BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS161E04

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    169   2e-45   Nicotiana tomentosiformis
ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    169   2e-45   Nicotiana tomentosiformis
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    168   5e-45   Nicotiana benthamiana
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    168   7e-45   Nicotiana benthamiana
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    167   2e-44   Nicotiana tomentosiformis
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    166   2e-44   Nicotiana sylvestris
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    166   2e-44   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    165   5e-44   Nicotiana benthamiana
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    165   7e-44   
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    165   8e-44   Solanum tuberosum [potatoes]
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    163   2e-43   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    156   1e-40   Fragaria vesca subsp. vesca
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    155   1e-40   Nicotiana benthamiana
gb|KJB19711.1|  hypothetical protein B456_003G116200                    151   2e-39   Gossypium raimondii
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           152   3e-39   Gossypium arboreum [tree cotton]
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    149   3e-39   
gb|ADN33858.1|  ATP-dependent clp protease                              152   4e-39   Cucumis melo subsp. melo
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   4e-39   Cucumis melo [Oriental melon]
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   5e-39   Solanum tuberosum [potatoes]
gb|KJB19712.1|  hypothetical protein B456_003G116200                    151   6e-39   Gossypium raimondii
gb|KJB19710.1|  hypothetical protein B456_003G116200                    151   6e-39   Gossypium raimondii
emb|CBI15747.3|  unnamed protein product                                149   9e-39   Vitis vinifera
ref|XP_010099042.1|  Chaperone protein ClpC                             147   1e-38   
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    149   2e-38   Vitis vinifera
emb|CDO98310.1|  unnamed protein product                                149   2e-38   Coffea canephora [robusta coffee]
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    149   3e-38   
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    149   3e-38   Solanum lycopersicum
ref|XP_007038115.1|  CLPC                                               149   3e-38   
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         149   4e-38   Jatropha curcas
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    148   5e-38   
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    148   7e-38   Prunus mume [ume]
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    148   7e-38   Solanum tuberosum [potatoes]
ref|XP_002511102.1|  ATP-dependent clp protease, putative               147   1e-37   Ricinus communis
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             146   3e-37   Prunus persica
gb|EPS63111.1|  hypothetical protein M569_11677                         137   3e-37   Genlisea aurea
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    144   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    144   2e-36   Cucumis melo [Oriental melon]
gb|AAD02267.1|  ClpC protease                                           144   2e-36   Spinacia oleracea
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    143   3e-36   Cucumis sativus [cucumbers]
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    143   3e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB07945.1|  hypothetical protein B456_001G054700                    142   6e-36   Gossypium raimondii
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     139   9e-36   Eucalyptus grandis [rose gum]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             141   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    140   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    140   6e-35   Eucalyptus grandis [rose gum]
ref|XP_002865831.1|  heat shock protein 93-V                            139   6e-35   
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          138   2e-34   Medicago truncatula
gb|AAC04687.1|  ClpC                                                    137   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             137   4e-34   Capsella rubella
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    129   5e-34   Phoenix dactylifera
emb|CDX83052.1|  BnaA01g20520D                                          137   5e-34   
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    137   6e-34   Brassica rapa
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   7e-34   Tarenaya hassleriana [spider flower]
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             137   7e-34   Phaseolus vulgaris [French bean]
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               133   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   7e-34   Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    136   7e-34   Tarenaya hassleriana [spider flower]
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    136   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    136   8e-34   
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    136   1e-33   Cicer arietinum [garbanzo]
ref|XP_002877635.1|  AtClpC                                             136   1e-33   
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             135   2e-33   
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    135   2e-33   Populus euphratica
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             135   2e-33   
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    135   2e-33   Pisum sativum [garden pea]
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    135   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    135   2e-33   Elaeis guineensis
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             135   3e-33   
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   3e-33   
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    134   5e-33   Sesamum indicum [beniseed]
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    134   6e-33   
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    134   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    134   6e-33   Medicago truncatula
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    134   7e-33   Glycine max [soybeans]
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    133   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    133   2e-32   Malus domestica [apple tree]
emb|CDX68504.1|  BnaC01g25820D                                          133   2e-32   
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    133   2e-32   Glycine max [soybeans]
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   132   2e-32   Glycine soja [wild soybean]
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    132   2e-32   Populus euphratica
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    132   3e-32   Brassica rapa
emb|CDY45800.1|  BnaC03g16230D                                          132   3e-32   Brassica napus [oilseed rape]
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             131   5e-32   Phaseolus vulgaris [French bean]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    130   1e-31   Phoenix dactylifera
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    130   1e-31   Phoenix dactylifera
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                129   2e-31   Erythranthe guttata [common monkey flower]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    127   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    129   4e-31   
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          128   9e-31   Medicago truncatula
emb|CAB87915.1|  AtClpC                                                 127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566912.2|  Clp ATPase                                            127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190035.1|  Clp ATPase                                         127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    126   4e-30   Elaeis guineensis
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             126   4e-30   Eutrema salsugineum [saltwater cress]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    125   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    125   8e-30   Glycine max [soybeans]
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   125   9e-30   Glycine soja [wild soybean]
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    125   1e-29   Glycine max [soybeans]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    124   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    124   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    124   2e-29   Cicer arietinum [garbanzo]
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    123   3e-29   Elaeis guineensis
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    121   1e-28   
emb|CDY05878.1|  BnaC08g20550D                                          120   3e-28   
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254              113   6e-28   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    119   6e-28   Citrus sinensis [apfelsine]
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    119   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    118   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    117   4e-27   Brachypodium distachyon [annual false brome]
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    117   4e-27   Brachypodium distachyon [annual false brome]
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    117   5e-27   Brassica napus [oilseed rape]
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    113   1e-26   Triticum urartu
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    112   7e-26   
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    114   7e-26   Setaria italica
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    113   9e-26   Triticum urartu
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...    108   2e-25   Triticum urartu
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    112   2e-25   Zea mays [maize]
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       112   2e-25   Cucumis sativus [cucumbers]
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    112   2e-25   Setaria italica
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          111   4e-25   Sorghum bicolor [broomcorn]
gb|EEC77204.1|  hypothetical protein OsI_15716                          110   7e-25   Oryza sativa Indica Group [Indian rice]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    110   9e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05148.2|  OSJNBa0039C07.4                                        110   9e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          110   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360             102   1e-24   Chlamydomonas reinhardtii
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    110   1e-24   
dbj|BAJ99801.1|  predicted protein                                      109   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    109   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    108   4e-24   Setaria italica
ref|NP_001169540.1|  uncharacterized protein LOC100383416               108   5e-24   Zea mays [maize]
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    108   6e-24   Oryza brachyantha
ref|WP_032558761.1|  hypothetical protein                             99.8    1e-23   
ref|WP_032554674.1|  hypothetical protein                             99.8    1e-23   
ref|WP_032553896.1|  hypothetical protein                             99.8    2e-23   
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     103   2e-23   Monoraphidium neglectum
ref|XP_001756645.1|  predicted protein                                  106   3e-23   
ref|XP_001779162.1|  predicted protein                                  106   3e-23   
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             105   4e-23   
emb|CAN78847.1|  hypothetical protein VITISV_010724                     105   5e-23   Vitis vinifera
ref|NP_001066442.1|  Os12g0230100                                       105   5e-23   
gb|EDZ93048.1|  Clp domain protein                                      102   6e-23   Arthrospira maxima CS-328
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              105   8e-23   Volvox carteri f. nagariensis
gb|EEC69045.1|  hypothetical protein OsI_37876                          105   1e-22   Oryza sativa Indica Group [Indian rice]
gb|AAB67745.1|  ClpC                                                    104   1e-22   Synechococcus elongatus PCC 7942
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     104   1e-22   Synechococcus elongatus PCC 6301
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     104   1e-22   Nostoc sp. PCC 7524
gb|AFW96628.1|  ATP-dependent Clp family protein                        104   1e-22   Anabaena sp. 90
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     104   1e-22   Monoraphidium neglectum
ref|WP_032555672.1|  hypothetical protein                             95.9    1e-22   
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    104   1e-22   Nostoc sp. PCC 7120
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             104   1e-22   Selaginella moellendorffii
gb|EHC12174.1|  ATPase AAA-2 domain protein                             103   2e-22   Fischerella thermalis
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             103   2e-22   
gb|ABK95905.1|  unknown                                                 103   2e-22   Populus trichocarpa [western balsam poplar]
ref|WP_044105586.1|  Clp protease ClpX                                  103   2e-22   cyanobacterium endosymbiont of Epithemia turgida
emb|CDX84888.1|  BnaA03g13420D                                          103   2e-22   
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    102   3e-22   
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    103   3e-22   Chamaesiphon minutus
ref|WP_038544339.1|  Clp protease ClpX                                  103   3e-22   Synechococcus sp. KORDI-100
ref|WP_028951828.1|  Clp protease ClpX                                  103   3e-22   Synechococcus sp. CC9616
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    103   3e-22   
ref|WP_015107874.1|  chaperone ATPase                                   103   3e-22   Cyanobium gracile
ref|WP_039899756.1|  Clp protease ClpX                                  103   3e-22   Microcystis sp. T1-4
ref|WP_038554285.1|  Clp protease ClpX                                  103   3e-22   Synechococcus sp. KORDI-52
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. RS9917
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. CB0205
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. CC9605
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus
ref|WP_041428551.1|  Clp protease ClpX                                  103   3e-22   Synechococcus sp. WH 7803
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. RS9916
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Acaryochloris marina
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. WH 8016
gb|AHF63374.1|  ATPase                                                  103   3e-22   Synechococcus sp. WH 8109
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. CB0101
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     103   3e-22   Synechococcus sp. WH 5701
ref|WP_043691512.1|  Clp protease ClpX                                  103   4e-22   Synechococcus sp. KORDI-49
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Cyanobium sp. PCC 7001
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Microcystis aeruginosa
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Acaryochloris sp. CCMEE 5410
ref|NP_050661.1|  Clp protease ATP binding subunit                      103   4e-22   Guillardia theta
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Synechococcus sp. WH 7805
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Synechococcus sp. RCC307
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Microcystis aeruginosa
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Microcystis aeruginosa
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Microcystis aeruginosa
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     103   4e-22   Synechococcus sp. CC9311
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    103   4e-22   Microcystis
ref|YP_001293474.1|  Clp protease ATP binding subunit                   103   4e-22   Rhodomonas salina
ref|XP_007509860.1|  predicted protein                                  103   4e-22   Bathycoccus prasinos
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    103   4e-22   Richelia intracellularis
ref|WP_041555480.1|  Clp protease ClpX                                  103   4e-22   Nostoc sp. PCC 7524
ref|WP_044521582.1|  Clp protease ClpX                                  103   4e-22   Nostocaceae
ref|WP_028082153.1|  Clp protease ClpX                                  102   4e-22   Dolichospermum circinale
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    102   4e-22   Richelia intracellularis
ref|WP_015128787.1|  ATPase                                             102   4e-22   Calothrix sp. PCC 7507
ref|WP_039740335.1|  Clp protease ClpX                                  102   4e-22   
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     102   4e-22   Nostoc punctiforme
ref|WP_029638478.1|  Clp protease ClpX [                                102   4e-22   [Scytonema hofmanni] UTEX B 1581
ref|WP_015111477.1|  ATPase                                             102   4e-22   Nostoc sp. PCC 7107
ref|WP_028090149.1|  Clp protease ClpX                                  102   4e-22   Dolichospermum circinale
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        102   4e-22   Gloeocapsa sp. PCC 7428
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     102   4e-22   Trichormus azollae
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     102   4e-22   Anabaena sp. PCC 7108
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    102   4e-22   Planktothrix
ref|WP_041458572.1|  Clp protease ClpX                                  102   5e-22   Anabaena sp. 90
gb|KIE07407.1|  Clp protease ClpX                                       102   5e-22   Tolypothrix bouteillei VB521301
ref|WP_027404746.1|  Clp protease ClpX                                  102   5e-22   Aphanizomenon flos-aquae
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Oscillatoria sp. PCC 10802
gb|KIJ80614.1|  Clp protease ClpX                                       102   5e-22   Scytonema tolypothrichoides VB-61278
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    102   5e-22   Lyngbya confervoides
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Trichormus variabilis
ref|WP_039200429.1|  Clp protease ClpX                                  102   5e-22   Aphanizomenon flos-aquae
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   5e-22   Synechococcus
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        102   5e-22   Gloeobacter kilaueensis
ref|WP_037222416.1|  Clp protease ClpX                                  102   5e-22   
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        102   5e-22   Pseudanabaena biceps
ref|WP_015166218.1|  ATPase                                             102   5e-22   Pseudanabaena sp. PCC 7367
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Scytonema hofmannii
ref|WP_026097796.1|  Clp protease ClpX                                  102   5e-22   Geitlerinema sp. PCC 7105
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Nodularia spumigena
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Trichodesmium erythraeum
ref|WP_027842712.1|  Clp protease ClpX                                  102   5e-22   Mastigocoleus testarum
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Mastigocladopsis repens
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        102   5e-22   Anabaena cylindrica
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    102   5e-22   Planktothrix
gb|AGW80480.1|  Clp protease ATP binding subunit                        102   5e-22   Planktothrix agardhii NIVA-CYA 68
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Synechococcus sp. PCC 7335
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    102   5e-22   Leptolyngbya sp. PCC 7375
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    102   5e-22   Cylindrospermum stagnale
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Pseudanabaena sp. PCC 6802
ref|WP_036485541.1|  Clp protease ClpX                                  102   5e-22   Myxosarcina sp. GI1
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Fortiea contorta
ref|WP_042153862.1|  Clp protease ClpX                                  102   5e-22   Planktothrix agardhii
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Lyngbya sp. PCC 8106
ref|WP_041035515.1|  Clp protease ClpX                                  102   5e-22   Tolypothrix campylonemoides
ref|WP_035153450.1|  Clp protease ClpX                                  102   5e-22   Calothrix sp. 336/3
ref|WP_041677108.1|  Clp protease ClpX                                  102   5e-22   Synechococcus elongatus
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Geminocystis herdmanii
ref|WP_015126250.1|  chaperone ATPase                                   102   5e-22   Synechococcus sp. PCC 6312
ref|WP_027250152.1|  Clp protease ClpX                                  102   5e-22   Planktothrix agardhii
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    102   5e-22   Rubidibacter lacunae
ref|WP_015166859.1|  chaperone ATPase                                   102   5e-22   Synechococcus sp. PCC 7502
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Aphanizomenonaceae
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Aphanizomenonaceae
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    102   5e-22   Leptolyngbya sp. PCC 6406
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   5e-22   Kamptonema
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     102   5e-22   Leptolyngbya sp. Heron Island J
ref|WP_015117004.1|  chaperone ATPase                                   102   5e-22   Rivularia sp. PCC 7116
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Cyanothece sp. PCC 7425
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Synechococcus sp. PCC 7336
ref|WP_040943370.1|  Clp protease ClpX                                  102   5e-22   
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Spirulina subsalsa
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    102   5e-22   Oscillatoriales cyanobacterium JSC-12
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Coleofasciculus chthonoplastes
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Gloeobacter violaceus
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Calothrix sp. PCC 7103
ref|WP_015201320.1|  ATPase                                             102   5e-22   Crinalium epipsammum
ref|WP_035989117.1|  Clp protease ClpX                                  102   5e-22   Leptolyngbya sp. KIOST-1
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        102   5e-22   Stanieria cyanosphaera
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Cyanothece sp. CCY0110
ref|WP_015200797.1|  ATPase                                             102   5e-22   Calothrix parietina
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Prochlorothrix hollandica
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   5e-22   Oscillatoriales
ref|WP_040939432.1|  Clp protease ClpX                                  102   5e-22   
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Synechococcus sp. CC9902
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Pleurocapsa sp. PCC 7319
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   cyanobacterium PCC 7702
ref|WP_015170572.1|  ATPase                                             102   5e-22   Geitlerinema sp. PCC 7407
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   Cyanothece sp. PCC 8801
ref|WP_036000319.1|  Clp protease ClpX                                  102   5e-22   [Leptolyngbya] sp. JSC-1
ref|WP_015145231.1|  chaperone ATPase                                   102   5e-22   Pleurocapsa minor
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   
ref|WP_015227883.1|  chaperone ATPase                                   102   5e-22   
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     102   5e-22   
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_026734190.1|  Clp protease ClpX                                  102   6e-22   
ref|WP_023066904.1|  istB-like ATP binding family protein               102   6e-22   
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_015185589.1|  chaperone ATPase                                   102   6e-22   
ref|WP_015147858.1|  chaperone ATPase                                   102   6e-22   
ref|WP_015225278.1|  ATPase                                             102   6e-22   
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    102   6e-22   
ref|WP_015219504.1|  ATPase                                             102   6e-22   
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   6e-22   
ref|WP_040054326.1|  Clp protease ClpX                                  102   6e-22   
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    102   6e-22   
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    102   6e-22   
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   6e-22   
ref|WP_026722984.1|  Clp protease ClpX                                  102   6e-22   
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   6e-22   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_028949334.1|  Clp protease ClpX                                  102   6e-22   
ref|WP_026086125.1|  Clp protease ClpX                                  102   6e-22   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     102   6e-22   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     102   7e-22   
gb|EEE52971.1|  hypothetical protein OsJ_35634                          102   7e-22   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    102   7e-22   
ref|WP_036906575.1|  Clp protease ClpX                                  102   8e-22   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      102   8e-22   
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     102   8e-22   
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     102   8e-22   
ref|WP_038653496.1|  Clp protease ClpX                                  102   9e-22   
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    102   9e-22   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     102   9e-22   
ref|WP_015157369.1|  ATPase                                             102   1e-21   
ref|WP_039713557.1|  Clp protease ClpX                                  102   1e-21   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    102   1e-21   
ref|WP_036902654.1|  Clp protease ClpX                                  101   1e-21   
ref|WP_036909986.1|  Clp protease ClpX                                  101   1e-21   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    101   1e-21   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     101   1e-21   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     101   1e-21   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935           99.0    1e-21   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    101   1e-21   
ref|WP_015132374.1|  ATPase                                             101   1e-21   
ref|WP_024545676.1|  Clp protease ClpX                                  101   1e-21   
ref|WP_030006722.1|  Clp protease ClpX                                  101   1e-21   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     101   1e-21   
ref|XP_002505550.1|  predicted protein                                  101   2e-21   
emb|CDY64710.1|  BnaA06g38690D                                          101   2e-21   
ref|WP_015223717.1|  ATPase                                             101   2e-21   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      100   2e-21   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     100   2e-21   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     100   2e-21   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    100   2e-21   
ref|WP_032527486.1|  Clp protease ClpX                                  100   2e-21   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              100   3e-21   
ref|WP_019474998.1|  hypothetical protein                               100   3e-21   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    100   3e-21   
ref|WP_029976482.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025968127.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025923359.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_032523561.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025955884.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_032514205.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025941830.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025954710.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     100   3e-21   
ref|WP_025944115.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025894690.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_042850567.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025970276.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025959792.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_025928515.1|  Clp protease ClpX                                  100   3e-21   
ref|WP_032519126.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025972244.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    100   4e-21   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    100   4e-21   
ref|WP_025893396.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    100   4e-21   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|WP_025935959.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    100   4e-21   
ref|WP_025926674.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025914744.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|WP_025964345.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025961281.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    100   4e-21   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|WP_032524589.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025924610.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_032515069.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025956785.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025906631.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_032516684.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025962478.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025965623.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025958425.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025932059.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|XP_001766010.1|  predicted protein                                  100   4e-21   
ref|WP_032522603.1|  Clp protease ClpX                                  100   4e-21   
ref|WP_025930513.1|  Clp protease ClpX                                  100   4e-21   
gb|AJA71272.1|  HSP100                                                  100   4e-21   
ref|YP_007947862.1|  Clp protease ATP binding subunit                   100   4e-21   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     100   4e-21   
gb|ADJ57429.1|  clp protease ATP binding subunit                        100   4e-21   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...  97.1    4e-21   
ref|WP_036896901.1|  Clp protease ClpX                                  100   5e-21   
gb|AIA21360.1|  Clp protease ATP binding subunit                        100   5e-21   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    100   5e-21   
ref|YP_009027615.1|  Clp protease ATP binding subunit                   100   5e-21   
ref|XP_001766888.1|  predicted protein                                  100   5e-21   
gb|AIA21566.1|  Clp protease ATP binding subunit                        100   5e-21   
gb|AFC40000.1|  Clp protease ATP binding subunit                      99.8    5e-21   
ref|YP_537014.1|  Clp protease ATP binding subunit                    99.8    5e-21   
ref|NP_053942.1|  Clp protease ATP binding subunit                    99.8    5e-21   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit    99.8    6e-21   
emb|CEG02027.1|  Clp, N-terminal                                      99.8    6e-21   
ref|WP_025781797.1|  Clp protease ClpX                                99.8    6e-21   
ref|WP_026735736.1|  hypothetical protein                             94.4    6e-21   
ref|YP_277337.1|  Clp protease ATP binding subunit                    99.4    7e-21   
ref|YP_007627346.1|  Clp protease ATP binding subunit                 99.4    8e-21   
gb|AJH65889.1|  ATP-dependent Clp protease                            99.4    9e-21   
ref|YP_007878188.1|  Clp protease ATP binding subunit                 99.0    9e-21   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                99.0    9e-21   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...  99.0    1e-20   
gb|AJO68399.1|  Clp protease ATP binding subunit                      99.0    1e-20   
ref|NP_045112.1|  Clp protease ATP binding subunit                    99.0    1e-20   
ref|YP_063564.1|  Clp protease ATP binding subunit                    99.0    1e-20   
ref|YP_009019572.1|  Clp protease ATP binding subunit                 99.0    1e-20   
ref|XP_003063658.1|  predicted protein                                98.6    2e-20   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type              98.2    2e-20   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...  97.4    4e-20   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...  97.4    4e-20   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...  97.4    4e-20   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...  97.1    4e-20   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...  97.1    4e-20   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...  97.1    5e-20   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...  96.7    6e-20   
gb|ABG51946.1|  TPR repeat containing protein                         97.4    7e-20   
ref|WP_017285691.1|  hypothetical protein                             93.6    7e-20   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit        96.3    9e-20   
ref|YP_005088687.1|  Clp protease ATP binding subunit                 96.3    1e-19   
ref|YP_008145463.1|  Clp protease ATP binding subunit                 95.9    1e-19   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)        95.5    2e-19   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C            95.5    2e-19   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...  94.7    4e-19   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain              91.7    4e-19   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...  94.0    5e-19   
ref|YP_009051035.1|  Clp protease ATP binding subunit                 94.0    5e-19   
ref|NP_849021.1|  Clp protease ATP binding subunit                    94.0    6e-19   
ref|WP_032525473.1|  hypothetical protein                             86.7    1e-18   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...  93.2    1e-18   
ref|YP_007476253.1|  Clp protease ATP binding subunit                 92.8    1e-18   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein   92.4    2e-18   
emb|CCI36398.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  92.0    3e-18   
ref|WP_015197969.1|  Clp domain-containing protein                    90.9    4e-18   
emb|CCI17334.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  91.3    6e-18   
ref|YP_003359282.1|  Clp protease ATP binding subunit                 90.5    9e-18   
gb|ELS44939.1|  clp amino terminal domain protein                     90.9    1e-17   
emb|CAO87136.1|  unnamed protein product                              90.9    1e-17   
ref|WP_039961643.1|  Clp protease ClpX, partial [                     89.4    2e-17   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein   89.4    2e-17   
ref|WP_013321074.1|  Clp domain-containing protein                    89.4    3e-17   
gb|AJH65844.1|  ATP-dependent Clp protease                            89.0    3e-17   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein   88.6    4e-17   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein   88.6    4e-17   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein   88.6    5e-17   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein   88.2    5e-17   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                      88.2    5e-17   
ref|WP_009630510.1|  ATPase with chaperone activity, ATP-binding ...  87.8    8e-17   
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166            87.4    9e-17   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                           87.4    1e-16   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein   87.4    1e-16   
ref|WP_015126728.1|  ATPase                                           87.4    1e-16   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein   87.4    1e-16   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit   87.4    1e-16   
ref|WP_015137763.1|  chaperone ATPase                                 87.0    1e-16   
ref|WP_044292615.1|  Clp protease ClpX                                87.0    1e-16   
ref|WP_017716489.1|  ATP-dependent Clp protease ATP-binding protein   87.0    1e-16   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein   87.0    1e-16   
ref|WP_027845315.1|  Clp protease ClpX                                87.0    1e-16   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit   87.0    1e-16   
ref|WP_026735213.1|  Clp protease ClpX                                86.7    2e-16   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein   86.7    2e-16   
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein   86.7    2e-16   
gb|KIJ85031.1|  Clp protease ClpX                                     86.3    3e-16   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...  86.3    3e-16   
gb|KIE09004.1|  Clp protease ClpX                                     86.3    3e-16   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein   86.3    3e-16   
gb|KDO51290.1|  hypothetical protein CISIN_1g003094mg                 86.3    3e-16   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein   85.9    3e-16   
ref|WP_041038849.1|  Clp protease ClpX                                85.9    3e-16   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein   85.9    3e-16   
ref|WP_029638259.1|  Clp protease ClpX [                              85.9    3e-16   
ref|WP_042466185.1|  Clp protease ClpX                                85.9    3e-16   
gb|EMT20629.1|  ATP-dependent Clp protease ATP-binding subunit cl...  85.5    4e-16   
gb|AFR24744.1|  ATP-dependent clp protease ATP-binding subunit        85.9    4e-16   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit   85.5    4e-16   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein   85.5    4e-16   
ref|XP_003576089.1|  PREDICTED: chaperone protein ClpC2, chloropl...  85.9    4e-16   
ref|WP_015199655.1|  ATPase                                           85.5    5e-16   
gb|AFY44720.1|  Clp domain protein                                    84.7    5e-16   
ref|WP_039752731.1|  Clp protease ClpX                                85.1    6e-16   
ref|WP_015113826.1|  ATPase                                           85.1    7e-16   
ref|WP_035148903.1|  Clp protease ClpX                                85.1    7e-16   
ref|WP_006196989.1|  ATP-dependent Clp protease ATP-binding protein   84.7    8e-16   
ref|WP_015147677.1|  chaperone ATPase                                 84.7    1e-15   
ref|WP_026723037.1|  Clp protease ClpX                                84.3    1e-15   
ref|WP_009453815.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  84.3    1e-15   



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG NA+DT+ RSGQ
Sbjct  15   IPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCNAIDTLVRSGQ  70

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  71   TLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  130

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  131  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  165



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG NA+DT+ RSGQ
Sbjct  23   IPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCNAIDTLVRSGQ  78

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  79   TLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  138

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  139  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  173



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG NA+DT+ RSGQ
Sbjct  11   IPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCNAVDTLVRSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG NA+DT+ RSGQ
Sbjct  11   IPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCNAVDTLVRSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG NA+DT+ +SGQ
Sbjct  11   IPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCNAIDTLVKSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TLHSKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLHSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG NA+DT+ +SGQ
Sbjct  11   IPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCNAVDTLVKSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG NA+DT+ RS Q
Sbjct  11   IPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCNAIDTLVRSEQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG NA+DT+ +SGQ
Sbjct  11   IPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCNAIDTLVKSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG NA+DT+ RSGQ
Sbjct  11   IPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCNAIDTLVRSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG NA+DT+ RSGQ
Sbjct  11   IPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCNAIDTLVRSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG NA+DT+ RSG+
Sbjct  11   IPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCNAIDTLVRSGE  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  NALD MAR GQ
Sbjct  11   IPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVNALDIMARPGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             L+SKV  A S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DLYSKVGVAISSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 130/170 (76%), Gaps = 19/170 (11%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG NA+DT+ +SGQ
Sbjct  11   IPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCNAIDTLVKSGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFV--------  337
            TLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHNFV        
Sbjct  67   TLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  338  -------gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
                      +ILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  176



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R   M+CS Q+P L++RSF+GLRG N+LD + R GQ  HSKV  + S RRGRGSR V KA
Sbjct  31   RSAKMMCSLQTPGLRIRSFSGLRGSNSLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKA  90

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  151  VEVEKIIGRGS  161



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R   M+CS Q+P L++RSF+GLRG N+LD + R GQ  HSKV  + S +RGRGSR V KA
Sbjct  31   RSAKMMCSLQTPGLRIRSFSGLRGSNSLDNIVRYGQDFHSKVGISISSQRGRGSRCVPKA  90

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  151  VEVEKIIGRGS  161



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N+LD M RS Q
Sbjct  11   IPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFNSLDNMLRSRQ  67

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  68   NFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  127

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N+LD M RSGQ
Sbjct  11   IPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFNSLDNMLRSGQ  67

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  68   DFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  127

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N+LD M RSGQ
Sbjct  11   IPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFNSLDNMLRSGQ  67

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  68   DFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  127

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 127/152 (84%), Gaps = 5/152 (3%)
 Frame = +2

Query  14   VAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTM-ARSGQTLH  190
            VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG NALDT+  +SG+TLH
Sbjct  17   VAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRGCNALDTLLVKSGETLH  72

Query  191  SKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillglig  370
            SKVAAAT  RR +G R V KAMFERFTEKAIK IMLAQ+EARRLGH+FVGTEQILLGLIG
Sbjct  73   SKVAAATFVRRSQGCRFVPKAMFERFTEKAIKGIMLAQDEARRLGHDFVGTEQILLGLIG  132

Query  371  egtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            EGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  133  EGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  164



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R   M+CS Q+P L++RSF+GLRG N+LD + R GQ  HSKV  + S RRGRGSR V KA
Sbjct  31   RSAKMMCSLQTPGLRIRSFSGLRGSNSLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKA  90

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  151  VEVEKIIGRGS  161



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R   M+CS Q+P L++RSF+GLRG N+LD + R GQ  HSKV  + S RRGRGSR V KA
Sbjct  31   RSAKMMCSLQTPGLRIRSFSGLRGSNSLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKA  90

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  151  VEVEKIIGRGS  161



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+C+ Q+P L++R F+GLRG NALD + RSG   HS+VAAA S R G+ SR V +AMF
Sbjct  81   VKMMCNVQAPGLRIRGFSGLRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMF  140

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  200

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  201  VEKIIGRGS  209



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  NALDTM R GQ
Sbjct  11   VPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFNALDTMMRPGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              +SKVA   S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFYSKVAITRSSRRQKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+C+ Q+P L++R F+GLRG NALD + RSG   HS+VAAA S R G+ SR V +AMF
Sbjct  33   VKMMCNVQAPGLRIRGFSGLRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMF  92

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  93   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  152

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  153  VEKIIGRGS  161



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            + SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  NALD M ++GQ
Sbjct  11   VSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSNALDMMVKTGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            +LHSKVA ATS RRGRGSR   +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   SLHSKVAIATSSRRGRGSRMAPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 129/156 (83%), Gaps = 6/156 (4%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTM-ARSG  178
            +PS VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG NALDT+  +SG
Sbjct  13   LPS-VAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGCNALDTLLVKSG  67

Query  179  QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqill  358
            +TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL
Sbjct  68   ETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL  127

Query  359  gligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  163



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 129/156 (83%), Gaps = 6/156 (4%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTM-ARSG  178
            +PS VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG NALDT+  +SG
Sbjct  13   LPS-VAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGCNALDTLLVKSG  67

Query  179  QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqill  358
            +TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL
Sbjct  68   ETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL  127

Query  359  gligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  163



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CS Q+P L++RSF+GLRG N+LD M R GQ   SKVA + S RRGRGSR V KAMFER
Sbjct  35   MMCSLQTPGLRIRSFSGLRGSNSLDNMVRFGQDFRSKVAISISSRRGRGSRCVPKAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CS++ P+L LR F+GLR  N LDT+ RSGQ  HS+VA + S R+ +  R + +AMFER
Sbjct  36   MMCSTRPPALTLRGFSGLRNSNCLDTLLRSGQDFHSRVAISMSRRQQKAKRFLPRAMFER  95

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  96   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  155

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  156  KIIGRGS  162



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N+LD M RS Q
Sbjct  11   IPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFNSLDNMLRSRQ  67

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  68   NFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  127

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  NALD MA+ GQ
Sbjct  11   IPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVNALDIMAKPGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              +SK+  A + RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFYSKMGVAITSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 127/156 (81%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTM-ARSG  178
            I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG NALDT+  +SG
Sbjct  11   ILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCNALDTLLVKSG  66

Query  179  QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqill  358
            +TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL
Sbjct  67   ETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL  126

Query  359  gligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CSS+ P+L LR +TGLR  N LDTM RSG   HS+VA   S R+ +  R + +AMFER
Sbjct  36   MMCSSRLPALTLRGYTGLRSSNCLDTMLRSGLDFHSRVAITMSRRQQKAKRFLPRAMFER  95

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  96   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  155

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  156  KIIGRGS  162



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 120/155 (77%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  NALD MA+ GQ
Sbjct  11   IPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVNALDIMAKPGQ  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              +SK+  A + RR        KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFYSKMGVAITSRRKASRCVP-KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = +2

Query  74   RVVAMLCSSQ-SPSLKLRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrg-rgsrav  244
            R V MLCSS+ +P+  +RSF+G RG N LD +  +S QTLHSKVA A    R  R +R  
Sbjct  32   RAVTMLCSSRLAPARTMRSFSGFRGVNVLDRLVQKSSQTLHSKVAEAAGPSRRGRRTRMA  91

Query  245  vKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLK  424
             +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLK
Sbjct  92   PRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLK  151

Query  425  DARVEVEKIIGRGS  466
            DARVEVEKIIGRGS
Sbjct  152  DARVEVEKIIGRGS  165



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSKV    S  +G+G R V KA
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSKVRLHISSCKGKGCRFVPKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  150  VEVEKIIGRGS  160



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +2

Query  5    PSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQT  184
            P+ + G  +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N+LD M R GQ 
Sbjct  8    PTNIPGLVVGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLNSLDNMFRPGQD  67

Query  185  LHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             HSK+A A S RR  R SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  68   FHSKMAIAISSRRVGRASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  127

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  463
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  128  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  161



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGNALDT+  + +
Sbjct  11   IPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGNALDTLGTTSE  65

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  66   CFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  250
            RVV M+ S  SP +++RSF+GLRG N+LD M R GQ  HSKVA A S RRG      V +
Sbjct  31   RVVKMMSSVHSPGMRMRSFSGLRGLNSLDNMFRPGQDFHSKVAIAISSRRGGRPSRGVPR  90

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  91   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  150

Query  431  RVEVEKIIGRG  463
            RVEVEKIIGRG
Sbjct  151  RVEVEKIIGRG  161



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGNALDT+  + +
Sbjct  11   IPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGNALDTLGSTSE  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   CFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 122/155 (79%), Gaps = 6/155 (4%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  +LD M R  Q
Sbjct  11   VPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGSTSLDNMVRVDQ  64

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  65   DFHSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  124

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  125  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  159



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +2

Query  5    PSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQT  184
            P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N+LDT+  S   
Sbjct  12   PAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSNSLDTLLNSSPD  67

Query  185  LHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgl  364
             HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL
Sbjct  68   FHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL  127

Query  365  igegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q   L+++ F GLRG NALDT+ +S Q  HSKV  A +  +G+ SR  VKAM
Sbjct  35   VKMMCSQLQVSGLRMQGFMGLRGNNALDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  74   RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  250
            R V M+CS  Q   L+++ F GLRG N LDT+ RS Q  HS+V  A +  +G+ SR V K
Sbjct  33   RPVKMMCSQLQVSGLRMQGFLGLRGNNVLDTLGRSRQDFHSRVRQAMNVPKGKASRCVTK  92

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  152

Query  431  RVEVEKIIGRGS  466
            RVEVEKIIGRGS
Sbjct  153  RVEVEKIIGRGS  164



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +2

Query  5    PSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQT  184
            P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N+LDT+  S   
Sbjct  12   PAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSNSLDTLLNSSPD  67

Query  185  LHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgl  364
             HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL
Sbjct  68   FHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL  127

Query  365  igegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +2

Query  5    PSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQT  184
            P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N+LDT+  S   
Sbjct  12   PAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSNSLDTLLNSSPD  67

Query  185  LHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgl  364
             HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL
Sbjct  68   FHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL  127

Query  365  igegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  IGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q   L+++ F GLRG NALDT+ ++ Q  HSKV  A +  +G+ SR  VKAM
Sbjct  35   VKMMCSQLQVSGLRMQGFLGLRGNNALDTLGKNRQDFHSKVRQAMNVPKGKASRFTVKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 121/155 (78%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N LDTM R G 
Sbjct  11   VPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTINHLDTMLRPGL  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              H+KV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFHAKVSMAISSRRARAKRIIPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+C   +  L ++ F GLRG NALDT+ +S Q  HSKV  A +  +G+ SR  VKAMF
Sbjct  35   VKMMCIIFNVWLPMQGFMGLRGNNALDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMF  94

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  95   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  154

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  155  VEKIIGRGS  163



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M    Q+P L+++ F GLRG N LD + RS Q  HSKV    S RRG+ SR + KAMFER
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSKVRLTMSSRRGKPSRCMPKAMFER  97

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  98   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  157

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  158  KIIGRGS  164



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q    +++ F GLRG NALDT+ ++ Q  HSKV  A +  +G+ SR   KAM
Sbjct  35   VKMMCSQLQVSGSRMQGFLGLRGSNALDTLGKTRQDFHSKVRQAMTVPKGKASRCTTKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ + +S  L+L+ F GLRG N LD ++RS Q  HS V+A  S  +G+  R V  AMFER
Sbjct  35   MMGNLRSHPLRLQDFAGLRGANNLDLLSRSRQDFHSLVSAYISSPQGKACRGVPVAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+ +SQ+P L ++SF+GLR  NA+D +AR      SKV    S R+G+ SR V KA
Sbjct  30   RCVKMMYTSQTPVLSIQSFSGLRAANAVDLIARPAHGFFSKVNLQISSRKGKSSRCVTKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  90   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  150  VEVEKIIGRGS  160



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+ +SQ+P L ++SF+GLR  NA+D +AR      SKV    S R+G+ SR V KA
Sbjct  30   RCVKMMYTSQTPVLSIQSFSGLRAANAVDLIARPAHGFFSKVNLQISSRKGKASRCVTKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  90   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  150  VEVEKIIGRGS  160



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+ + ++P L+++SF+GLR  N+LD +ARSG   HSKV   TS R+G+  R V KA
Sbjct  30   RYVKMMYNLEAPGLRIQSFSGLRSSNSLDFIARSGHDFHSKVRLQTSSRKGKACRFVPKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEA+RLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GINLK AR
Sbjct  90   MFERFTEKAIKVIMLAQEEAQRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGINLKYAR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  150  VEVEKIIGRGS  160



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N LD ++RS +
Sbjct  11   MPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVNNLDLLSRSRR  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            +L SK+  +TS RR R  R V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   SLPSKMLTSTSSRRERAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 4/128 (3%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFE  262
            MLC+S + S ++RSF+GLRG N++D M +   QTL SKV+ +  G++ R      +AMFE
Sbjct  35   MLCNSLATSARMRSFSGLRGANSIDMMLQKNIQTLQSKVSVSRRGKKIRTGA---RAMFE  91

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  92   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  151

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  152  EKIIGRGS  159



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  283
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  104

Query  284  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  463
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  105  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  164

Query  464  S  466
            S
Sbjct  165  S  165



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  283
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  111

Query  284  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  463
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  112  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  171

Query  464  S  466
            S
Sbjct  172  S  172



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 114/155 (74%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  NALD   +  +
Sbjct  11   IPSLVTGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSCYTGLRSVNALDISVKPRR  65

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             L S V  A + R  R SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  66   DLFSSVKFANTKRCERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ SS S  L +  ++GLR  N LDT+ R GQ+ HSKVA   S R+ +  R V +AMFER
Sbjct  36   MMSSSPSQGLVMSGYSGLRSANCLDTLLRHGQSFHSKVAITISPRQQKAKRFVPRAMFER  95

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  96   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  155

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  156  KIIGRGS  162



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 118/156 (76%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N LDTM R G 
Sbjct  11   VPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFNHLDTMLRPGL  66

Query  182  TLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqill  358
              HSKV+ A S  R   +   + KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL
Sbjct  67   DFHSKVSIAISSSRRARATRCIPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILL  126

Query  359  gligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  GLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  162



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+CS Q+P LK++SF+GLR  +ALD MAR       K   A S RR + SR V KAMF
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMARPSPGFLVKFKRAISSRREKASRCVPKAMF  115

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  176  VEKIIGRGS  184



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SKV    S R  +  R V KAMF
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSKVNRNISSRNEKARRCVPKAMF  90

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  91   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  150

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  151  VEKIIGRGS  159



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q    +++ F GLRG NALDT+  + Q  HSKV  + +  +G+ SR  VKAM
Sbjct  35   VKMMCSQLQVSGSRMQGFMGLRGSNALDTLGSTRQDFHSKVRQSMNVPKGKASRCTVKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q    +++ F GLRG NALDT+  + Q  HSKV  A +  +G+ SR  VKAM
Sbjct  35   VKMMCSQLQVSGSRMQGFMGLRGSNALDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  201  VEKIIGRGS  209



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CS  S  L +  ++GLR  N LDT+ R G + HSKVA   S R+ +  R V +AMFER
Sbjct  36   MMCSLPSRGLVISGYSGLRSANCLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFER  95

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  96   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  155

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  156  KIIGRGS  162



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CS  S  L +  ++GLR  N LDT+ R G + HSKVA   S R+ +  R V +AMFER
Sbjct  36   MMCSLPSRGLVISGYSGLRSANCLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFER  95

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  96   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  155

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  156  KIIGRGS  162



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N L+TM R G 
Sbjct  11   VPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFNHLNTMMRPGL  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M  +  +PSL LR F+GLR  NALD+M RS    HSKVAAA S  R + SR V  AMFER
Sbjct  32   MAYNIPAPSLMLRGFSGLRASNALDSMLRSHCNFHSKVAAAISIPRAKASRGVAVAMFER  91

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  92   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  151

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  152  KIIGRGS  158



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+C+ +S +L+L++F GLRG N LD ++RS Q  HS V+A  S  +G+  R V  AMFER
Sbjct  35   MMCNLRSHALRLQAFAGLRGANNLDLLSRSRQDFHSLVSAYISAPQGKACRGVPVAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  201  VEKIIGRGS  209



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+CS  Q    +++ F GLRG NALDT+  + Q  HSKV  A +  +G+ SR  VKAM
Sbjct  35   VKMMCSQLQVSGSRMQGFMGLRGRNALDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAM  94

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  95   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  154

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  155  EVEKIIGRGS  164



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrg-rgsravvKAM  256
             MLCS+    L L  FTGLR  NALD M R +GQTL SK+AA  +  +  + +R V +AM
Sbjct  34   TMLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSKIAAKNTFAKRGKHARMVPRAM  93

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
Sbjct  94   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV  153

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  154  EVEKIIGRGS  163



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  NALD   +   
Sbjct  11   IPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVNALDVSVKPRH  65

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  66   DLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  NALD   +   
Sbjct  11   IPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVNALDVSVKPRH  65

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  66   DLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N+LD+M R GQ
Sbjct  11   VPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLNSLDSMLRPGQ  67

Query  182  TLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqi  352
              HSKV       R +G   SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI
Sbjct  68   DFHSKVLTQIGTNRAKGGRGSRCVTKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI  127

Query  353  llgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  165



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N LDTM R G 
Sbjct  11   VPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFNPLDTMLRPGI  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKV+ ATS R+ R +R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFHSKVSIATSSRQARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSKVNLNISYRMEKARRCVPKAM  90

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  151  EVEKIIGRGS  160



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 114/155 (74%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  NALD   +  +
Sbjct  11   IPSVAMGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSGYTGLRSVNALDISVKPRR  65

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
             L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  66   DLFSSVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  125

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  160



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrr-grgsravvK  250
            R V M+ +SQ+P L ++SF+GLR  NA+D +AR      SKV    S R+         K
Sbjct  30   RCVKMMYTSQTPVLSIQSFSGLRSANAVDLIARPAHGFFSKVNLQISSRKGKASRCVTTK  89

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+
Sbjct  90   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDS  149

Query  431  RVEVEKIIGRGS  466
            RVEVEKIIGRGS
Sbjct  150  RVEVEKIIGRGS  161



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N LDTM R G 
Sbjct  11   VPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFNPLDTMLRPGI  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N LDTM R G 
Sbjct  11   VPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFNPLDTMLRPGI  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
              HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S  S  L +  ++GLR  N LDT+ R G + HSKVA   S R+ +  R V +AMF
Sbjct  34   VKMMSSLPSRGLVMSGYSGLRSANCLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMF  93

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  94   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  153

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  154  VEKIIGRGS  162



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            ML     PSL LR F+GLR  NALD+M RS    HS V AA S  RG+ SR V  AMFER
Sbjct  33   MLFHVPFPSLLLRGFSGLRASNALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFER  92

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  93   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  152

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  153  KIIGRGS  159



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            ML     PSL LR F+GLR  NALD+M RS    HS V AA S  RG+ SR V  AMFER
Sbjct  62   MLFHVPFPSLLLRGFSGLRASNALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFER  121

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  122  FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  181

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  182  KIIGRGS  188



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  74   RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  250
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   KV  A +  +G+GSR VVK
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVK  92

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  152

Query  431  RVEVEKIIGRGS  466
            RVEVEKIIGRGS
Sbjct  153  RVEVEKIIGRGS  164



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +2

Query  80   VAMLCSSQ--SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   KV  A +  +G+GSR VVKA
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGKVRHAMNVPKGKGSRGVVKA  94

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  155  VEVEKIIGRGS  165



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  256
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSKVNLNISSRIEKARRCVPKAM  90

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  151  EVEKIIGRGS  160



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N LDTM R G 
Sbjct  11   VPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFNPLDTMLRPGI  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
               SKV+ ATS RRGR +R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   DFRSKVSIATSARRGRATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  126

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  127  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  161



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+C+ +   L+L+ F GLRG N LD ++RS +  HS V+A  S  + +  R V  AMFER
Sbjct  35   MMCNMRLHPLRLQGFAGLRGSNNLDLLSRSRRDFHSVVSAYISAPQAKACRGVPVAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R+  M+C+ +   L+L  FTGLR  NALD   +SG+  HS ++A     RGR  R V KA
Sbjct  30   RLTLMMCNVRVSPLRLHGFTGLRQLNALDFPYKSGKDFHSLISALNPASRGRAKRVVPKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  150  IEVEKIIGRGS  160



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAM  256
             MLCS+Q  +++L+SF+GLR  N+LD M  +   TL SKVAAA +  R  R SR   +AM
Sbjct  34   TMLCSTQPTAIRLQSFSGLRRANSLDIMVWQPRHTLQSKVAAAIAPVRQGRKSRMAPRAM  93

Query  257  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  436
            FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKDAR+
Sbjct  94   FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKDARI  153

Query  437  EVEKIIGRGS  466
            EVEKIIGRGS
Sbjct  154  EVEKIIGRGS  163



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  176  VEKIIGRGS  184



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  250
            R V M+ +SQ+  L ++SF+GLR  NALD +AR       KV    S  R   +   V K
Sbjct  30   RCVKMMYTSQTSVLSIQSFSGLRASNALDRVARPSHDFFGKVNLQMSSSRREKASRGVTK  89

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+
Sbjct  90   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDS  149

Query  431  RVEVEKIIGRGS  466
            RVEVEKIIGRGS
Sbjct  150  RVEVEKIIGRGS  161



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 114/158 (72%), Gaps = 5/158 (3%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N+LD+M R  Q
Sbjct  11   VPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLNSLDSMFRPRQ  68

Query  182  TLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqi  352
              HSKV       R RG   SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI
Sbjct  69   DFHSKVLTQIGTNRARGGRGSRCVTRAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI  128

Query  353  llgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LLGLIGEGTGI AKVLKSMGINLKD+RVEVEKIIGRGS
Sbjct  129  LLGLIGEGTGIGAKVLKSMGINLKDSRVEVEKIIGRGS  166



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  176  VEKIIGRGS  184



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  176  VEKIIGRGS  184



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  84

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  85   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  144

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  145  VEKIIGRGS  153



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ + +  S++L+ F GLRG N LD ++RS +  HS V+A  S  +G+  R V  AMFER
Sbjct  35   MMYNMRLHSIRLQGFAGLRGSNNLDLLSRSRRDFHSVVSAYISAPQGKACRGVPVAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +2

Query  80   VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  259
            V M+ S  +P L +R+++GLR  +ALD MA       +KV  + S R+G+ SR V KAMF
Sbjct  32   VKMMSSLHAPVLSIRNYSGLRVNSALDLMASRSPDFFAKVNISISSRKGKASRCVPKAMF  91

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  92   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  151

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  152  VEKIIGRGS  160



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ S +   L+L+SF GLR  + LD  +R  Q  HS V+   S  RG+ +R V KAMFER
Sbjct  35   MVRSMRMHPLRLQSFAGLRAADNLDFSSRCQQDFHSVVSRYISNPRGKATRGVPKAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+ + + P+L++ SF+GLR  N LD+++R   T        T+ RR R  R V KA
Sbjct  31   RSVKMMSTLRIPALRMSSFSGLRTLNPLDSVSRPRHTF----PLTTTSRRERAKRCVPKA  86

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  147  VEVEKIIGRGS  157



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+ + + P+L++ SF+GLR  N LD+++R   T        T+ RR R  R V KA
Sbjct  31   RSVKMMSTLRIPALRMSSFSGLRTLNPLDSVSRPRHTF----PLTTTSRRERAKRCVPKA  86

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  147  VEVEKIIGRGS  157



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 120/155 (77%), Gaps = 8/155 (5%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N +D+++R   
Sbjct  11   MPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLNPMDSLSRPRH  66

Query  182  TLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillg  361
            T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG
Sbjct  67   TF----PLNTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLG  122

Query  362  ligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  123  LIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  157



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+C  Q   L+L  F GLR  + L+  +R+    HS V+   S   G+ SR V KAMFER
Sbjct  35   MMCQLQMHPLRLPGFAGLRRADNLEFFSRNRHDFHSLVSVYVSYAWGKASRGVAKAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+C  +  SL+L+ F GLR  + ++  +R+ +  HS V+   S  RG+ SR V KAMFER
Sbjct  35   MMCQPRKHSLRLQGFAGLRRSDNVEFSSRNQRDFHSVVSGYISYSRGKASRGVAKAMFER  94

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  95   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  154

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  155  KIIGRGS  161



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 115/158 (73%), Gaps = 6/158 (4%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  181
            +P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N+LD+M R   
Sbjct  11   VPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVNSLDSMLRPRL  67

Query  182  TLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqi  352
              HSKV       R R    +R V KAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI
Sbjct  68   DFHSKVLTQIGTNRARSGRGNRVVPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQI  127

Query  353  llgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  128  LLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  165



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R+  M+C+ +   L+++ FTGLR  NALD   +SG+  H  ++A +   RGR  R V KA
Sbjct  30   RLALMMCNVRVSPLRMQGFTGLRQLNALDFPYKSGRDFHFLISALSPTARGRAKRVVPKA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   VFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  434  VEVEKIIGRGS  466
             EVEKIIGRGS
Sbjct  150  AEVEKIIGRGS  160



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 114/161 (71%), Gaps = 11/161 (7%)
 Frame = +2

Query  2    IPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNALDTMA-RSG  178
            +PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG NALD M  RSG
Sbjct  11   LPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGANALDVMVQRSG  66

Query  179  QTLHSKvaaats-----grrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  343
            QTL SKVAA  S       R            E F  KAIKVIMLAQEEARRLGHNFVGT
Sbjct  67   QTLQSKVAATNSGKRGRKLRMAXXXXXXXXXXEGFX-KAIKVIMLAQEEARRLGHNFVGT  125

Query  344  eqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  126  EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  166



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGG-NALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMF  259
            M+ +SQ+  L ++SF+GLR   NALD +AR       KV    S  R   +   V KAMF
Sbjct  35   MMYTSQTSVLSIQSFSGLRASSNALDRVARPSHDFFGKVNLQISSSRKGKASRGVTKAMF  94

Query  260  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  439
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  95   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  154

Query  440  VEKIIGRGS  466
            VEKIIGRGS
Sbjct  155  VEKIIGRGS  163



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ +  + +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFER
Sbjct  34   MVRNMPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFER  93

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  94   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  153

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  154  KIIGRGS  160



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R V M+   Q  + ++ SF+GLR  NALDT      +  +   ++  G+ GR    VVKA
Sbjct  31   RNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKA  90

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  151  VEVEKIIGRGS  161



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+CS +S  L+   FTGL+G N L  ++   +     V+A+ S  +G+ SR V  AMFER
Sbjct  34   MMCSRRSSQLRFLGFTGLKGSNDLHLVSGPSKDFRLAVSASVSAPKGKASRGVAVAMFER  93

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR+EVE
Sbjct  94   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARIEVE  153

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  154  KIIGRGS  160



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+C  Q   L+L+ F GLR  + L + +R  Q  HS V+   +  RGR SR V KAMFER
Sbjct  35   MICQLQMHPLRLQGFAGLRVADNLFS-SRHRQDFHSVVSGYITNPRGRPSRLVTKAMFER  93

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEVE
Sbjct  94   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVE  153

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  154  KIIGRGS  160



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA+  +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVASQLARPRGKGSRMVVRAMFE  92

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  153  EKIIGRGS  160



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA   +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVAHQLARPRGKGSRMVVRAMFE  92

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  153  EKIIGRGS  160



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  143  GGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  322
            G N LDT+ RS Q+   KV  A +  +G+GSR VVKAMFERFTEKAIKVIMLAQEEARRL
Sbjct  4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL  63

Query  323  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  111



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  274
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  275  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  454
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  455  GRGS  466
            GRGS
Sbjct  152  GRGS  155



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  274
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  275  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  454
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  455  GRGS  466
            GRGS
Sbjct  152  GRGS  155



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             ML S+ + +L L  F GLR  N LDT +   +     VA+  S  RG  SR VV+AMFE
Sbjct  30   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGYIVASQISRPRGSASRGVVRAMFE  89

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  150  EKIIGRGS  157



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             ML S+ + +L L  F GLR  N LDT +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  29   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQISRPRGSGSRMVVRAMFE  88

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEV
Sbjct  89   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEV  148

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  149  EKIIGRGS  156



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S +  +++ +F GLR  ++   +  S     S VA+    RRGR +  V +A
Sbjct  80   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAVRSS--NFRSTVASYRFSRRGRRASFVTRA  137

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  197

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  198  VEVEKIIGRGN  208



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ ++ + +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFE
Sbjct  33   TMVRNTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFE  92

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKV+KSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVMKSMGINLKDARVEV  152

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  153  EKIIGRGS  160



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  164  MARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  343
            M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGT
Sbjct  1    MLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGT  60

Query  344  eqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  61   EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  101



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ +  + +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFE
Sbjct  33   TMVRNMPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGSIVASQIARPRGSASRGVVRAMFE  92

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  153  EKIIGRGS  160



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ +  + +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFE
Sbjct  33   TMVRNMPARTLTLGGFQGLRQTNFLDTRSVIKRDFVSIVASQIARPRGSASRGVVRAMFE  92

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  153  EKIIGRGS  160



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  30   TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  89

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  150  EKIIGRGS  157



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  30   TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  89

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  150  EKIIGRGS  157



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  60

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  121  KIIGRGS  127



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  262
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  145  TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  204

Query  263  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  442
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  205  RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  264

Query  443  EKIIGRGS  466
            EKIIGRGS
Sbjct  265  EKIIGRGS  272



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  265
            M+ +  + +L L  F GLR  N LD+ +   +   + VA+  S  RG  SR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVVKRDFGAIVASQISRHRGSASRGVVRAMFER  60

Query  266  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  445
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  446  KIIGRGS  466
            KIIGRGS
Sbjct  121  KIIGRGS  127



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S +  +++ +F GLR  ++   M  S     S VA+    RRGR +  V +A
Sbjct  31   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAMRSS--NFRSTVASYRFSRRGRRASFVTRA  88

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  148

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  149  VEVEKIIGRGN  159



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S +  +++ +F GLR  ++    A       S VA+  S RRGR +R V +A
Sbjct  31   RPASMLAMSLNRPVRMAAFVGLRSAHSF--TATPASNYRSTVASYRSSRRGRRTRFVTRA  88

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLVGEGTGIAAKVLKSMGINLKDAR  148

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  149  VEVEKIIGRGN  159



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S RR R SR V +A
Sbjct  31   RPASMLAMSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRRTRRSRFVTRA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  150  VEVEKIIGRGN  160



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S R+ R SR V +A
Sbjct  31   RPASMLAVSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRQTRRSRFVTQA  89

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  150  VEVEKIIGRGN  160



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S S  +K+ +F GLR  ++   M  S         A+   RRGR +R V ++
Sbjct  31   RPPSMLAMSLSRPVKMAAFVGLRSVHSFSVMPVSN---FRSTVASYRSRRGRRTRFVTRS  87

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  88   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  147

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  148  VEVEKIIGRGN  158



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +2

Query  116  KLRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKV  289
            + +SF+G+R G+ +D +  + G+   S VA +T+          V  AMFERFTEKAIKV
Sbjct  50   RFQSFSGMRKGSVVDALVVKQGKDFKSVVANSTAVTGHSRPSRGVTTAMFERFTEKAIKV  109

Query  290  IMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGS
Sbjct  110  IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGS  168



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 102/142 (72%), Gaps = 11/142 (8%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLK---------LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrr  223
            R +A   S+   +LK          +SF+G+R  +A+D +  + G+ L S VA + +   
Sbjct  30   RTIAQAASTGRKNLKKSASLSVSGFQSFSGMRKASAVDALTVKQGKDLKSVVAKSMAVAG  89

Query  224  grgsravvK-AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVL  400
                   V  AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVL
Sbjct  90   HSRPSRGVTFAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVL  149

Query  401  KSMGINLKDARVEVEKIIGRGS  466
            KSMG+NLK+ARVEVEKIIGRGS
Sbjct  150  KSMGVNLKEARVEVEKIIGRGS  171



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  119  LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  295
            L+++ G+R  + LD++A R+ +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  21   LQTYVGMRKPSPLDSLATRTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  80

Query  296  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGS
Sbjct  81   LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGS  137



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/73 (99%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
 Frame = +2

Query  248  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  427
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  63   RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  122

Query  428  ARVEVEKIIGRGS  466
            ARVEVEKIIGRGS
Sbjct  123  ARVEVEKIIGRGS  135



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S S  +K+ +F GLR   ++ + + +  T      A+   RRGR +R V ++
Sbjct  31   RPPSMLAMSLSRPVKMAAFVGLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRS  87

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  88   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  147

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  148  VEVEKIIGRGN  158



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +2

Query  248  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  427
            K+MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  73   KSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  132

Query  428  ARVEVEKIIGRGS  466
            ARVEVEKIIGRGS
Sbjct  133  ARVEVEKIIGRGS  145



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +2

Query  74   RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  253
            R  +ML  S S  +K+ +F GLR   ++ + + +  T      A+   RRGR +R V ++
Sbjct  524  RPPSMLAMSLSRPVKMAAFVGLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRS  580

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  581  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  640

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRG+
Sbjct  641  VEVEKIIGRGN  651



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/73 (95%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
 Frame = +2

Query  248  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  427
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  428  ARVEVEKIIGRGS  466
            AR+EVEKIIGRGS
Sbjct  74   ARIEVEKIIGRGS  86



>dbj|BAD79443.1| ATP-dependent Clp protease regulatory subunit ClpC [Synechococcus 
elongatus PCC 6301]
Length=839

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/73 (95%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
 Frame = +2

Query  248  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  427
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  428  ARVEVEKIIGRGS  466
            AR+EVEKIIGRGS
Sbjct  74   ARIEVEKIIGRGS  86



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  33   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  92

Query  431  RVEVEKIIGRGS  466
            R+EVEKIIGRGS
Sbjct  93   RIEVEKIIGRGS  104



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  431  RVEVEKIIGRGS  466
            R+EVEKIIGRGS
Sbjct  76   RIEVEKIIGRGS  87



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +2

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDA
Sbjct  78   AMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDA  137

Query  431  RVEVEKIIGRGS  466
            RVEVEKIIGRGS
Sbjct  138  RVEVEKIIGRGS  149



>ref|WP_032555672.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518A6]
Length=69

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  434  VEVEKIIGR  460
            +EVEKIIGR
Sbjct  61   IEVEKIIGR  69



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  431  RVEVEKIIGRGS  466
            R+EVEKIIGRGS
Sbjct  76   RIEVEKIIGRGS  87



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  119  LRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  295
            L+++ G+R  + LD++A S  +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  57   LQTYVGMRKPSPLDSLATSTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  116

Query  296  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  466
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGS
Sbjct  117  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGS  173



>gb|EHC12174.1| ATPase AAA-2 domain protein [Fischerella sp. JSC-11]
Length=851

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  251  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  430
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  29   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  88

Query  431  RVEVEKIIGRGS  466
            R+EVEKIIGRGS
Sbjct  89   RIEVEKIIGRGS  100



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_044105586.1| Clp protease ClpX [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP16974.1| ATP-dependent Clp protease regulatory subunit [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=823

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNF+GTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFMGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>gb|EMT29575.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4B 
protein, chloroplastic [Aegilops tauschii]
Length=1027

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/73 (97%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
 Frame = +2

Query  248  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  427
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  224  RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  283

Query  428  ARVEVEKIIGRGS  466
            ARVEVEKIIGRGS
Sbjct  284  ARVEVEKIIGRGS  296



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_010317861.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0205]
Length=850

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>gb|AHF63374.1| ATPase [Synechococcus sp. WH 8109]
Length=846

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|NP_050661.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
 sp|O78410.1|CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Guillardia theta]
 gb|AAC35595.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
Length=819

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_006041704.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 7805]
 gb|EAR18013.1| ATPase [Synechococcus sp. WH 7805]
Length=857

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_011935205.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RCC307]
 emb|CAK27691.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Synechococcus 
sp. RCC307]
Length=852

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_011618961.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9311]
 gb|ABI47413.1| putative Clp protease, ATP-binding subunit ClpC [Synechococcus 
sp. CC9311]
Length=860

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|YP_001293474.1| Clp protease ATP binding subunit [Rhodomonas salina]
 gb|ABO70723.1| Clp protease ATP binding subunit [Rhodomonas salina]
Length=819

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            VEVEKIIGRGS
Sbjct  61   VEVEKIIGRGS  71



>ref|XP_007509860.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18975.1| predicted protein [Bathycoccus prasinos]
Length=944

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 12/126 (10%)
 Frame = +2

Query  125  SFTGLRGGNALD---TMARSGQ---------TLHSKvaaatsgrrgrgsravvKAMFERF  268
            +F+GLR  NA+D   T++R+G          +  S  ++++SG++        +AMFERF
Sbjct  51   NFSGLRSTNAIDMTSTLSRNGNFKGVTSRQLSTKSGSSSSSSGKKLGAVIKGPRAMFERF  110

Query  269  TEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEK  448
            TEKAIKV+MLAQEEARRLGHNFVGTEQI+LGLIGEGTGIAAKVLKSMGI+LK+ARVEVEK
Sbjct  111  TEKAIKVVMLAQEEARRLGHNFVGTEQIMLGLIGEGTGIAAKVLKSMGISLKEARVEVEK  170

Query  449  IIGRGS  466
            IIGRGS
Sbjct  171  IIGRGS  176



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_039726508.1| MULTISPECIES: Clp protease ClpX [Oscillatoriophycideae]
 gb|KIF14711.1| Clp protease ClpX [Aphanocapsa montana BDHKU210001]
 gb|KIF39633.1| Clp protease ClpX [Lyngbya confervoides BDU141951]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_037222416.1| Clp protease ClpX [Richelia intracellularis]
 emb|CDN15062.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_009626822.1| ATPase AAA-2 domain protein [Pseudanabaena biceps]
 gb|ELS33048.1| ATPase AAA-2 domain protein [Pseudanabaena biceps PCC 7429]
Length=829

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_017741509.1| ATP-dependent Clp protease ATP-binding protein [Scytonema hofmanni]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_026097796.1| Clp protease ClpX [Geitlerinema sp. PCC 7105]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_011612018.1| ATP-dependent Clp protease ATP-binding protein [Trichodesmium 
erythraeum]
 gb|ABG51652.1| ATPase AAA-2 [Trichodesmium erythraeum IMS101]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_017318713.1| ATP-dependent Clp protease ATP-binding protein [Mastigocladopsis 
repens]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>gb|AGW80480.1| Clp protease ATP binding subunit [Planktothrix agardhii NIVA-CYA 
68]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015206692.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale]
 gb|AFZ23436.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale PCC 7417]
Length=823

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_036485541.1| Clp protease ClpX [Myxosarcina sp. GI1]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_017651562.1| ATP-dependent Clp protease ATP-binding protein [Microchaete sp. 
PCC 7126]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_009784332.1| ATP-dependent Clp protease ATP-binding protein [Lyngbya sp. PCC 
8106]
 gb|EAW37092.1| ATP-dependent Clp protease regulatory subunit [Lyngbya sp. PCC 
8106]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_035153450.1| Clp protease ClpX [Calothrix sp. 336/3]
 gb|KFB83654.1| Clp protease ClpX [Calothrix sp. 336/3]
Length=822

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_041677108.1| Clp protease ClpX [Synechococcus elongatus]
Length=824

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_017293405.1| ATP-dependent Clp protease ATP-binding protein [Geminocystis 
herdmanii]
Length=824

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  254  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  433
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  434  VEVEKIIGRGS  466
            +EVEKIIGRGS
Sbjct  61   IEVEKIIGRGS  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750