BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS161E12

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             170   5e-46   
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    170   9e-46   Malus domestica [apple tree]
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    167   5e-45   Solanum tuberosum [potatoes]
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    167   6e-45   
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                167   6e-45   Erythranthe guttata [common monkey flower]
emb|CDP18254.1|  unnamed protein product                                167   7e-45   Coffea canephora [robusta coffee]
gb|KEH43106.1|  cyclin-like protein                                     167   9e-45   Medicago truncatula
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             167   9e-45   Prunus persica
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    166   1e-44   Prunus mume [ume]
gb|KHG26706.1|  Protein EFR3 B                                          167   1e-44   Gossypium arboreum [tree cotton]
gb|KHG26707.1|  Efr3b                                                   167   1e-44   Gossypium arboreum [tree cotton]
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    166   2e-44   Populus euphratica
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    165   4e-44   Nicotiana sylvestris
ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    165   4e-44   Nicotiana tomentosiformis
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    164   9e-44   Eucalyptus grandis [rose gum]
gb|KJB81105.1|  hypothetical protein B456_013G129500                    162   1e-43   Gossypium raimondii
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    163   1e-43   Fragaria vesca subsp. vesca
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    163   1e-43   Fragaria vesca subsp. vesca
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  163   2e-43   
gb|KHG02153.1|  Protein EFR3                                            163   3e-43   Gossypium arboreum [tree cotton]
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    162   3e-43   
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    162   3e-43   Glycine max [soybeans]
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    162   5e-43   
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    162   5e-43   
gb|KHN23227.1|  Protein EFR3 like cmp44E                                161   5e-43   Glycine soja [wild soybean]
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    162   6e-43   
gb|KDP23388.1|  hypothetical protein JCGZ_23221                         161   7e-43   Jatropha curcas
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    161   1e-42   Sesamum indicum [beniseed]
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             160   2e-42   Citrus clementina [clementine]
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    160   3e-42   Citrus sinensis [apfelsine]
emb|CAN82509.1|  hypothetical protein VITISV_012725                     160   3e-42   Vitis vinifera
gb|KJB45453.1|  hypothetical protein B456_007G306600                    159   5e-42   Gossypium raimondii
gb|AAB61061.1|  Hypothetical protein F2P16.24                           159   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  159   6e-42   
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    159   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    159   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    159   7e-42   Camelina sativa [gold-of-pleasure]
gb|EPS74671.1|  hypothetical protein M569_00084                         145   8e-42   Genlisea aurea
gb|KJB81106.1|  hypothetical protein B456_013G129500                    158   8e-42   Gossypium raimondii
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             158   9e-42   Eutrema salsugineum [saltwater cress]
gb|KJB81104.1|  hypothetical protein B456_013G129500                    158   9e-42   Gossypium raimondii
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             158   1e-41   
ref|NP_198037.3|  uncharacterized protein                               158   1e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41892.1|  unknown protein                                        158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             158   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             157   3e-41   Phaseolus vulgaris [French bean]
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  155   8e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002512512.1|  conserved hypothetical protein                     155   2e-40   
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    154   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    154   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    154   4e-40   Vitis vinifera
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             150   6e-39   Brassica rapa
emb|CDX87029.1|  BnaC09g03440D                                          150   7e-39   
gb|ABF95548.1|  cyclin, putative, expressed                             149   8e-39   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19753.1|  BnaA09g04060D                                          149   2e-38   Brassica napus [oilseed rape]
ref|XP_010094723.1|  hypothetical protein L484_003597                   146   2e-38   
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    149   3e-38   Setaria italica
ref|NP_001049903.1|  Os03g0308200                                       148   3e-38   
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    148   3e-38   Oryza brachyantha
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    147   5e-38   Cucumis melo [Oriental melon]
ref|XP_008778937.1|  PREDICTED: protein EFR3 homolog cmp44E-like        142   5e-38   
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          147   8e-38   Sorghum bicolor [broomcorn]
ref|XP_004165925.1|  PREDICTED: uncharacterized LOC101202927            147   9e-38   
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    147   1e-37   Cucumis sativus [cucumbers]
ref|XP_010092978.1|  hypothetical protein L484_018915                   147   1e-37   
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    147   1e-37   Phoenix dactylifera
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    147   1e-37   
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    145   3e-37   Elaeis guineensis
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    145   3e-37   Zea mays [maize]
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    145   3e-37   
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    145   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    145   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    143   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    143   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_006840435.1|  hypothetical protein AMTR_s00045p00164850          142   5e-36   Amborella trichopoda
ref|XP_009765963.1|  PREDICTED: protein EFR3 homolog cmp44E-like        134   7e-36   Nicotiana sylvestris
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    142   7e-36   Elaeis guineensis
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    142   7e-36   
ref|XP_008354962.1|  PREDICTED: protein EFR3 homolog A-like             126   4e-34   
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    136   4e-34   Phoenix dactylifera
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    136   4e-34   Phoenix dactylifera
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         135   1e-33   Nicotiana tomentosiformis
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         135   1e-33   
gb|EYU18743.1|  hypothetical protein MIMGU_mgv1a0012531mg               125   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_001767624.1|  predicted protein                                  133   4e-33   
ref|XP_006858684.1|  hypothetical protein AMTR_s00066p00085830          134   4e-33   Amborella trichopoda
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       133   9e-33   Solanum lycopersicum
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       132   1e-32   Nicotiana sylvestris
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       132   1e-32   Nicotiana sylvestris
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       132   1e-32   Nicotiana sylvestris
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       132   1e-32   Solanum lycopersicum
ref|XP_006838291.1|  hypothetical protein AMTR_s00103p00108190          132   1e-32   Amborella trichopoda
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    132   1e-32   Solanum tuberosum [potatoes]
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    132   1e-32   Solanum lycopersicum
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    132   1e-32   Solanum lycopersicum
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       132   1e-32   Nicotiana tomentosiformis
emb|CDX80597.1|  BnaC07g28470D                                          132   2e-32   
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       132   2e-32   Nicotiana tomentosiformis
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    132   2e-32   
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    132   2e-32   Solanum tuberosum [potatoes]
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    132   2e-32   Solanum tuberosum [potatoes]
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             132   2e-32   
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    132   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009626575.1|  PREDICTED: protein EFR3 homolog B-like             124   2e-32   Nicotiana tomentosiformis
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    132   2e-32   Prunus mume [ume]
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    132   2e-32   Phoenix dactylifera
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    132   2e-32   Phoenix dactylifera
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    132   2e-32   Fragaria vesca subsp. vesca
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         132   2e-32   
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    131   2e-32   
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    132   2e-32   Sesamum indicum [beniseed]
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       131   3e-32   Solanum lycopersicum
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       131   4e-32   Nicotiana sylvestris
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    131   4e-32   
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       131   4e-32   Nicotiana tomentosiformis
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       131   4e-32   Nicotiana tomentosiformis
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    131   4e-32   Brassica rapa
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       131   4e-32   Nicotiana tomentosiformis
emb|CDY09095.1|  BnaA02g05210D                                          130   5e-32   Brassica napus [oilseed rape]
ref|XP_004166917.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   6e-32   
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       130   8e-32   Cucumis sativus [cucumbers]
ref|XP_004136762.1|  PREDICTED: uncharacterized protein LOC101210251    130   8e-32   
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    130   8e-32   Vitis vinifera
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    130   9e-32   Camelina sativa [gold-of-pleasure]
emb|CDX88246.1|  BnaA06g28370D                                          130   1e-31   
gb|EPS68493.1|  hypothetical protein M569_06272                         130   1e-31   Genlisea aurea
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    130   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    130   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008355520.1|  PREDICTED: uncharacterized protein LOC103419180    120   1e-31   
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             130   1e-31   Capsella rubella
ref|NP_197607.5|  uncharacterized protein                               130   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    129   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097525.1|  hypothetical protein L484_024736                   121   1e-31   
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    129   1e-31   Sesamum indicum [beniseed]
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    129   1e-31   Sesamum indicum [beniseed]
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             129   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    129   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    129   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    129   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    129   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             129   2e-31   
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         129   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         129   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...    129   3e-31   Fragaria vesca subsp. vesca
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...    129   3e-31   Fragaria vesca subsp. vesca
ref|XP_006443048.1|  hypothetical protein CICLE_v100186802mg            121   3e-31   
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    129   3e-31   Nicotiana sylvestris
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    129   3e-31   Nicotiana sylvestris
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    128   3e-31   Cucumis melo [Oriental melon]
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             128   4e-31   
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    128   4e-31   Arabis alpina [alpine rockcress]
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    127   4e-31   
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    128   5e-31   Solanum tuberosum [potatoes]
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             128   5e-31   Solanum lycopersicum
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004              127   6e-31   
ref|XP_002529611.1|  conserved hypothetical protein                     127   6e-31   
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             127   7e-31   Prunus persica
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    127   7e-31   Brassica rapa
ref|XP_002322714.1|  cyclin-related family protein                      127   7e-31   
emb|CDY06190.1|  BnaA09g50130D                                          127   8e-31   
emb|CDY09999.1|  BnaC08g44520D                                          127   9e-31   Brassica napus [oilseed rape]
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    127   1e-30   Prunus mume [ume]
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    127   1e-30   Sesamum indicum [beniseed]
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    127   1e-30   Populus euphratica
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    127   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    127   1e-30   Populus euphratica
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    127   1e-30   Populus euphratica
ref|XP_003605757.1|  EFR3-like protein                                  127   1e-30   Medicago truncatula
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    126   2e-30   Phoenix dactylifera
gb|KDO53678.1|  hypothetical protein CISIN_1g0359231mg                  119   2e-30   Citrus sinensis [apfelsine]
ref|XP_002517810.1|  conserved hypothetical protein                     126   2e-30   
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    126   2e-30   Camelina sativa [gold-of-pleasure]
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                125   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             125   3e-30   
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    125   3e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH23652.1|  cyclin-like protein                                     125   3e-30   Medicago truncatula
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             125   4e-30   Capsella rubella
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     125   4e-30   Eucalyptus grandis [rose gum]
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    125   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    125   4e-30   Eucalyptus grandis [rose gum]
ref|XP_001770437.1|  predicted protein                                  125   4e-30   
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    125   4e-30   Vitis vinifera
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    125   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    125   5e-30   Vitis vinifera
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    125   5e-30   Eucalyptus grandis [rose gum]
emb|CDY63789.1|  BnaA08g31700D                                          125   5e-30   Brassica napus [oilseed rape]
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           124   5e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29857.3|  unnamed protein product                                125   5e-30   Vitis vinifera
ref|XP_002892313.1|  predicted protein                                  125   5e-30   
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             125   5e-30   
emb|CDX86545.1|  BnaC08g01580D                                          125   6e-30   
ref|NP_001154308.1|  ARM repeat superfamily protein                     125   6e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01387.1|  predicted protein                                      125   6e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             125   6e-30   
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                125   6e-30   Erythranthe guttata [common monkey flower]
emb|CDP18636.1|  unnamed protein product                                125   6e-30   Coffea canephora [robusta coffee]
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    125   6e-30   Camelina sativa [gold-of-pleasure]
ref|NP_563755.1|  ARM repeat superfamily protein                        125   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             124   7e-30   Capsella rubella
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    124   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    124   7e-30   Pyrus x bretschneideri [bai li]
gb|EPS68833.1|  hypothetical protein M569_05934                         123   7e-30   Genlisea aurea
ref|XP_002308951.2|  cyclin-related family protein                      124   7e-30   
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    124   7e-30   Populus euphratica
ref|XP_003591099.1|  EFR3-like protein                                  118   8e-30   
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    124   9e-30   Vitis vinifera
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    124   9e-30   Glycine max [soybeans]
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    124   1e-29   Citrus sinensis [apfelsine]
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   124   1e-29   Citrus sinensis [apfelsine]
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   124   1e-29   Citrus sinensis [apfelsine]
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   124   1e-29   Citrus sinensis [apfelsine]
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    124   1e-29   Fragaria vesca subsp. vesca
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203725    124   1e-29   Cucumis sativus [cucumbers]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           124   1e-29   
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           124   1e-29   
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  123   2e-29   
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    124   2e-29   Cucumis melo [Oriental melon]
emb|CBI24919.3|  unnamed protein product                                124   2e-29   Vitis vinifera
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    124   2e-29   Cucumis melo [Oriental melon]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             123   2e-29   
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    123   2e-29   
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    123   2e-29   Pyrus x bretschneideri [bai li]
gb|KJB46322.1|  hypothetical protein B456_007G360200                    123   2e-29   Gossypium raimondii
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    123   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         122   3e-29   Brassica rapa
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         122   3e-29   Brassica rapa
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    122   4e-29   Setaria italica
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    122   4e-29   Cicer arietinum [garbanzo]
gb|KHN33312.1|  Protein EFR3 like B                                     122   4e-29   Glycine soja [wild soybean]
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    122   4e-29   Cicer arietinum [garbanzo]
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  122   4e-29   
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    122   4e-29   Glycine max [soybeans]
gb|KJB71806.1|  hypothetical protein B456_011G143200                    122   4e-29   Gossypium raimondii
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    122   4e-29   
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    122   4e-29   Glycine max [soybeans]
gb|KHG08769.1|  Protein EFR3 B                                          122   5e-29   Gossypium arboreum [tree cotton]
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    122   5e-29   Citrus sinensis [apfelsine]
gb|EAY92960.1|  hypothetical protein OsI_14753                          117   7e-29   Oryza sativa Indica Group [Indian rice]
gb|KEH39475.1|  cyclin-like protein                                     121   8e-29   Medicago truncatula
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    122   8e-29   Elaeis guineensis
ref|XP_003597513.1|  EFR3-like protein                                  121   8e-29   
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             121   8e-29   
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    121   9e-29   Populus euphratica
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             121   9e-29   
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    121   9e-29   Glycine max [soybeans]
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             121   9e-29   Eutrema salsugineum [saltwater cress]
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    121   9e-29   Populus euphratica
gb|KJB71808.1|  hypothetical protein B456_011G143200                    121   1e-28   Gossypium raimondii
gb|KJB71809.1|  hypothetical protein B456_011G143200                    121   1e-28   Gossypium raimondii
gb|KJB71804.1|  hypothetical protein B456_011G143200                    121   1e-28   Gossypium raimondii
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       121   1e-28   Eucalyptus grandis [rose gum]
emb|CDY10165.1|  BnaC05g04080D                                          121   1e-28   Brassica napus [oilseed rape]
gb|EMS53000.1|  Protein EFR3-like protein B                             121   1e-28   Triticum urartu
gb|AFK33385.1|  unknown                                                 112   1e-28   Lotus japonicus
gb|KHG30683.1|  Protein EFR3 cmp44E                                     121   1e-28   Gossypium arboreum [tree cotton]
ref|NP_181714.3|  uncharacterized protein                               121   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     121   1e-28   Eucalyptus grandis [rose gum]
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    121   1e-28   Oryza brachyantha
dbj|BAF00551.1|  hypothetical protein                                   121   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KHN11694.1|  Protein EFR3 like B                                     121   1e-28   Glycine soja [wild soybean]
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             120   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    120   2e-28   
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             120   2e-28   Phaseolus vulgaris [French bean]
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    120   2e-28   Elaeis guineensis
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    120   2e-28   Oryza brachyantha
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    120   2e-28   Elaeis guineensis
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             120   2e-28   Phaseolus vulgaris [French bean]
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    120   2e-28   Elaeis guineensis
gb|EMT11310.1|  hypothetical protein F775_16040                         120   2e-28   
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    120   2e-28   Elaeis guineensis
gb|KJB16447.1|  hypothetical protein B456_002G230500                    120   2e-28   Gossypium raimondii
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             120   2e-28   
emb|CDY47707.1|  BnaA10g03960D                                          120   2e-28   
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    120   3e-28   
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    120   3e-28   
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    120   3e-28   
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    120   3e-28   
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    120   3e-28   
emb|CDY06905.1|  BnaA04g24100D                                          120   3e-28   
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    120   3e-28   
emb|CDY14788.1|  BnaC04g47850D                                          120   3e-28   
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    120   3e-28   
gb|EEE57911.1|  hypothetical protein OsJ_08605                          120   3e-28   
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          120   4e-28   
gb|EEC74114.1|  hypothetical protein OsI_09170                          116   4e-28   
gb|KHN30101.1|  Protein EFR3 like B                                     119   4e-28   
gb|KJB37960.1|  hypothetical protein B456_006G228200                    119   4e-28   
ref|NP_001048304.1|  Os02g0780500                                       119   4e-28   
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    119   5e-28   
emb|CDP16550.1|  unnamed protein product                                119   5e-28   
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             119   5e-28   
gb|KJB37959.1|  hypothetical protein B456_006G228200                    119   6e-28   
gb|KJB37958.1|  hypothetical protein B456_006G228200                    119   6e-28   
gb|KDP42800.1|  hypothetical protein JCGZ_23742                         119   8e-28   
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    119   8e-28   
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    119   8e-28   
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          119   9e-28   
ref|XP_004158232.1|  PREDICTED: protein EFR3 homolog cmp44E-like        118   9e-28   
gb|KJB49179.1|  hypothetical protein B456_008G105100                    118   9e-28   
gb|EEE55815.1|  hypothetical protein OsJ_04415                          118   1e-27   
gb|KHG10450.1|  Protein EFR3                                            118   1e-27   
gb|KJB49180.1|  hypothetical protein B456_008G105100                    118   1e-27   
ref|NP_001045092.1|  Os01g0898300                                       118   1e-27   
gb|KJB49178.1|  hypothetical protein B456_008G105100                    118   1e-27   
ref|NP_001059150.1|  Os07g0205900                                       118   1e-27   
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    118   2e-27   
gb|EEC81712.1|  hypothetical protein OsI_25322                          118   2e-27   
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              117   2e-27   
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    118   2e-27   
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    118   2e-27   
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    117   2e-27   
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    118   2e-27   
ref|XP_004136123.1|  PREDICTED: uncharacterized protein LOC101211879    117   2e-27   
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       117   2e-27   
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219905    117   2e-27   
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    117   2e-27   
gb|KHN06209.1|  Protein EFR3 like B                                     117   2e-27   
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    117   3e-27   
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    117   3e-27   
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    117   3e-27   
ref|NP_001045867.1|  Os02g0143200                                       117   3e-27   
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    116   3e-27   
gb|EEC72466.1|  hypothetical protein OsI_05818                          117   3e-27   
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    117   3e-27   
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    117   3e-27   
gb|EEE56284.1|  hypothetical protein OsJ_05346                          117   3e-27   
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    117   3e-27   
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    117   4e-27   
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    117   4e-27   
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    117   4e-27   
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    117   4e-27   
gb|AFK46351.1|  unknown                                                 112   4e-27   
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    117   4e-27   
emb|CDM85315.1|  unnamed protein product                                116   5e-27   
dbj|BAK04246.1|  predicted protein                                      116   5e-27   
gb|EMS60662.1|  Protein EFR3-like protein                               116   5e-27   
ref|XP_002533049.1|  conserved hypothetical protein                     116   6e-27   
gb|KEH30318.1|  cyclin-like protein                                     116   8e-27   
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    116   8e-27   
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    116   8e-27   
gb|EMT06694.1|  Putative mitochondrial protein                          116   8e-27   
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    115   8e-27   
gb|AAC02765.1|  hypothetical protein                                    115   1e-26   
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    115   1e-26   
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    115   1e-26   
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             115   2e-26   
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          115   2e-26   
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    115   2e-26   
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    115   2e-26   
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    115   2e-26   
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    115   2e-26   
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    115   2e-26   
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    114   2e-26   
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    115   2e-26   
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    114   2e-26   
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    114   2e-26   
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    114   2e-26   
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 114   3e-26   
emb|CDX79909.1|  BnaA05g02470D                                          114   4e-26   
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    114   4e-26   
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    114   4e-26   
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    114   4e-26   
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    114   4e-26   
gb|KHN25286.1|  Protein EFR3 like B                                     113   7e-26   
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    111   4e-25   
ref|XP_010092917.1|  hypothetical protein L484_004958                   102   1e-24   
ref|XP_004160819.1|  PREDICTED: uncharacterized LOC101203725            101   2e-24   
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    108   5e-24   
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    105   5e-23   
gb|KHN32414.1|  Protein EFR3 like B                                     103   2e-22   
gb|EMT12879.1|  hypothetical protein F775_15212                         102   5e-22   
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                 99.0    5e-21   
gb|KDP26045.1|  hypothetical protein JCGZ_21078                       99.4    5e-21   
gb|KHN07377.1|  hypothetical protein glysoja_012675                   99.0    7e-21   
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476  97.1    3e-20   
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...  96.3    6e-20   
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...  96.3    6e-20   
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                  95.9    8e-20   
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...  95.9    8e-20   
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...  95.9    8e-20   
gb|KGN45115.1|  hypothetical protein Csa_7G426560                     93.6    5e-19   
gb|EAZ26671.1|  hypothetical protein OsJ_10574                        91.7    3e-18   
gb|EAY89716.1|  hypothetical protein OsI_11254                        91.7    3e-18   
ref|XP_006482855.1|  PREDICTED: uncharacterized protein LOC102612183  83.6    2e-17   
gb|KDO81671.1|  hypothetical protein CISIN_1g0461822mg                80.5    4e-17   
gb|EMT28557.1|  Protein EFR3-like protein                             86.3    2e-16   
gb|EMS54754.1|  Protein EFR3-like protein A                           86.3    2e-16   
gb|AES61350.2|  cyclin-like protein                                   79.0    6e-16   
emb|CDY48767.1|  BnaC04g02200D                                        82.4    4e-15   
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656  79.3    4e-14   
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg           79.0    5e-14   
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...  75.9    5e-13   
ref|XP_005846281.1|  hypothetical protein CHLNCDRAFT_135622           65.1    3e-10   
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...  65.1    2e-09   
ref|XP_005645965.1|  hypothetical protein COCSUDRAFT_48103            59.7    1e-07   
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...  59.3    2e-07   
emb|CAJ44368.1|  putative cyclin-related protein                      58.9    2e-07   
gb|KJB71039.1|  hypothetical protein B456_011G101600                  55.1    4e-07   
gb|KJB71038.1|  hypothetical protein B456_011G101600                  55.1    4e-07   
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488  53.1    2e-05   
gb|KDD71994.1|  hypothetical protein H632_c4035p0                     45.8    4e-04   



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   170 bits (431),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRSGH K +N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSGHVKFINIV  94



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SRKLFPACESMCICCPA+RSRSRQPVKRY KLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGLISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKAPDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR GH K +N++
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLGHIKFINIV  94



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRY KLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H K +NVI
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVI  94



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRY KLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H K +NVI
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVI  94



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   167 bits (423),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGVISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKTPDGHPNDRKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNPFRIPKIAK LE +CYKELRSG+ KLV ++
Sbjct  61   ASKNPFRIPKIAKYLEEKCYKELRSGNIKLVGIV  94



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  81   SRFCGSSSSPDLSLQG-KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFP  257
            S FCGS  SP L  Q  KMG +SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFP
Sbjct  29   SSFCGSFYSPYLVSQARKMGFISRKVFPACGNMCVCCPALRSRSRQPVKRYKKLLADIFP  88

Query  258  KSPDGSANGRKIMKLCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            KSPD  +N RK++KLCEYAAKNPFRIPKI K LE RCYKELRS + K V ++
Sbjct  89   KSPDSPSNERKVVKLCEYAAKNPFRIPKITKYLEDRCYKELRSQNIKFVEIV  140



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLLADIFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDELPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H KLV +I
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKII  94



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRY KLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHVKFINIV  94



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRY KLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIV  94



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRY KLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIV  94



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 92/119 (77%), Gaps = 8/119 (7%)
 Frame = +3

Query  81   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTK  236
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY K
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  237  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIV  135



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 92/119 (77%), Gaps = 8/119 (7%)
 Frame = +3

Query  81   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTK  236
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY K
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  237  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIV  135



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RC+KELRSGH K +N++
Sbjct  61   AAKNPFRIPKIAKYLEERCFKELRSGHVKFINIV  94



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRY KLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RC+KELRS H K +NVI
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVI  94



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRY KLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RC+KELRS H K +NVI
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVI  94



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPA+RSRSRQPVKRY KLLADIFPKSPDGS N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPAMRSRSRQPVKRYKKLLADIFPKSPDGSPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNV  410
            AAKNPFRIPKI K LE RCYKELRS H K +N+
Sbjct  61   AAKNPFRIPKIVKYLEERCYKELRSEHIKFINI  93



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score =   162 bits (411),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIV  94



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRY KLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIV  94



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRY KLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIV  94



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   163 bits (413),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY KLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIV  94



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   163 bits (412),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIV  94



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H KLVN+I
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNII  94



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H KLVN+I
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNII  94



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRY KLLA+IFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDCPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIV  94



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC SMC+CCPALRSRSRQPVKRY KLL DIFPKSPD   N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGSMCVCCPALRSRSRQPVKRYRKLLVDIFPKSPDELPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H KLV ++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIV  94



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H KLVN+I
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHLKLVNII  94



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H KLVN+I
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKLVNII  94



>gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SRK+FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELRS H K +N++
Sbjct  60   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINIV  93



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG +N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSHDGQSNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKIAK LE RCYKELRSG+ + V+++
Sbjct  61   ASKNPLRIPKIAKYLEERCYKELRSGNIRFVSIV  94



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H KL+N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIV  94



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H KL+N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIV  94



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  93   GSSSSPDLSLQGK-MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPD  269
            G  + PDL  QGK MG +SR++FPAC SMC+CCPALRSRSRQPVKRY KLLA+IFPKS D
Sbjct  451  GVFAPPDLPPQGKEMGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSID  510

Query  270  GSANGRKIMKLCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            G  N RKI+KLCEYAAKNPFRIPKIAK LE RCYKELR  H K + ++
Sbjct  511  GPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIV  558



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY KLL++IFPKSPD   N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKFINIV  94



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRY KLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIV  94



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGTPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>gb|EPS74671.1| hypothetical protein M569_00084, partial [Genlisea aurea]
Length=95

 Score =   145 bits (366),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR+LFP CE+MC+CCPA R+ SRQPVKRY KLL +IFPK PD   N RKIMKLCEY
Sbjct  3    MGVISRRLFPVCETMCVCCPAFRASSRQPVKRYKKLLTEIFPKFPDDRPNDRKIMKLCEY  62

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNV  410
            A+KN FRIPKIAK LE RCYKELRSG+TK+V +
Sbjct  63   ASKNSFRIPKIAKYLEERCYKELRSGNTKVVAI  95



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIV  94



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMC+CCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY KLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NPFRIPKIAK LE RCYKELR  H K +N++
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIV  94



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMC+CCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACESMC+CCPALRSRSRQPVKRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  94



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSDRKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RC +EL+S H K+VN+I
Sbjct  61   AAKNPFRIPKIAKYLEERCSRELKSEHIKMVNII  94



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRKLFPAC SMC+CCPALRSRSRQPVKRY KL+ADIFPKSPDG  N RK++KLCEY
Sbjct  1    MGIISRKLFPACGSMCVCCPALRSRSRQPVKRYKKLIADIFPKSPDGQTNERKLVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI K+LE + ++ELR GH K+V ++
Sbjct  61   AAKNPVRIPKITKQLEEKFFRELRYGHLKIVGIV  94



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = +3

Query  129  KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCE  308
            +MG +SRK+FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCE
Sbjct  46   EMGFVSRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCE  104

Query  309  YAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            YAAKNPFRIPKIAK LE RC KELRS H K +N +
Sbjct  105  YAAKNPFRIPKIAKYLEERCCKELRSEHIKFINTV  139



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR++FPACESMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG+ N RKI+KLCEY
Sbjct  1    MGFISRRVFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NP RIPKIAK LE RCYKELRS   K ++++
Sbjct  61   AARNPLRIPKIAKFLEERCYKELRSEQIKFISIV  94



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSP--DGSANGRKIMKLC  305
            MG +SR +FPACESMCICCPALRSRSRQPVKRY KLL +IFPKSP  DG+ N RKI+KLC
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPVSDGAPNERKIVKLC  60

Query  306  EYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            EYAAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   EYAAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIV  96



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR++FPAC SMC+CCPALRSRSRQPVKRY KLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE RCYKELR  H K + ++
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIV  94



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE+MC+CCPALR RS+ P KRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIV  94



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE+MC+CCPALR RS+ P KRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE RCYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIV  94



>gb|ABF95548.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
Length=729

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +S KLFP+CESMC+CCPALR  SR+PVKRY KLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   + +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKII  94



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE+MC+CCPALR RS+ P KRY KLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE +CYK+LRS   K +N++
Sbjct  61   AAKNPIRIPKIAKILEEKCYKDLRSEQMKFINIV  94



>ref|XP_010094723.1| hypothetical protein L484_003597 [Morus notabilis]
 gb|EXB56843.1| hypothetical protein L484_003597 [Morus notabilis]
Length=570

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRY KLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKIAK LE RCYKELR  H K +N++
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIV  94



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG LS KL P+CESMC+CCPALR  SR+PVKRY KLLA+IFPK+PDG+ N RKIMKLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRTHKELRSAHVSFVRII  94



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +S KLFP+CESMC+CCPALR  SR+PVKRY KLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   + +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKII  94



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +S KLFP+CESMC+CCPALR  SR+PVKRY KLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGPPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELR+ H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRAAHVNFVKII  94



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC +MCICCPALRSRSRQPVKRY KLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKI K LE RC KELR+   K + +I
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRNEQVKCITII  94



>ref|XP_008778937.1| PREDICTED: protein EFR3 homolog cmp44E-like [Phoenix dactylifera]
Length=352

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRY KLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKII  94



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG LS KL P+CESMC+CCPALR  SR+PVKRY KLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRII  94



>ref|XP_004165925.1| PREDICTED: uncharacterized LOC101202927 [Cucumis sativus]
Length=995

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRY KLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKI K LE RC KELRS   K + +I
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITII  94



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRY KLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKI K LE RC KELRS   K + +I
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITII  94



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRY KLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKIAK LE RCYKELR  H K +N++
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIV  94



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRY KLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKII  94



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRY KLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKII  94



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   145 bits (367),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/94 (71%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRY KLLA+IFPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGPPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKII  94



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   145 bits (367),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKL PAC +MC+CCPAL   SR+PVKRY KLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NP RIPKIAK LE RCYKELR+ H   V +I
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKII  94



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   145 bits (367),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRKL PAC +MC+CCPAL   SR+PVKRY KLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NP RIPKIAK LE RCYKELR+ H   V +I
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKII  94



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG LS KL P+CES+C+CCPALR  SR+PVKRY KLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRII  94



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG LS KL P+CES+C+CCPALR  SR+PVKRY KLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R +KELRS H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRII  94



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ P C +MC+CCPALRSRSRQP KRY KLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKIAK LE R YKELRS H K VNVI
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVI  94



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ P C +MC+CCPALRSRSRQP KRY KLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKIAK LE R YKELRS H K VNVI
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVI  94



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +  KLFP+CESMC+CCPALR  SR+PVKRY KLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R  KELR+ H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKII  94



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +  KLFP+CESMC+CCPALR  SR+PVKRY KLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R  KELR+ H   V +I
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKII  94



>ref|XP_006840435.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR++FP C S+C+CCPALRSRSRQPVKRY KLL+DIFPKS DG  N R+I KLCEY
Sbjct  1    MGFISRRVFPVCGSICVCCPALRSRSRQPVKRYKKLLSDIFPKSLDGPPNERRITKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNPFRIPKIAK LE R +KEL   H K + +I
Sbjct  61   AAKNPFRIPKIAKFLEQRSHKELHCDHFKYIEII  94



>ref|XP_009765963.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765964.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765965.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765966.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
Length=214

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRY KLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFLCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNPFRIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRY KLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NP RIPKIAK LE R YKELR GH   V +I
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKII  94



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRY KLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AA+NP RIPKIAK LE R YKELR GH   V +I
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKII  94



>ref|XP_008354962.1| PREDICTED: protein EFR3 homolog A-like [Malus domestica]
Length=109

 Score =   126 bits (316),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++FP CES+C  CPALR+RSR PVKRY ++LA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKQMLAEIFPRSPDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+K P RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVV  94



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRY KLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELR  H   V +I
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKII  94



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRY KLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIAK LE R YKELR  H   V +I
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKII  94



>ref|XP_009625867.1| PREDICTED: protein EFR3 homolog isoform X2 [Nicotiana tomentosiformis]
Length=924

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRY KLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNPFRIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRY KLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNPFRIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>gb|EYU18743.1| hypothetical protein MIMGU_mgv1a0012531mg, partial [Erythranthe 
guttata]
Length=151

 Score =   125 bits (314),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP++R+RSRQPVKRY KL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPSMRARSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKIA+ LE RCYKELR+ + + V ++
Sbjct  66   AKNPLRIPKIAESLEQRCYKELRNENIRSVKIV  98



>ref|XP_001767624.1| predicted protein [Physcomitrella patens]
 gb|EDQ67583.1| predicted protein [Physcomitrella patens]
Length=790

 Score =   133 bits (335),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SR++ P C SMC+CCPALR+RSRQPVKRY  LLADI+PKS D + N RKI KL EY
Sbjct  1    MGLISRRVLPICGSMCVCCPALRARSRQPVKRYNMLLADIYPKSQDEAPNDRKIGKLVEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIA  LE + YKEL++ H   V  +
Sbjct  61   AAKNPLRIPKIAGALEQKGYKELKADHFGTVTTV  94



>ref|XP_006858684.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C S+C  CP+LR+RSRQPVKRY KLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNDRKICKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI K LE RCY+ELR+ H   V V+
Sbjct  61   AAKNPLRIPKITKYLEQRCYRELRNEHFGSVKVV  94



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE +CYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVV  98



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE +CYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVV  98



>ref|XP_006838291.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC  +C  CP+LR+RSRQPVKRY KLLADIFPKS D   N RKI KLCEY
Sbjct  1    MGIMSRKVLPACGRLCFFCPSLRARSRQPVKRYKKLLADIFPKSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP R+PKIA  LE RCYKELR  H     V+
Sbjct  61   ASKNPLRVPKIADYLEQRCYKELRIEHFGFAKVV  94



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE +CYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVV  98



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE + +CCPA   RS  PVKRY  LL DIFPKSPDG++N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKILLLDIFPKSPDGASNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP  IPKIAK LE  CYK+LRS   K +NV+
Sbjct  61   AAKNPVHIPKIAKCLENMCYKDLRSRQMKFINVV  94



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_010257180.1| PREDICTED: uncharacterized protein LOC104597386 isoform X2 [Nelumbo 
nucifera]
Length=1010

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRY KL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKIA  LE RCYKELR+   +L  V+
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVV  94



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRY KL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKIA  LE RCYKELR+   +L  V+
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVV  94



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE RCYK+LR+ H   V V+
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVV  94



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++FP CES+C  CPALR+RSR PVKRY KLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+K P RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVV  94



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRY KLL D+FP+SPDG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACGNLCCFCPSLRARSRQPVKRYKKLLTDVFPRSPDGQPNDRMIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR+G      V+
Sbjct  61   ASKNPMRIPKITNYLEQRCYKELRNGQFNSAKVV  94



>ref|XP_009626575.1| PREDICTED: protein EFR3 homolog B-like [Nicotiana tomentosiformis]
Length=204

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRY KL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCY+ELR+ +   V V+
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVV  93



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++FP CES+C  CPALR+RSR PVKRY KLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+K P RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVV  94



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR  H   V ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIV  94



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR  H   V ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIV  94



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+ R++FP CES+C  CPALR+RSR PVKRY KLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGLIQRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+K P RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVV  94



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR  H   V ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIV  94



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR  H   V V+
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKVV  94



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR RSRQPVKRY KL++DIFPKS D   N RKI KLCEYA
Sbjct  7    GVISRQVLPACGSLCFFCPALRERSRQPVKRYKKLISDIFPKSLDEEPNDRKIGKLCEYA  66

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKIA  LE RCYKELR+ + + V V+
Sbjct  67   AKNPLRIPKIANSLEQRCYKELRNENFRAVKVV  99



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE +CYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVV  98



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE +CYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVV  98



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG ++R +FP CES+C  CPALR+RSR PVKRY +LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELR  383
            AAKNP RIPKI   LE RCYKELR
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELR  84



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  120  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMK  299
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  300  LCEYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            LCEYAAKNPFRIPKI K LE RCYKELR+ + +   V+
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVV  98



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG ++R +FP CES+C  CPALR+RSR PVKRY +LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELR  383
            AAKNP RIPKI   LE RCYKELR
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELR  84



>ref|XP_004166917.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224192, 
partial [Cucumis sativus]
Length=986

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPALR+RSRQPVKRY KL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + + V V+
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVV  98



>gb|KGN59399.1| hypothetical protein Csa_3G816120 [Cucumis sativus]
Length=870

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPALR+RSRQPVKRY KL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + + V V+
Sbjct  69   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVV  101



>ref|XP_004136762.1| PREDICTED: uncharacterized protein LOC101210251 [Cucumis sativus]
Length=1002

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPALR+RSRQPVKRY KL+ADIFP++P+   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + + V V+
Sbjct  66   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVV  98



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRY KLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNERKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGH  392
            A+KN  RIPKI   LE RCYK+LR+GH
Sbjct  61   ASKNALRIPKITDYLEQRCYKDLRNGH  87



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIV  94



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE + +CCPAL  RS  PVKRY  LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPALGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIIKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP  IPKIAK LE  CYK+LRS   K + ++
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIV  94



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PACES+C  CP LR+RSRQPVKRY KL+ADIFP+S D   N RKI KLCEYA
Sbjct  6    GVISRQILPACESLCFFCPGLRTRSRQPVKRYKKLIADIFPRSQDEEPNYRKIEKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +KNP RIPKI   LE RCYKELR  + + V ++
Sbjct  66   SKNPMRIPKIESSLEQRCYKELRVENIRSVKIV  98



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIV  94



>ref|XP_010454428.1| PREDICTED: uncharacterized protein LOC104736187 [Camelina sativa]
Length=1034

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIV  94



>ref|XP_008355520.1| PREDICTED: uncharacterized protein LOC103419180 [Malus domestica]
 ref|XP_008363736.1| PREDICTED: uncharacterized protein LOC103427461 [Malus domestica]
Length=109

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLL DI P++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNP RIPKI   LE RCYK+LR+ H   V V+
Sbjct  61   AMKNPLRIPKITDSLEQRCYKDLRNEHFGSVTVV  94



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIV  94



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIV  94



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRY KLLADIFP S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPHSQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             ++NP RIPKI   LE RCY+ELR+ H   V V+
Sbjct  61   TSRNPLRIPKITNYLEQRCYRELRNEHFGYVKVV  94



>ref|XP_010097525.1| hypothetical protein L484_024736 [Morus notabilis]
 gb|EXB68716.1| hypothetical protein L484_024736 [Morus notabilis]
Length=161

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLLADIFP++ D   N RKI KLC Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAELNDRKIGKLCVY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNENYGSVKVV  94



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALRSRSRQPVKRY KL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKIA  LE RCYKELR+ + + V ++
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIV  98



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALRSRSRQPVKRY KL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKIA  LE RCYKELR+ + + V ++
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIV  98



>ref|XP_006400678.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
 gb|ESQ42131.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
Length=1020

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSLDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCY+ELR+     V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRTEQFHSVKIV  94



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ P C S+C  CPALR+RSRQPVKRY KL+A+IFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPVCGSLCFFCPALRARSRQPVKRYKKLIAEIFPRSQDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYKELR+    L  V+
Sbjct  61   ASKNPMRIPKITSTLEQRCYKELRNEQFWLAKVV  94



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI K LE RCYK+LR+ H   V V+
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVV  94



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR + PACES+CI CP+LR+RSRQPVKRY KLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRSIMPACESLCIFCPSLRTRSRQPVKRYKKLLADIFPRSQDEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             ++NP RIPKI   LE + YKELR  H   V V+
Sbjct  61   VSRNPLRIPKITSYLEQKFYKELRLEHFGTVKVV  94



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY KLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI K LE RCYK+LR+ H   V V+
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVV  94



>ref|XP_010523669.1| PREDICTED: uncharacterized protein LOC104801976 isoform X3 [Tarenaya 
hassleriana]
Length=985

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY KLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKN  RIPKI + LE RCY++LR      V ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIV  94



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCYKELR      V ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRMEQFHSVKIV  94



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY KLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKN  RIPKI + LE RCY++LR      V ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIV  94



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY KLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKN  RIPKI + LE RCY++LR      V ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIV  94



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRY KLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE +CYK+LR+ H   V VI
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVI  94



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRY KLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE +CYK+LR+ H   V VI
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVI  94



>ref|XP_006443048.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
 gb|ESR56288.1| hypothetical protein CICLE_v100186802mg, partial [Citrus clementina]
Length=190

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY K+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVV  94



>ref|XP_009789840.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Nicotiana 
sylvestris]
Length=1028

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRY KL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCY+ELR+ +   V V+
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVV  93



>ref|XP_009789839.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Nicotiana 
sylvestris]
Length=1029

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRY KL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHRIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCY+ELR+ +   V V+
Sbjct  60   ASKNPLRIPKITSVLEQRCYRELRNENIGSVKVV  93



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPALR+RSRQPVKRY KL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             KNP RIPKI   LE RCYKELR+ + + V V+
Sbjct  69   GKNPLRIPKITTSLEQRCYKELRNENFQAVKVV  101



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C  +C+CCP LR+RSRQPVKRY KLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNPFRIPKIAK LE R YKELR  H   V VI
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHHGSVRVI  94



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR +FP CES+C  CPALR+RSR PVKRY  LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSVDEQPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKI   LE RCY+ELR      V ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRMEQFHSVKIV  94



>ref|XP_009151505.1| PREDICTED: uncharacterized protein LOC103874824 [Brassica rapa]
Length=767

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR +FPACE + +CCPA   RS  PVKRY  LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIVKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP  IPKIAK LE  CYK+LRS   K + ++
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIV  94



>ref|XP_006345431.1| PREDICTED: uncharacterized protein LOC102584593 [Solanum tuberosum]
Length=1017

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRY KL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCY+ELR+ +   V V+
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVV  93



>ref|XP_004229640.1| PREDICTED: protein EFR3 homolog B-like [Solanum lycopersicum]
Length=1018

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG+ S ++ PAC+ +C+CCPA+R+RSRQPVKRY KL++D FP+SPDG  N R I KLCEY
Sbjct  1    MGI-SHQIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEY  59

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCY+ELR+ +   V V+
Sbjct  60   ASKNPLRIPKITTVLEQRCYRELRNENLGSVKVV  93



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C  +C+CCP LR+RSRQPVKRY KLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNPFRIPKIAK LE R YKELR  H   V VI
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHYGSVRVI  94



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   127 bits (320),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQP+KRY KL+A+IFP++PD   N R I +LCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPAMRARSRQPIKRYKKLIANIFPRNPDDGPNDRMIGRLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKNP RIPKI   LE RCYKELR+
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRN  89



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNP RIPKI   LE RCYK+LR+ H   V V+
Sbjct  61   ALKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVV  94



>ref|XP_009118564.1| PREDICTED: protein EFR3 homolog [Brassica rapa]
Length=933

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   127 bits (320),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLMADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITCSLEQRCYKELR  88



>emb|CDY06190.1| BnaA09g50130D [Brassica napus]
Length=936

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>emb|CDY09999.1| BnaC08g44520D [Brassica napus]
Length=942

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +  AN RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEANDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNP RIPKI   LE RCYK+LR+ H   V V+
Sbjct  61   ALKNPLRIPKITGSLEQRCYKDLRNEHFGSVKVV  94



>ref|XP_011087843.1| PREDICTED: uncharacterized protein LOC105169196 [Sesamum indicum]
Length=1011

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++S+++ P C+S+CICCP +R RSR PVKRY KLLADI+PK+ +   N RKI KLCEY
Sbjct  1    MGVMSKRMMPVCDSLCICCPGMRPRSRHPVKRYKKLLADIYPKNMEEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP R+PKI   LE RCY+ELR+ +   V V+
Sbjct  61   ASKNPLRVPKITSLLEERCYRELRNENINCVKVV  94



>ref|XP_011033325.1| PREDICTED: uncharacterized protein LOC105131844 isoform X3 [Populus 
euphratica]
Length=1000

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITCSLEQRCYKELR  88



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP+LR RSRQPVKRY KLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGALCFLCPSLRERSRQPVKRYKKLLADIFPRAQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS---GHTKLV  404
            A++NP RIPKI   LE RCYKE+R+   G  K+V
Sbjct  61   ASRNPLRIPKITTYLEQRCYKEMRNERFGSVKVV  94



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITCSLEQRCYKELR  88



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITCSLEQRCYKELR  88



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            M ++SR ++P C S+C  CPALR RSR P+KRY KLLADIFP++P+   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPEEEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP R+PKI   LE RCYKELR+ + + V V+
Sbjct  61   ASKNPLRVPKITSYLEQRCYKELRTENYQAVKVV  94



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC  +C  CPALR+RSRQPVKRY KLL +IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGRLCFFCPALRARSRQPVKRYKKLLVEIFPRTQDEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI   LE RCY+ELR+ H     +I
Sbjct  61   ASRNPLRIPKITSYLEQRCYRELRNEHFSFAKII  94



>gb|KDO53678.1| hypothetical protein CISIN_1g0359231mg, partial [Citrus sinensis]
Length=194

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             KNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIV  98



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSA--NGRKIMKLC  305
            M ++S ++ PAC+S+C  CPALR+RSRQP+KRY KLLADIFP++P G    N RKI KLC
Sbjct  1    MSVISTQVMPACDSLCFFCPALRTRSRQPIKRYKKLLADIFPRAPVGEEQLNDRKIGKLC  60

Query  306  EYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            EYAAKNP RIPKI   LE RCYK+LRS   + V ++
Sbjct  61   EYAAKNPLRIPKITSSLEQRCYKDLRSEQFQSVKIV  96



>ref|XP_010485557.1| PREDICTED: uncharacterized protein LOC104763859 [Camelina sativa]
Length=979

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +SR+ FPAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGFMSRRFFPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>gb|EYU20743.1| hypothetical protein MIMGU_mgv1a000711mg [Erythranthe guttata]
Length=1009

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP LR+RSRQPVKRY KL+++IFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLISEIFPRSQEEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPK+A  LE RCYKELR+ + + V V+
Sbjct  66   AKNPLRIPKMANSLEQRCYKELRNENFRAVKVV  98



>ref|XP_006417969.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
 gb|ESQ36322.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
Length=965

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY ++LA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKQMLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP LR+RSRQPVKRY KL+ADIFPK+ D   N R I KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKTQDEGPNDRMIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+NP R+PKI   LE RCYKELR+ +   V ++
Sbjct  66   ARNPLRVPKITNNLEQRCYKELRNQNFNAVKIV  98



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C CCP+LR+RSRQPVKRY KL+ADIFP++ +   N RKI KLC+Y 
Sbjct  6    GVVSRQVLPACGSLCFCCPSLRTRSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCDYV  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKNP RIPKI   LE RCYKELR+
Sbjct  66   AKNPLRIPKIVTALEQRCYKELRN  89



>ref|XP_006293443.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
 gb|EOA26341.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
Length=1027

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+CI CPALR+RSRQPVKRY KL+ADIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQDEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNV  410
            AKN  R+PKI+  LE RCYKELR+ +  L  +
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFHLAKI  97



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPA+R+RSRQPVKRY KL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIV  98



>ref|XP_010522186.1| PREDICTED: uncharacterized protein LOC104800896 isoform X2 [Tarenaya 
hassleriana]
Length=995

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP+LR+RSRQPVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSLRARSRQPVKRYKKMLAEIFPRNQEAEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +++NP RIPKI   LE +CYKELR+G+   V V+
Sbjct  61   SSRNPLRIPKITDYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPA+R+RSRQPVKRY KL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIV  98



>ref|XP_001770437.1| predicted protein [Physcomitrella patens]
 gb|EDQ64774.1| predicted protein [Physcomitrella patens]
Length=1107

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MGL+SR++ P C SMC+CCPALR+RSRQPVKRY  LLADI+PK+     N RKI KL +Y
Sbjct  1    MGLMSRRVLPVCGSMCVCCPALRARSRQPVKRYNMLLADIYPKTQVEVPNDRKIGKLVDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AAKNP RIPKIA  LE R  KEL++ H   V V+
Sbjct  61   AAKNPLRIPKIASALEQRGLKELKNEHIGTVRVV  94



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC ++C  CPA+R RSRQP+KRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELRS + +   V+
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVV  98



>ref|XP_010522184.1| PREDICTED: uncharacterized protein LOC104800896 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522185.1| PREDICTED: uncharacterized protein LOC104800896 isoform X1 [Tarenaya 
hassleriana]
Length=996

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP+LR+RSRQPVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSLRARSRQPVKRYKKMLAEIFPRNQEAEPNDRKISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +++NP RIPKI   LE +CYKELR+G+   V V+
Sbjct  61   SSRNPLRIPKITDYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC ++C  CPA+R RSRQP+KRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELRS + +   V+
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVV  98



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+C  CPA+R+RSRQPVKRY KL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKNP RIPKI   LE RCYKELR+
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRT  89



>emb|CDY63789.1| BnaA08g31700D [Brassica napus]
Length=928

 Score =   125 bits (313),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCI-CCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCE  308
            MG++SR++ PAC ++C  CCP+LR RSR PVKRY ++LADIFP++ D   N RKI KLCE
Sbjct  1    MGVMSRRVLPACGNICFFCCPSLRVRSRHPVKRYKQMLADIFPRNQDAEPNDRKIGKLCE  60

Query  309  YAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            YA++NP RIPKI + LE +CY+ELR+G+   V V+
Sbjct  61   YASRNPLRIPKINEYLEHKCYRELRNGNIGSVKVV  95



>gb|AAK56279.1|AF367291_1 At1g05960/T21E18_20 [Arabidopsis thaliana]
 gb|AAN72256.1| At1g05960/T21E18_20 [Arabidopsis thaliana]
Length=731

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>emb|CBI29857.3| unnamed protein product [Vitis vinifera]
Length=1195

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC ++C  CPA+R RSRQP+KRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELRS + +   V+
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVV  98



>ref|XP_002892313.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68572.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1634

 Score =   125 bits (315),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_006303900.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
 gb|EOA36798.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
Length=867

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>emb|CDX86545.1| BnaC08g01580D [Brassica napus]
Length=919

 Score =   125 bits (313),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCI-CCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCE  308
            MG++SR++ PAC ++C  CCP+LR RSR PVKRY ++LADIFP++ D   N RKI KLCE
Sbjct  1    MGVMSRRVLPACGNICFFCCPSLRVRSRHPVKRYKQMLADIFPRNQDAEPNDRKIGKLCE  60

Query  309  YAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            YA++NP RIPKI + LE +CY+ELR+G+   V V+
Sbjct  61   YASRNPLRIPKINEYLEHKCYRELRNGNIGSVKVV  95



>ref|NP_001154308.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27924.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=1003

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRY K+LA+IFP++PD   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTPDEEPNERRIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS---GHTKLVNVI  413
            AAKNP R+PKI   LE R YKELR+   G  K+V +I
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRTEQYGFAKVVMLI  97



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G+LSR++ PAC  +C  CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GILSRQVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGH---TKLV  404
            AKNP RIPKI   LE RCYKELR+ +   TK+V
Sbjct  66   AKNPLRIPKITNFLEQRCYKELRNENFRSTKIV  98



>gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Erythranthe guttata]
Length=974

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG +S+++ P C+S+CICCPA+R RSR PVKRY KLLADIFP++     N R+I KLCEY
Sbjct  1    MGAMSKRMMPFCDSLCICCPAMRPRSRHPVKRYKKLLADIFPRNMGDEPNDRQISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             +KNP R+PKI   LE RCY+ELR+ +   V VI
Sbjct  61   VSKNPLRVPKITSLLEERCYRELRNANVNRVKVI  94



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLISDIFPRSQEEEPNERKISKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKE+R+ + + V ++
Sbjct  66   AKNPLRIPKITTSLEQRCYKEIRNENFRSVKIV  98



>ref|XP_010457707.1| PREDICTED: uncharacterized protein LOC104739144 [Camelina sativa]
Length=979

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|NP_563755.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27923.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=982

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_006303899.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
 gb|EOA36797.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
Length=980

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_010475319.1| PREDICTED: uncharacterized protein LOC104754751 [Camelina sativa]
Length=979

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLL DI P++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNP RIPKI   LE RCYK+LR+ H   V V+
Sbjct  61   AMKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVV  94



>gb|EPS68833.1| hypothetical protein M569_05934, partial [Genlisea aurea]
Length=579

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  126  GKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLC  305
            G+MG +S+++ P C+S+C+CCPAL  RSR PVKRY +LLAD+FP++ +   N RK+ KLC
Sbjct  42   GEMGAMSKQMMPVCDSLCVCCPALLPRSRHPVKRYKRLLADVFPRNMEEEPNDRKVSKLC  101

Query  306  EYAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            EYA+KNP R+PKI   LE RCY+E+R+ +   V V+
Sbjct  102  EYASKNPLRVPKITSLLEERCYREVRNENLGRVKVV  137



>ref|XP_002308951.2| cyclin-related family protein [Populus trichocarpa]
 gb|EEE92474.2| cyclin-related family protein [Populus trichocarpa]
Length=901

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITSSLEQRCYKELR  88



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELR  383
            AKNP RIPKI   LE RCYKELR
Sbjct  66   AKNPLRIPKITSSLEQRCYKELR  88



>ref|XP_003591099.1| EFR3-like protein [Medicago truncatula]
Length=210

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = +3

Query  141  LSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYAAK  320
            +S +L  AC      CPALRSRSRQPVK Y KLLADIFPKSP    N RKI+KLCEYAAK
Sbjct  14   ISSQLVRAC---VFTCPALRSRSRQPVKCYRKLLADIFPKSP--LPNERKIVKLCEYAAK  68

Query  321  NPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            NP RIPKIAK LE RCYKELRS H KLV +I
Sbjct  69   NPLRIPKIAKYLEERCYKELRSEHIKLVKII  99



>ref|XP_002277709.2| PREDICTED: uncharacterized protein LOC100265428 [Vitis vinifera]
Length=1012

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ P C S+C  CP++RSRSRQPVKRY KLLA+IFP+S +   N RKI KLCEY
Sbjct  1    MGIISRKVMPVCGSLCFFCPSMRSRSRQPVKRYKKLLAEIFPRSREEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS---GHTKLV  404
            A++NP RIPKI   LE RCYKELR+    H K+V
Sbjct  61   ASRNPLRIPKITTYLEQRCYKELRTERFHHVKVV  94



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            M ++SR ++P C S+C  CPALR RSR P+KRY KLLADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPDEEPNERMISKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP R+PKI   LE RCY+ELR+ + + V V+
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVV  94



>ref|XP_006478683.1| PREDICTED: uncharacterized protein LOC102614635 isoform X1 [Citrus 
sinensis]
 ref|XP_006478684.1| PREDICTED: uncharacterized protein LOC102614635 isoform X2 [Citrus 
sinensis]
 ref|XP_006478685.1| PREDICTED: uncharacterized protein LOC102614635 isoform X3 [Citrus 
sinensis]
Length=1000

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY K+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVV  94



>gb|KDO47320.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47321.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47322.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=1000

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY K+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVV  94



>gb|KDO47318.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=979

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY K+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVV  94



>gb|KDO47319.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=985

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY K+LADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITTLLEQRCYKDLRNENFGSVKVV  94



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP LR+RSRQPVKRY KL+ADIFPK+ +   N RKI KLCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGH---TKLV  404
            +KNP RIPKI   LE RCYKELR+ +   TK+V
Sbjct  66   SKNPLRIPKITTSLEQRCYKELRNENFRSTKIV  98



>gb|AAF80120.1|AC024174_2 Contains similarity to an unknown protein T11A7.7 gi|2335096 
from Arabidopsis thaliana BAC T11A7 gb|AC002339 and contains 
a tropomyosin PF|00261 domain. ESTs gb|AI995205, gb|N37925, 
gb|F13889, gb|AV523107, gb|AV535948, gb|AV558461, gb|F13888 
come from this gene [Arabidopsis thaliana]
Length=1628

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP+LR+RSR PVKRY K+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A++NP RIPKI + LE +CYKELR+G+   V V+
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVV  94



>ref|XP_004140882.1| PREDICTED: uncharacterized protein LOC101203725 [Cucumis sativus]
Length=955

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY K LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVV  94



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY KLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A +NP RIPKI  +LE RCYK+LR+ +   V V+
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVV  94



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C  CP++R+RSRQPVKRY KLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A +NP RIPKI  +LE RCYK+LR+ +   V V+
Sbjct  61   ALRNPLRIPKITGQLEQRCYKDLRNENFGSVKVV  94



>ref|XP_007028783.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY09285.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=706

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            +KNP RIPKI+  LE RCYKELR+
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRN  89



>ref|XP_008445732.1| PREDICTED: uncharacterized protein LOC103488670 isoform X2 [Cucumis 
melo]
Length=954

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY K LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVV  94



>emb|CBI24919.3| unnamed protein product [Vitis vinifera]
Length=1322

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ P C S+C  CP++RSRSRQPVKRY KLLA+IFP+S +   N RKI KLCEY
Sbjct  1    MGIISRKVMPVCGSLCFFCPSMRSRSRQPVKRYKKLLAEIFPRSREEEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS---GHTKLV  404
            A++NP RIPKI   LE RCYKELR+    H K+V
Sbjct  61   ASRNPLRIPKITTYLEQRCYKELRTERFHHVKVV  94



>ref|XP_008445731.1| PREDICTED: uncharacterized protein LOC103488670 isoform X1 [Cucumis 
melo]
Length=991

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY K LADIFP++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKFLADIFPRNQDAEPNDRKICKLCDY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITELLEQRCYKDLRNENFGSVKVV  94



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             KNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQFAKIV  98



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIV  98



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIV  98



>gb|KJB46322.1| hypothetical protein B456_007G360200 [Gossypium raimondii]
Length=987

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP+LR+RSRQPVKRY  L+ADIFP+  +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPSLRTRSRQPVKRYKALIADIFPRKKEDGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +KNP RIPKI + LE RCYKELR+ + + V ++
Sbjct  66   SKNPLRIPKITESLEQRCYKELRNENFQSVKIV  98



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            AKNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIV  98



>ref|XP_009111016.1| PREDICTED: protein EFR3 homolog isoform X1 [Brassica rapa]
Length=921

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCI-CCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCE  308
            MG++SR++ PAC ++C  CCP+LR RSR PVKRY ++LADIFP++ D   N RKI KLCE
Sbjct  1    MGVMSRRVLPACGNICFFCCPSLRVRSRHPVKRYKQMLADIFPRNQDAEPNDRKIGKLCE  60

Query  309  YAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            YA++ P RIPKI + LE +CY+ELR+G+   V V+
Sbjct  61   YASRKPLRIPKINEYLEHKCYRELRNGNIGSVKVV  95



>ref|XP_009111018.1| PREDICTED: protein EFR3 homolog isoform X3 [Brassica rapa]
Length=920

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCI-CCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCE  308
            MG++SR++ PAC ++C  CCP+LR RSR PVKRY ++LADIFP++ D   N RKI KLCE
Sbjct  1    MGVMSRRVLPACGNICFFCCPSLRVRSRHPVKRYKQMLADIFPRNQDAEPNDRKIGKLCE  60

Query  309  YAAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            YA++ P RIPKI + LE +CY+ELR+G+   V V+
Sbjct  61   YASRKPLRIPKINEYLEHKCYRELRNGNIGSVKVV  95



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   122 bits (307),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC  +C  CP+LR RSRQPVKRY K++ADIFP S +   N R+I KLCEY 
Sbjct  9    GMVSRKVLPACGGLCYLCPSLRPRSRQPVKRYKKIIADIFPSSQEDEPNERRIGKLCEYV  68

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+NP R+PKI   LE RCYKELRS H     V+
Sbjct  69   ARNPQRVPKITDYLEQRCYKELRSEHYGYAKVV  101



>ref|XP_010505973.1| PREDICTED: uncharacterized protein LOC104782671 [Camelina sativa]
Length=1022

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+CI CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKN  R+PKI+  LE RCYKELR+
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRN  89



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR+RSRQPVKRY KL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKNP RIPKI   LE RCYKELR+
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRN  90



>gb|KHN33312.1| Protein EFR3 like B [Glycine soja]
Length=926

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRY K +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQAAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENYGSVKVV  94



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPALR+RSRQPVKRY KL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKNP RIPKI   LE RCYKELR+
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRN  90



>ref|XP_010508669.1| PREDICTED: uncharacterized protein LOC104785201 isoform X1 [Camelina 
sativa]
 ref|XP_010508670.1| PREDICTED: uncharacterized protein LOC104785201 isoform X2 [Camelina 
sativa]
Length=1026

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+CI CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKN  R+PKI+  LE RCYKELR+
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRN  89



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CPA+R+RSRQPVKRY KL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +KNP RIPKI+  LE RCYKELR+ + +   ++
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIV  98



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            M ++SR ++P C S+C  CPALR RSR P+KRY K LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP R+PKI   LE RCY+ELR+ + + V V+
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVV  94



>gb|KJB71806.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=778

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KLLA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS  386
            A++NP RIPKI   LE RC+K+LR+
Sbjct  61   ASRNPLRIPKITSNLEQRCFKDLRN  85



>ref|XP_010413002.1| PREDICTED: uncharacterized protein LOC104699388 [Camelina sativa]
Length=1046

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+CI CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKN  R+PKI+  LE RCYKELR+
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRN  89



>ref|XP_006597228.1| PREDICTED: uncharacterized protein LOC100811354 isoform X1 [Glycine 
max]
 ref|XP_006597229.1| PREDICTED: uncharacterized protein LOC100811354 isoform X2 [Glycine 
max]
Length=967

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ P C ++C+ CP+LR+RSRQPVKRY K +ADIFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQAAEPNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI   LE RCYK+LR+ +   V V+
Sbjct  61   ASKNPLRIPKITDNLEQRCYKDLRNENYGSVKVV  94



>gb|KHG08769.1| Protein EFR3 B [Gossypium arboreum]
Length=1010

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ PAC S+C  CP+LR+RSRQPVKRY  L+ADIFP+  +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPSLRTRSRQPVKRYKVLIADIFPRKKEDGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            +KNP RIPKI + LE RCYKELR+ + + V ++
Sbjct  66   SKNPLRIPKITESLEQRCYKELRNENFQSVKIV  98



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRY KL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
             KNP RIPKI   LE RCYKELR+ + +   ++
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIV  98



>gb|EAY92960.1| hypothetical protein OsI_14753 [Oryza sativa Indica Group]
Length=279

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRY  +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRS---GHTKLVNVI  413
             ++NP R+PKI   LE R YKELRS   G  K+V +I
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLI  97



>gb|KEH39475.1| cyclin-like protein [Medicago truncatula]
Length=949

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRY KL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+     V VI
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVI  94



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++C  CP++R+RSRQPVKRY KL+AD FPK+P+G  N R I KLCEY
Sbjct  1    MGMVSRQVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTPEGEPNNRMIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A KNP RIPKI + LE + YK LR+ H  L  V+
Sbjct  61   ACKNPMRIPKITECLEQKFYKALRNEHFSLAKVV  94



>ref|XP_003597513.1| EFR3-like protein [Medicago truncatula]
 gb|AES67764.1| cyclin-like protein [Medicago truncatula]
Length=969

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEY  311
            MG++SR++ PAC ++CI CP+LR+RSRQPVKRY KL+A+I P++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCIFCPSLRARSRQPVKRYKKLIAEILPRNKVAELNDRKIGKLCEY  60

Query  312  AAKNPFRIPKIAKRLE*RCYKELRSGHTKLVNVI  413
            A+KNP RIPKI + LE RCYK+LR+     V VI
Sbjct  61   ASKNPLRIPKITENLEQRCYKDLRNESFGSVKVI  94



>ref|XP_002881801.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58060.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
Length=1025

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  135  GLLSRKLFPACESMCICCPALRSRSRQPVKRYTKLLADIFPKSPDGSANGRKIMKLCEYA  314
            G++SR++ P C S+CI CPALR+RSRQPVKRY KL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGINDRKIGKLCEYA  65

Query  315  AKNPFRIPKIAKRLE*RCYKELRS  386
            AKN  R+PKI+  LE +CYKELR+
Sbjct  66   AKNAVRMPKISDSLEQKCYKELRN  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875