPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SK+
Sbjct  561  DDKIASKI  568



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTT+PTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTVPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HK+KVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKRKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKIASKLA  569



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTR NNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRANNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK EAKN+LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKAEAKNSLENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGN+KVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFST+SDN
Sbjct  381  VQAAILSGEGNDKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTFSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  561  DEKISAKL  568



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGS+LS
Sbjct  561  DEKIGSQLS  569



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI +KLS
Sbjct  561  DEKISAKLS  569



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDV+PLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVSPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   343 bits (881),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  6    QAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQ  185
            +AAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQ
Sbjct  351  KAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQ  410

Query  186  PGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTT  365
            PGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTT
Sbjct  411  PGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTT  470

Query  366  GQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVKD  545
            GQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+KD
Sbjct  471  GQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKD  530

Query  546  EKIGSKLS  569
            EKI SKL+
Sbjct  531  EKISSKLA  538



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK++AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGS+LS
Sbjct  561  DEKIGSQLS  569



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKIASKLA  569



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   344 bits (883),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   344 bits (883),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_007016452.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34071.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=677

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LEN+AYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNELENFAYNMRNTVR  560

Query  543  DEKIGSKLS  569
            DEKIG+KL+
Sbjct  561  DEKIGAKLN  569



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKISSKLA  569



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKISSKL  568



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPG LIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGALIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKISSKLA  569



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKIASKLA  569



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKISSKLA  569



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTT+PTKKE VFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTVPTKKEHVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  560  DDKIASKL  567



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLT  569



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTT+PTKKE VFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTVPTKKEHVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTT+PTKKEQVFSTYSDN
Sbjct  148  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTVPTKKEQVFSTYSDN  207

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  208  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  267

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  268  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  327

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  328  DEKISAKL  335



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKISSKLS  569



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVETKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  382  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  441

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  442  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  501

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEDHKKKVEAKNALENYAYNMRNT+K
Sbjct  502  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTIK  561

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  562  DEKIAAKL  569



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKK+VEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKRVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI +KL
Sbjct  561  DDKIAAKL  568



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKIASKLA  569



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKIASKLA  569



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+ 
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIN  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKIASKLA  569



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVE+KN+LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKISSKL  568



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKIASKLS  569



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKIASKLA  569



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  276  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  335

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  336  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  395

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENYAYNMRNTV+
Sbjct  396  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVR  455

Query  543  DEKIGSKL  566
            DEK  SKL
Sbjct  456  DEKFSSKL  463



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQ+AEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKN+LENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  474  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  533

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  534  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  593

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  594  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIK  653

Query  543  DEKIGSKLS  569
            DEKI +KLS
Sbjct  654  DEKISAKLS  662



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  301  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  360

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  361  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  420

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENYAYNMRNT+K
Sbjct  421  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNGLENYAYNMRNTIK  480

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  481  DEKISSKL  488



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI  KL
Sbjct  561  DEKIAGKL  568



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ AEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQGAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  559

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  560  DEKIASKL  567



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVE+KN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  474  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  533

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  534  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  593

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  594  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIK  653

Query  543  DEKIGSKLS  569
            DEKI +KLS
Sbjct  654  DEKISAKLS  662



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKINSKL  568



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKISSKL  568



>ref|XP_006407675.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49128.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=561

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  292  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  351

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  352  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  411

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT++
Sbjct  412  TGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIR  471

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  472  DEKIGEKLA  480



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   342 bits (877),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  382  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  441

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  442  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  501

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKV+AKN+LENYAYNMRNT++
Sbjct  502  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVDAKNSLENYAYNMRNTIQ  561

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  562  DEKIASKL  569



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   342 bits (877),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDV+PLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVSPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFD+DANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDMDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            D+KIG KL
Sbjct  561  DDKIGEKL  568



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   342 bits (876),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  560  DDKIASKLS  568



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  382  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  441

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  442  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  501

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQ+AEKYKSEDE+HKKKVEAKN+LENYAYNMRNT++
Sbjct  502  TGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIQ  561

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  562  DEKIASKL  569



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKN LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            D++I SKLS
Sbjct  561  DDQISSKLS  569



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKLS
Sbjct  561  DEKISSKLS  569



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIG  557
            DEKIG
Sbjct  561  DEKIG  565



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGGKL  568



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKIG+KL
Sbjct  561  DEKIGAKL  568



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  561  DEKIGEKL  568



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  500  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  559

Query  543  DEKIGSKL  566
            D+KIG KL
Sbjct  560  DDKIGGKL  567



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   347 bits (889),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  581  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  640

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  641  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  700

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKN+LENYAYNMRNT+K
Sbjct  701  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIK  760

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  761  DDKISSKLS  769



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDV+PLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVSPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFD+DANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDMDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKN+LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  346  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  405

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  406  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  465

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+HKKKVE+KNALENYAYNMRNT++
Sbjct  466  TGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRNTIR  525

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  526  DEKIGGKLA  534



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVY GERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYGGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKISSKL  568



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDEDH+KKVE+KN+LENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEDHQKKVESKNSLENYAYNMRNTVR  560

Query  543  DEKIGSKL  566
            DEKI S L
Sbjct  561  DEKIASSL  568



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+ KKKVEAKN+LENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            DEKIGSKLS
Sbjct  561  DEKIGSKLS  569



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  496  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  555

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  556  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  615

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENY+YNMRNT+K
Sbjct  616  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIK  675

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  676  DEKIASKL  683



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNV+AEDKT
Sbjct  440  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVTAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK+EAKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIEAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  560  DEKIAAKL  567



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_002976219.1| hypothetical protein SELMODRAFT_443120 [Selaginella moellendorffii]
 gb|EFJ22479.1| hypothetical protein SELMODRAFT_443120 [Selaginella moellendorffii]
Length=655

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  379  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  438

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  439  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  498

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMV EAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  499  TGQKNKITITNDKGRLSKDEIEKMVSEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  558

Query  543  DEKIGSKL  566
            D+KI  KL
Sbjct  559  DDKIAGKL  566



>ref|XP_002987127.1| hypothetical protein SELMODRAFT_446858 [Selaginella moellendorffii]
 gb|EFJ11703.1| hypothetical protein SELMODRAFT_446858 [Selaginella moellendorffii]
Length=655

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  379  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  438

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  439  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  498

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMV EAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  499  TGQKNKITITNDKGRLSKDEIEKMVSEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  558

Query  543  DEKIGSKL  566
            D+KI  KL
Sbjct  559  DDKIAGKL  566



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  561  DEKISAKL  568



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAIL+GEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILTGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDE+HKKKVEAKNALENY+YNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEEHKKKVEAKNALENYSYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKISSKLS  569



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT++
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIR  559

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  560  DEKIAAKL  567



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+HKKKVEAKN LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQ+FSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER+RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERSRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAE+YKSEDE+HKKKVE+KNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAERYKSEDEEHKKKVESKNALENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKIASKLA  569



>sp|P29357.3|HSP7E_SPIOL RecName: Full=Chloroplast envelope membrane 70 kDa heat shock-related 
protein [Spinacia oleracea]
 emb|CAA43711.1| 70 kDa heat shock protein [Spinacia oleracea]
Length=653

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPP PRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPGPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKI ITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRN VK
Sbjct  501  TGQKNKIRITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNIVK  560

Query  543  DEKIGSKLS  569
            DEKIG+KLS
Sbjct  561  DEKIGAKLS  569



>gb|ADN03965.1| heat shock cognate 70 kDa protein [Phytolacca acinosa]
Length=588

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  318  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  377

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  378  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  437

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIE+MVQEAE+YKSEDE+HKKKVEAKN LENYAYNMRNT+K
Sbjct  438  TGQKNKITITNDKGRLSKEEIERMVQEAERYKSEDEEHKKKVEAKNGLENYAYNMRNTIK  497

Query  543  DEKIGSKL  566
            D+KI +KL
Sbjct  498  DDKISAKL  505



>dbj|BAD94888.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
Length=404

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LI RNTTIPTKKEQVFSTYSDN
Sbjct  132  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTIPTKKEQVFSTYSDN  191

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  192  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  251

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TG+KNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT++
Sbjct  252  TGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIR  311

Query  543  DEKIGSKL  566
            DEKIG KL
Sbjct  312  DEKIGEKL  319



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            D+KIG KL
Sbjct  561  DDKIGEKL  568



>gb|EMS50129.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=736

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  469  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  528

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  529  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  588

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  589  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  648

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  649  DDKIASKLA  657



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+HKKKVE+KNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGGKLA  569



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  560  DDKIASKL  567



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFE SGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFEXSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KN LENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNTLENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  561  DEKIASKLA  569



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNV+AEDKT
Sbjct  440  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVTAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKK+EAKNALENYAYNMRNT++
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIEAKNALENYAYNMRNTIR  559

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  560  DEKIAAKL  567



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  561  DDKIASKL  568



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKITSKL  568



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKK E+KNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKAESKNALENYAYNMRNTIR  560

Query  543  DEKIGSKL  566
            D+KIG+KL
Sbjct  561  DDKIGAKL  568



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKVEAKNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIR  560

Query  543  DEKIGSKL  566
            DEKIGSKL
Sbjct  561  DEKIGSKL  568



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKLS  569
            DEKI SKL+
Sbjct  560  DEKIASKLA  568



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAIL+GEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILTGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKLS  569
            D+KI SKL+
Sbjct  561  DDKISSKLA  569



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDEDHKKK+EAKN+LENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEDHKKKIEAKNSLENYAYNMRNTIR  560

Query  543  DEKIGSKL  566
            D+KI + L
Sbjct  561  DDKIAANL  568



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   337 bits (863),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  270  VQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  329

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  330  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  389

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+HKKKV++KNALENYAYNMRNT+K
Sbjct  390  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRNTIK  449

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  450  DDKIASKL  457



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 181/196 (92%), Gaps = 8/196 (4%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDl--------llldvtplslglETAGGVMTVLIPRNTTIPTKKEQ  158
            VQAAILSGEGNEKVQDL               LSLGLETAGGVMTVLIPRNTTIPTKKEQ
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSXXXXXXLSLGLETAGGVMTVLIPRNTTIPTKKEQ  440

Query  159  VFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGIL  338
            VFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGIL
Sbjct  441  VFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGIL  500

Query  339  NVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYA  518
            NVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKKVE+KNALENYA
Sbjct  501  NVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYA  560

Query  519  YNMRNTVKDEKIGSKL  566
            YNMRNT+KDEKIG+KL
Sbjct  561  YNMRNTIKDEKIGAKL  576



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   336 bits (862),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  269  VQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  328

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  329  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  388

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+HKKKV++KNALENYAYNMRNT+K
Sbjct  389  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRNTIK  448

Query  543  DEKIGSKL  566
            D+KI SKL
Sbjct  449  DDKIASKL  456



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLA  569



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIR  560

Query  543  DEKIGSKLS  569
            DEKIG KL+
Sbjct  561  DEKIGEKLA  569



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTP SLGLETAGGVMTVLI RNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+HKKK E+KNALENYAYNMRNT++
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKAESKNALENYAYNMRNTIR  560

Query  543  DEKIGSKL  566
            D+KIG+KL
Sbjct  561  DDKIGAKL  568



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNTVK
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKLS  569
            D+KI SKLS
Sbjct  561  DDKIASKLS  569



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            V AAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VHAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI +KL
Sbjct  561  DEKISAKL  568



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVR  560

Query  543  DEKIGSKL  566
            DEK  SKL
Sbjct  561  DEKFSSKL  568



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   341 bits (875),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKKKVEAKNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI  KL
Sbjct  561  DEKIAGKL  568



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   339 bits (870),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct  380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN  439

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  499

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+HKKKV+AKNALENYAYNMRNT+K
Sbjct  500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK  559

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  560  DEKIASKL  567



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   339 bits (870),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVR  560

Query  543  DEKIGSKL  566
            DEK  SKL
Sbjct  561  DEKFSSKL  568



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   339 bits (870),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFD+DANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDLDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+HKKKVE+KNALENYAYNMRNT+K
Sbjct  501  TGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK  560

Query  543  DEKIGSKL  566
            DEKI SKL
Sbjct  561  DEKIASKL  568



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    VQAAILSGEGNEKVQDlllldvtplslglETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  182
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN
Sbjct  381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN  440

Query  183  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  362
            QPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct  441  QPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT  500

Query  363  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVK  542
            TGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+HKKKVEAKN+LENYAYNMRNTV+
Sbjct  501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVR  560

Query  543  DEKIGSKL  566
            DEK  SKL
Sbjct  561  DEKFSSKL  568



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515